F469835

General Info

Members Datasets Scaffolds Average Seq Length
619 205 1238 138

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0157022|Ga0395899_0157022_1069_1542
Length 157
Sequence MPVTRSPIWSNSQAGIEMAMNERLPFPTLGSDPQSVRQRVEAMERLLERLFVVPGLNRPIGLDVILDAVPVVGDIAAAALGAYIVWEARNLGMSKWQVARMAGNVGIDWLLGLIPWVGAIPDFFFRSNSRNLRIIKRHLDKHHPGTRTIEAEARRHD

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.75
Rhizosphere 97.09
Stem 0
Stem Tuber 0
Unclassified 5.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0157022 3300037312 Bacteria 1609
2 JGI24740J21852_10009351 3300001979 Bacteria 3845
3 JGI24740J21852_10019066 3300001979 Bacteria 2422
4 JGI24740J21852_10057275 3300001979 Bacteria 1089
5 JGI24739J22299_10032182 3300001989 Bacteria 1806
6 JGI24737J22298_10037330 3300001990 Bacteria 1498
7 JGI24735J21928_10016410 3300002067 Bacteria 2297
8 JGI24735J21928_10017707 3300002067 Bacteria 2202
9 JGI24735J21928_10111264 3300002067 Bacteria 788
10 JGI24735J21928_10130278 3300002067 Bacteria 725
11 JGI24738J21930_10014568 3300002075 Bacteria 1686
12 JGI24742J22300_10016259 3300002244 Unclassified 1255
13 Ga0065707_10622712 3300005295 Bacteria 678
14 Ga0070658_10000130 3300005327 Bacteria 66295
15 Ga0070658_10017023 3300005327 Bacteria 5817
16 Ga0070658_10020966 3300005327 Bacteria 5235
17 Ga0070658_10033970 3300005327 Bacteria 4104
18 Ga0070658_10066130 3300005327 Bacteria 2953
19 Ga0070658_10230382 3300005327 Bacteria 1568
20 Ga0070658_10395067 3300005327 Bacteria 1187
21 Ga0070676_10011590 3300005328 Bacteria 4796
22 Ga0070676_10018463 3300005328 Bacteria 3866
23 Ga0070676_10709385 3300005328 Bacteria 735
24 Ga0070683_100008548 3300005329 Bacteria 8699
25 Ga0070683_100023386 3300005329 Bacteria 5527
26 Ga0070683_100147505 3300005329 Bacteria 2230
27 Ga0070683_101455176 3300005329 Bacteria 658
28 Ga0070690_100073519 3300005330 Bacteria 2224
29 Ga0068869_100083787 3300005334 Bacteria 2385
30 Ga0070666_10002432 3300005335 Bacteria 11257
31 Ga0070666_10005625 3300005335 Bacteria 7688
32 Ga0070680_100008823 3300005336 Bacteria 7732
33 Ga0070680_100053203 3300005336 Bacteria 3304
34 Ga0070680_100164809 3300005336 Bacteria 1863
35 Ga0070680_100691198 3300005336 Bacteria 878
36 Ga0068868_100114477 3300005338 Bacteria 2194
37 Ga0068868_100358137 3300005338 Bacteria 1251
38 Ga0068868_100670652 3300005338 Bacteria 925
39 Ga0070660_100000075 3300005339 Bacteria 59407
40 Ga0070660_100003716 3300005339 Bacteria 10542
41 Ga0070660_100003741 3300005339 Bacteria 10514
42 Ga0070660_100016251 3300005339 Bacteria 5398
43 Ga0070660_100099522 3300005339 Bacteria 2302
44 Ga0070660_101496590 3300005339 Bacteria 574
45 Ga0070660_101660676 3300005339 Bacteria 544
46 Ga0070689_101332485 3300005340 Unclassified 647
47 Ga0070691_10610611 3300005341 Bacteria 645
48 Ga0070661_100000882 3300005344 Bacteria 21564
49 Ga0070661_100049744 3300005344 Bacteria 3069
50 Ga0070661_100141387 3300005344 Unclassified 1814
51 Ga0070661_100248264 3300005344 Bacteria 1372
52 Ga0070661_101280930 3300005344 Bacteria 614
53 Ga0070692_10330405 3300005345 Bacteria 941
54 Ga0070668_100009798 3300005347 Bacteria 7103
55 Ga0070668_100053761 3300005347 Bacteria 3105
56 Ga0070668_100205153 3300005347 Bacteria 1619
57 Ga0070668_100301796 3300005347 Unclassified 1343
58 Ga0070668_100381044 3300005347 Bacteria 1200
59 Ga0070668_100428807 3300005347 Unclassified 1133
60 Ga0070669_100186755 3300005353 Unclassified 1624
61 Ga0070669_100268439 3300005353 Unclassified 1363
62 Ga0070669_101907339 3300005353 Bacteria 519
63 Ga0070675_100057377 3300005354 Bacteria 3210
64 Ga0070671_100001544 3300005355 Bacteria 17311
65 Ga0070671_100033017 3300005355 Bacteria 4278
66 Ga0070671_100197768 3300005355 Bacteria 1704
67 Ga0070674_100067775 3300005356 Bacteria 2511
68 Ga0070674_100117031 3300005356 Bacteria 1967
69 Ga0070674_100584787 3300005356 Bacteria 941
70 Ga0070674_100643862 3300005356 Bacteria 900
71 Ga0070673_100004701 3300005364 Bacteria 8666
72 Ga0070673_100064103 3300005364 Bacteria 2926
73 Ga0070673_100083185 3300005364 Bacteria 2600
74 Ga0070659_100000084 3300005366 Bacteria 71138
75 Ga0070659_100008782 3300005366 Bacteria 7399
76 Ga0070659_100016609 3300005366 Bacteria 5528
77 Ga0070659_100387615 3300005366 Unclassified 1178
78 Ga0070659_100423399 3300005366 Bacteria 1126
79 Ga0070659_101318110 3300005366 Bacteria 640
80 Ga0070659_101745906 3300005366 Bacteria 557
81 Ga0070667_100019436 3300005367 Bacteria 5636
82 Ga0070667_100040532 3300005367 Bacteria 3905
83 Ga0070667_100123392 3300005367 Bacteria 2255
84 Ga0070667_100296460 3300005367 Bacteria 1455
85 Ga0070667_100324312 3300005367 Bacteria 1390
86 Ga0070667_100439955 3300005367 Unclassified 1190
87 Ga0070663_100000440 3300005455 Bacteria 22000
88 Ga0070663_100002673 3300005455 Bacteria 10095
89 Ga0070663_100055943 3300005455 Bacteria 2825
90 Ga0070663_100613869 3300005455 Bacteria 916
91 Ga0070678_100001074 3300005456 Bacteria 14303
92 Ga0070678_100071676 3300005456 Bacteria 2594
93 Ga0070678_100689936 3300005456 Bacteria 919
94 Ga0070678_101281479 3300005456 Bacteria 681
95 Ga0070662_100000058 3300005457 Bacteria 59818
96 Ga0070662_100002595 3300005457 Bacteria 11141
97 Ga0070662_100010796 3300005457 Bacteria 6013
98 Ga0070662_100132824 3300005457 Bacteria 1921
99 Ga0070662_100260148 3300005457 Bacteria 1398
100 Ga0070662_100740309 3300005457 Bacteria 833
101 Ga0070681_10054174 3300005458 Bacteria 3996
102 Ga0070681_10130378 3300005458 Bacteria 2446
103 Ga0070681_10396589 3300005458 Bacteria 1291
104 Ga0070681_10455221 3300005458 Bacteria 1192
105 Ga0068867_100096951 3300005459 Unclassified 2246
106 Ga0068867_100117114 3300005459 Bacteria 2054
107 Ga0070685_10077557 3300005466 Bacteria 1984
108 Ga0070706_100898142 3300005467 Bacteria 819
109 Ga0070679_100081500 3300005530 Bacteria 3225
110 Ga0070679_100369277 3300005530 Bacteria 1382
111 Ga0070684_100004713 3300005535 Bacteria 10417
112 Ga0070684_100019198 3300005535 Bacteria 5652
113 Ga0070684_100059811 3300005535 Bacteria 3332
114 Ga0070684_100202979 3300005535 Bacteria 1806
115 Ga0068853_100003940 3300005539 Bacteria 11400
116 Ga0068853_100006461 3300005539 Bacteria 9319
117 Ga0068853_100074152 3300005539 Bacteria 2969
118 Ga0068853_100634709 3300005539 Bacteria 1016
119 Ga0068853_100739858 3300005539 Bacteria 939
120 Ga0070672_100004242 3300005543 Bacteria 9373
121 Ga0070672_100050536 3300005543 Bacteria 3238
122 Ga0070672_100057683 3300005543 Bacteria 3048
123 Ga0070672_100068085 3300005543 Bacteria 2823
124 Ga0070686_101382895 3300005544 Unclassified 590
125 Ga0070696_100304699 3300005546 Bacteria 1221
126 Ga0070696_100779851 3300005546 Unclassified 785
127 Ga0070693_100004555 3300005547 Bacteria 6573
128 Ga0070665_100003576 3300005548 Bacteria 16470
129 Ga0070665_100005110 3300005548 Bacteria 13605
130 Ga0070665_100013915 3300005548 Bacteria 8092
131 Ga0070665_100040476 3300005548 Bacteria 4684
132 Ga0070665_100055080 3300005548 Bacteria 3989
133 Ga0070665_101033911 3300005548 Bacteria 833
134 Ga0068855_100019280 3300005563 Bacteria 8199
135 Ga0068855_100042872 3300005563 Bacteria 5362
136 Ga0068855_100216113 3300005563 Bacteria 2152
137 Ga0068855_100246878 3300005563 Bacteria 1992
138 Ga0068855_100420715 3300005563 Bacteria 1461
139 Ga0068855_100591469 3300005563 Bacteria 1198
140 Ga0068855_100615715 3300005563 Bacteria 1169
141 Ga0070664_100000032 3300005564 Bacteria 88298
142 Ga0070664_100005333 3300005564 Bacteria 10317
143 Ga0070664_100010573 3300005564 Bacteria 7480
144 Ga0070664_100029580 3300005564 Bacteria 4567
145 Ga0070664_100425530 3300005564 Unclassified 1217
146 Ga0070664_101059883 3300005564 Bacteria 763
147 Ga0070664_101129374 3300005564 Bacteria 738
148 Ga0068857_100012379 3300005577 Bacteria 7426
149 Ga0068854_100014800 3300005578 Bacteria 5150
150 Ga0068854_100033082 3300005578 Bacteria 3603
151 Ga0068854_100630886 3300005578 Bacteria 918
152 Ga0068856_100000161 3300005614 Bacteria 69696
153 Ga0068856_100090963 3300005614 Bacteria 3036
154 Ga0068856_100281709 3300005614 Bacteria 1679
155 Ga0068856_100979884 3300005614 Bacteria 864
156 Ga0068852_100001870 3300005616 Bacteria 14325
157 Ga0068852_100013250 3300005616 Bacteria 6304
158 Ga0068852_100033821 3300005616 Bacteria 4249
159 Ga0068852_100057720 3300005616 Bacteria 3359
160 Ga0068852_100111824 3300005616 Bacteria 2484
161 Ga0068852_100214408 3300005616 Bacteria 1828
162 Ga0068852_100339458 3300005616 Bacteria 1464
163 Ga0068859_100020226 3300005617 Bacteria 6682
164 Ga0068859_100333440 3300005617 Bacteria 1611
165 Ga0068859_102428314 3300005617 Bacteria 577
166 Ga0068864_100008096 3300005618 Bacteria 8668
167 Ga0068864_100008774 3300005618 Bacteria 8335
168 Ga0068864_100270926 3300005618 Bacteria 1582
169 Ga0068866_10229625 3300005718 Bacteria 1125
170 Ga0068861_100083075 3300005719 Bacteria 2511
171 Ga0068851_10030390 3300005834 Bacteria 2679
172 Ga0068851_10064780 3300005834 Bacteria 1879
173 Ga0068851_10706425 3300005834 Bacteria 621
174 Ga0068870_10256733 3300005840 Bacteria 1086
175 Ga0068870_10389698 3300005840 Unclassified 904
176 Ga0068863_100015256 3300005841 Bacteria 7384
177 Ga0068863_100137528 3300005841 Bacteria 2334
178 Ga0068858_100032114 3300005842 Bacteria 4877
179 Ga0068858_100070220 3300005842 Bacteria 3246
180 Ga0068858_100965672 3300005842 Unclassified 834
181 Ga0068858_101162521 3300005842 Bacteria 758
182 Ga0068860_100005579 3300005843 Bacteria 12718
183 Ga0068860_100197949 3300005843 Bacteria 1946
184 Ga0068860_101552560 3300005843 Bacteria 684
185 Ga0068860_101694118 3300005843 Bacteria 654
186 Ga0068862_100006729 3300005844 Bacteria 9533
187 Ga0068862_100031118 3300005844 Bacteria 4502
188 Ga0068862_100577635 3300005844 Unclassified 1076
189 Ga0068862_100694063 3300005844 Unclassified 985
190 Ga0081539_10072198 3300005985 Bacteria 1846
191 Ga0081539_10150294 3300005985 Bacteria 1121
192 Ga0075427_10052183 3300006194 Bacteria 705
193 Ga0097621_100002273 3300006237 Bacteria 13155
194 Ga0097621_100072520 3300006237 Bacteria 2848
195 Ga0097621_100318458 3300006237 Bacteria 1377
196 Ga0097621_101329818 3300006237 Bacteria 679
197 Ga0068871_100012063 3300006358 Bacteria 6359
198 Ga0068871_100584251 3300006358 Bacteria 1014
199 Ga0068871_101193296 3300006358 Bacteria 714
200 Ga0068865_100014521 3300006881 Bacteria 5006
201 Ga0068865_100257278 3300006881 Bacteria 1380
202 Ga0068865_100905831 3300006881 Unclassified 767
203 Ga0097620_100020226 3300006931 Bacteria 6682
204 Ga0097620_100333437 3300006931 Bacteria 1611
205 Ga0097620_102428361 3300006931 Bacteria 577
206 Ga0075435_101736643 3300007076 Bacteria 548
207 Ga0105240_10075618 3300009093 Bacteria 4154
208 Ga0105240_11566655 3300009093 Bacteria 690
209 Ga0105245_10273263 3300009098 Bacteria 1649
210 Ga0114129_11168022 3300009147 Unclassified 960
211 Ga0105243_10118692 3300009148 Bacteria 2226
212 Ga0105243_10931326 3300009148 Unclassified 866
213 Ga0105241_10231901 3300009174 Bacteria 1556
214 Ga0105248_10000223 3300009177 Bacteria 65010
215 Ga0105248_10009313 3300009177 Bacteria 10812
216 Ga0105248_10114288 3300009177 Bacteria 3045
217 Ga0105248_10190591 3300009177 Bacteria 2310
218 Ga0105237_12118112 3300009545 Bacteria 572
219 Ga0105238_10261354 3300009551 Bacteria 1710
220 Ga0105238_12269905 3300009551 Bacteria 578
221 Ga0105249_10086749 3300009553 Bacteria 2919
222 Ga0105249_10243019 3300009553 Unclassified 1781
223 Ga0105249_11303195 3300009553 Bacteria 798
224 Ga0157373_10020082 3300013100 Bacteria 4860
225 Ga0157373_10047016 3300013100 Bacteria 3078
226 Ga0157373_10052326 3300013100 Bacteria 2906
227 Ga0157373_10225878 3300013100 Bacteria 1321
228 Ga0157373_10238176 3300013100 Bacteria 1286
229 Ga0157373_10942489 3300013100 Bacteria 642
230 Ga0157371_10006556 3300013102 Bacteria 9571
231 Ga0157371_10054077 3300013102 Bacteria 2852
232 Ga0157371_10070048 3300013102 Bacteria 2483
233 Ga0157371_10190539 3300013102 Bacteria 1468
234 Ga0157371_10193978 3300013102 Bacteria 1455
235 Ga0157371_10257778 3300013102 Bacteria 1257
236 Ga0157371_10497833 3300013102 Bacteria 900
237 Ga0157371_10508888 3300013102 Bacteria 890
238 Ga0157370_10111012 3300013104 Bacteria 2563
239 Ga0157370_10112075 3300013104 Bacteria 2550
240 Ga0157370_10179680 3300013104 Bacteria 1966
241 Ga0157370_10333562 3300013104 Bacteria 1398
242 Ga0157370_10409568 3300013104 Bacteria 1248
243 Ga0157369_10006870 3300013105 Bacteria 13128
244 Ga0157369_10078237 3300013105 Bacteria 3544
245 Ga0157369_10086267 3300013105 Bacteria 3352
246 Ga0157369_10325268 3300013105 Bacteria 1598
247 Ga0157369_10370965 3300013105 Bacteria 1486
248 Ga0157369_11017943 3300013105 Bacteria 848
249 Ga0157369_11745109 3300013105 Bacteria 632
250 Ga0157374_10044572 3300013296 Bacteria 4100
251 Ga0157374_10066675 3300013296 Bacteria 3383
252 Ga0157374_10289591 3300013296 Bacteria 1618
253 Ga0157378_11548074 3300013297 Bacteria 708
254 Ga0163162_10002607 3300013306 Bacteria 17093
255 Ga0163162_10068537 3300013306 Bacteria 3599
256 Ga0163162_10093991 3300013306 Bacteria 3084
257 Ga0157372_10007165 3300013307 Bacteria 11868
258 Ga0157372_10113809 3300013307 Bacteria 3101
259 Ga0157372_10508122 3300013307 Bacteria 1405
260 Ga0157372_11617336 3300013307 Bacteria 746
261 Ga0157372_12023944 3300013307 Bacteria 662
262 Ga0157375_10028216 3300013308 Bacteria 5257
263 Ga0157375_10202522 3300013308 Bacteria 2141
264 Ga0157375_10480127 3300013308 Bacteria 1408
265 Ga0163163_10000371 3300014325 Bacteria 43097
266 Ga0163163_10004898 3300014325 Bacteria 11515
267 Ga0157380_10013699 3300014326 Bacteria 5920
268 Ga0157380_10114676 3300014326 Bacteria 2271
269 Ga0182008_10296244 3300014497 Bacteria 845
270 Ga0157377_10018985 3300014745 Bacteria 3585
271 Ga0157379_11050957 3300014968 Bacteria 778
272 Ga0157376_11826820 3300014969 Bacteria 644
273 Ga0163161_10009313 3300017792 Bacteria 6794
274 Ga0207697_10028805 3300025315 Bacteria 2272
275 Ga0207697_10065600 3300025315 Unclassified 1515
276 Ga0207697_10390264 3300025315 Bacteria 618
277 Ga0207656_10052637 3300025321 Bacteria 1764
278 Ga0207656_10181431 3300025321 Bacteria 1010
279 Ga0207688_10045895 3300025901 Bacteria 2438
280 Ga0207680_10035754 3300025903 Bacteria 2855
281 Ga0207680_10321751 3300025903 Bacteria 1082
282 Ga0207647_10003878 3300025904 Bacteria 11181
283 Ga0207647_10012508 3300025904 Bacteria 5906
284 Ga0207647_10036127 3300025904 Bacteria 3142
285 Ga0207647_10126409 3300025904 Bacteria 1504
286 Ga0207645_10014880 3300025907 Bacteria 5190
287 Ga0207645_10728625 3300025907 Bacteria 674
288 Ga0207643_10193979 3300025908 Unclassified 1234
289 Ga0207705_10000200 3300025909 Bacteria 60434
290 Ga0207705_10012684 3300025909 Bacteria 6081
291 Ga0207705_10049670 3300025909 Bacteria 3019
292 Ga0207705_10063505 3300025909 Bacteria 2668
293 Ga0207705_10082998 3300025909 Bacteria 2337
294 Ga0207705_10215135 3300025909 Bacteria 1458
295 Ga0207705_10380524 3300025909 Bacteria 1090
296 Ga0207684_10273552 3300025910 Bacteria 1457
297 Ga0207654_10156650 3300025911 Bacteria 1467
298 Ga0207707_10013218 3300025912 Bacteria 7193
299 Ga0207707_10133233 3300025912 Bacteria 2174
300 Ga0207707_10144229 3300025912 Bacteria 2081
301 Ga0207707_10211975 3300025912 Bacteria 1687
302 Ga0207695_10023725 3300025913 Bacteria 6923
303 Ga0207695_10090417 3300025913 Bacteria 3077
304 Ga0207671_10029345 3300025914 Bacteria 4107
305 Ga0207660_10003824 3300025917 Bacteria 9812
306 Ga0207660_10135188 3300025917 Bacteria 1880
307 Ga0207660_10405260 3300025917 Bacteria 1098
308 Ga0207660_10488565 3300025917 Bacteria 998
309 Ga0207657_10000164 3300025919 Bacteria 67184
310 Ga0207657_10000856 3300025919 Bacteria 32149
311 Ga0207657_10002745 3300025919 Bacteria 18961
312 Ga0207657_10008436 3300025919 Bacteria 10455
313 Ga0207657_10012539 3300025919 Bacteria 8360
314 Ga0207657_10030342 3300025919 Bacteria 4908
315 Ga0207657_10036255 3300025919 Bacteria 4416
316 Ga0207657_10097994 3300025919 Bacteria 2437
317 Ga0207649_10000043 3300025920 Bacteria 115777
318 Ga0207649_10001075 3300025920 Bacteria 16675
319 Ga0207649_10081928 3300025920 Bacteria 2091
320 Ga0207649_10412757 3300025920 Bacteria 1013
321 Ga0207649_10431344 3300025920 Bacteria 991
322 Ga0207652_10022384 3300025921 Bacteria 5228
323 Ga0207652_10174632 3300025921 Bacteria 1929
324 Ga0207652_10395477 3300025921 Bacteria 1247
325 Ga0207652_10578561 3300025921 Bacteria 1008
326 Ga0207681_10017557 3300025923 Bacteria 4494
327 Ga0207681_10165955 3300025923 Unclassified 1669
328 Ga0207681_11262405 3300025923 Bacteria 620
329 Ga0207694_10001883 3300025924 Bacteria 17389
330 Ga0207694_10168311 3300025924 Bacteria 1773
331 Ga0207694_11139451 3300025924 Bacteria 660
332 Ga0207650_10010570 3300025925 Bacteria 6339
333 Ga0207650_10108605 3300025925 Bacteria 2145
334 Ga0207650_10371387 3300025925 Unclassified 1180
335 Ga0207650_11664094 3300025925 Bacteria 541
336 Ga0207687_10035446 3300025927 Bacteria 3394
337 Ga0207644_10017727 3300025931 Bacteria 4813
338 Ga0207644_10040053 3300025931 Bacteria 3310
339 Ga0207644_10040797 3300025931 Bacteria 3281
340 Ga0207644_10132221 3300025931 Bacteria 1912
341 Ga0207644_10133146 3300025931 Bacteria 1906
342 Ga0207690_10000062 3300025932 Bacteria 96511
343 Ga0207690_10002095 3300025932 Bacteria 12214
344 Ga0207690_10028058 3300025932 Bacteria 3564
345 Ga0207690_10362790 3300025932 Bacteria 1148
346 Ga0207690_10593404 3300025932 Unclassified 904
347 Ga0207706_10000196 3300025933 Bacteria 67184
348 Ga0207706_10000866 3300025933 Bacteria 31146
349 Ga0207706_10013730 3300025933 Bacteria 7351
350 Ga0207706_10046640 3300025933 Bacteria 3837
351 Ga0207706_11402574 3300025933 Bacteria 574
352 Ga0207709_10076629 3300025935 Bacteria 2141
353 Ga0207669_10025916 3300025937 Bacteria 3180
354 Ga0207669_10055019 3300025937 Bacteria 2407
355 Ga0207669_10604941 3300025937 Bacteria 891
356 Ga0207704_10038289 3300025938 Bacteria 2780
357 Ga0207704_10070586 3300025938 Bacteria 2213
358 Ga0207691_10002422 3300025940 Bacteria 18263
359 Ga0207691_10059756 3300025940 Bacteria 3465
360 Ga0207691_10061715 3300025940 Bacteria 3404
361 Ga0207691_10073928 3300025940 Bacteria 3074
362 Ga0207711_10001232 3300025941 Bacteria 24279
363 Ga0207711_10006175 3300025941 Bacteria 10125
364 Ga0207711_10388746 3300025941 Bacteria 1295
365 Ga0207689_10030278 3300025942 Bacteria 4511
366 Ga0207661_10006015 3300025944 Bacteria 8571
367 Ga0207661_10374772 3300025944 Bacteria 1287
368 Ga0207661_10551170 3300025944 Bacteria 1056
369 Ga0207661_10624760 3300025944 Bacteria 989
370 Ga0207679_10000380 3300025945 Bacteria 32146
371 Ga0207679_10021718 3300025945 Bacteria 4357
372 Ga0207679_10137981 3300025945 Bacteria 1967
373 Ga0207667_10004130 3300025949 Bacteria 17846
374 Ga0207667_10006431 3300025949 Bacteria 14231
375 Ga0207667_10020593 3300025949 Bacteria 7329
376 Ga0207667_10156644 3300025949 Bacteria 2343
377 Ga0207667_10283242 3300025949 Bacteria 1693
378 Ga0207667_10291399 3300025949 Bacteria 1667
379 Ga0207651_10006332 3300025960 Bacteria 6183
380 Ga0207651_10114624 3300025960 Bacteria 2030
381 Ga0207712_10161820 3300025961 Unclassified 1740
382 Ga0207712_10164835 3300025961 Bacteria 1726
383 Ga0207712_10838802 3300025961 Bacteria 810
384 Ga0207668_10000150 3300025972 Bacteria 48022
385 Ga0207668_10183365 3300025972 Bacteria 1653
386 Ga0207668_10224904 3300025972 Bacteria 1509
387 Ga0207668_10236357 3300025972 Unclassified 1476
388 Ga0207668_10395393 3300025972 Bacteria 1167
389 Ga0207668_11404134 3300025972 Bacteria 629
390 Ga0207640_10010760 3300025981 Bacteria 5162
391 Ga0207640_10129479 3300025981 Bacteria 1822
392 Ga0207640_10230106 3300025981 Bacteria 1425
393 Ga0207640_10498502 3300025981 Bacteria 1014
394 Ga0207640_10914059 3300025981 Bacteria 767
395 Ga0207658_10020996 3300025986 Bacteria 4528
396 Ga0207658_10028395 3300025986 Bacteria 3940
397 Ga0207658_10055391 3300025986 Bacteria 2938
398 Ga0207658_10385675 3300025986 Unclassified 1228
399 Ga0207658_10599488 3300025986 Bacteria 989
400 Ga0207677_10454254 3300026023 Bacteria 1098
401 Ga0207677_10582122 3300026023 Bacteria 980
402 Ga0207703_10036465 3300026035 Bacteria 3914
403 Ga0207703_10436059 3300026035 Bacteria 1221
404 Ga0207639_10000124 3300026041 Bacteria 57560
405 Ga0207639_10019688 3300026041 Bacteria 4818
406 Ga0207639_10024653 3300026041 Bacteria 4356
407 Ga0207639_10058239 3300026041 Bacteria 2971
408 Ga0207639_10162598 3300026041 Bacteria 1883
409 Ga0207639_10246307 3300026041 Bacteria 1557
410 Ga0207639_10305680 3300026041 Bacteria 1407
411 Ga0207639_11077904 3300026041 Bacteria 753
412 Ga0207678_10002492 3300026067 Bacteria 16750
413 Ga0207678_10030174 3300026067 Bacteria 4733
414 Ga0207678_10114797 3300026067 Bacteria 2297
415 Ga0207678_10169981 3300026067 Bacteria 1861
416 Ga0207708_11502140 3300026075 Bacteria 592
417 Ga0207702_10001652 3300026078 Bacteria 22015
418 Ga0207702_10308247 3300026078 Bacteria 1504
419 Ga0207702_10644897 3300026078 Bacteria 1041
420 Ga0207702_11578825 3300026078 Bacteria 649
421 Ga0207641_10066034 3300026088 Bacteria 3096
422 Ga0207641_10136385 3300026088 Bacteria 2209
423 Ga0207648_10096886 3300026089 Unclassified 2581
424 Ga0207648_10167279 3300026089 Bacteria 1943
425 Ga0207676_10006241 3300026095 Bacteria 8414
426 Ga0207676_10045650 3300026095 Bacteria 3386
427 Ga0207674_10008190 3300026116 Bacteria 12113
428 Ga0207674_10028824 3300026116 Bacteria 5853
429 Ga0207674_10441309 3300026116 Bacteria 1258
430 Ga0207675_100501200 3300026118 Bacteria 1209
431 Ga0207683_10007362 3300026121 Bacteria 9435
432 Ga0207683_10080082 3300026121 Bacteria 2897
433 Ga0207698_10001193 3300026142 Bacteria 15146
434 Ga0207698_10005408 3300026142 Bacteria 7889
435 Ga0207698_10039952 3300026142 Bacteria 3480
436 Ga0207698_10061495 3300026142 Bacteria 2927
437 Ga0207698_10094363 3300026142 Bacteria 2460
438 Ga0207698_10214061 3300026142 Bacteria 1736
439 Ga0209967_1021050 3300027364 Bacteria 952
440 Ga0209971_1016251 3300027682 Bacteria 1765
441 Ga0209974_10000170 3300027876 Bacteria 20007
442 Ga0268266_10004016 3300028379 Bacteria 14232
443 Ga0268266_10021340 3300028379 Bacteria 5517
444 Ga0268266_10038925 3300028379 Bacteria 4048
445 Ga0268266_10040084 3300028379 Bacteria 3991
446 Ga0268266_10108328 3300028379 Bacteria 2458
447 Ga0268266_10706888 3300028379 Bacteria 971
448 Ga0268265_10003010 3300028380 Bacteria 12309
449 Ga0268265_10007372 3300028380 Bacteria 7426
450 Ga0268265_10055683 3300028380 Bacteria 3006
451 Ga0268264_10114302 3300028381 Bacteria 2369
452 Ga0268264_10178203 3300028381 Bacteria 1928
453 Ga0268264_11209543 3300028381 Bacteria 765
454 Ga0268264_12033054 3300028381 Bacteria 584
455 Ga0307408_100053607 3300031548 Bacteria 2913
456 Ga0307408_100203984 3300031548 Bacteria 1602
457 Ga0307408_100943058 3300031548 Bacteria 792
458 Ga0307405_10017875 3300031731 Bacteria 3901
459 Ga0307405_10026548 3300031731 Bacteria 3343
460 Ga0307413_10131395 3300031824 Bacteria 1714
461 Ga0307413_10194863 3300031824 Bacteria 1458
462 Ga0307410_10165100 3300031852 Bacteria 1663
463 Ga0307410_10250509 3300031852 Bacteria 1377
464 Ga0307410_10326903 3300031852 Bacteria 1218
465 Ga0307406_10051002 3300031901 Bacteria 2625
466 Ga0307406_10480360 3300031901 Bacteria 1003
467 Ga0307407_10197906 3300031903 Bacteria 1344
468 Ga0307407_10791963 3300031903 Bacteria 720
469 Ga0307412_10039503 3300031911 Bacteria 3047
470 Ga0307412_10044991 3300031911 Bacteria 2883
471 Ga0307409_100006806 3300031995 Bacteria 6763
472 Ga0307409_100010410 3300031995 Bacteria 5782
473 Ga0307409_100540865 3300031995 Bacteria 1142
474 Ga0307416_100029173 3300032002 Bacteria 4117
475 Ga0307416_100081953 3300032002 Bacteria 2731
476 Ga0307416_100144176 3300032002 Bacteria 2171
477 Ga0307416_100394325 3300032002 Bacteria 1419
478 Ga0307416_100791382 3300032002 Bacteria 1043
479 Ga0307414_10038694 3300032004 Bacteria 3206
480 Ga0307414_10041221 3300032004 Bacteria 3125
481 Ga0307414_10098666 3300032004 Bacteria 2192
482 Ga0307411_10112951 3300032005 Bacteria 1948
483 Ga0307411_10143616 3300032005 Bacteria 1763
484 Ga0307411_10249217 3300032005 Bacteria 1395
485 Ga0307415_100019483 3300032126 Bacteria 4120
486 Ga0307415_100038501 3300032126 Bacteria 3152
487 Ga0307415_100155232 3300032126 Bacteria 1767
488 Ga0373940_0137358 3300035088 Bacteria 770
489 Ga0373951_0066310 3300035091 Bacteria 912
490 Ga0373931_0038920 3300035691 Bacteria 2490
491 Ga0395899_0001919 3300037312 Bacteria 17147
492 Ga0395899_0017481 3300037312 Bacteria 5463
493 Ga0395899_0025364 3300037312 Bacteria 4475
494 Ga0395899_0030981 3300037312 Bacteria 4021
495 Ga0395899_0052799 3300037312 Bacteria 3012
496 Ga0395899_0125166 3300037312 Bacteria 1838
497 Ga0395899_0225304 3300037312 Bacteria 1297
498 Ga0395899_0517540 3300037312 Bacteria 772
499 Ga0395900_0001171 3300037418 Bacteria 32731
500 Ga0395900_0002717 3300037418 Bacteria 19339
501 Ga0395900_0004022 3300037418 Bacteria 15690
502 Ga0395900_0020668 3300037418 Bacteria 6727
503 Ga0395900_0046164 3300037418 Bacteria 4486
504 Ga0395900_0049349 3300037418 Bacteria 4336
505 Ga0395900_0058867 3300037418 Bacteria 3955
506 Ga0395900_0060965 3300037418 Bacteria 3880
507 Ga0395900_0068480 3300037418 Bacteria 3647
508 Ga0395900_0079131 3300037418 Bacteria 3377
509 Ga0395900_0103496 3300037418 Bacteria 2924
510 Ga0395900_0128553 3300037418 Bacteria 2597
511 Ga0395900_0201061 3300037418 Bacteria 2016
512 Ga0395900_0247879 3300037418 Bacteria 1783
513 Ga0395900_0412718 3300037418 Bacteria 1312
514 Ga0395900_0664442 3300037418 Bacteria 978
515 Ga0395900_1083555 3300037418 Bacteria 719
516 Ga0395898_0001741 3300037466 Bacteria 28718
517 Ga0395898_0014122 3300037466 Bacteria 8210
518 Ga0395898_0027353 3300037466 Bacteria 5727
519 Ga0395898_0073112 3300037466 Bacteria 3311
520 Ga0395898_0163818 3300037466 Bacteria 2127
521 Ga0395898_0185545 3300037466 Bacteria 1987
522 Ga0395898_0670882 3300037466 Bacteria 979
523 Ga0395898_0705445 3300037466 Bacteria 951
524 Ga0395898_0760695 3300037466 Bacteria 910
525 Ga0395898_0985582 3300037466 Bacteria 779
526 Ga0395898_1546626 3300037466 Bacteria 588
527 Ga0395905_0004734 3300037471 Bacteria 14055
528 Ga0395905_0008446 3300037471 Bacteria 10154
529 Ga0395905_0011028 3300037471 Bacteria 8744
530 Ga0395905_0016371 3300037471 Bacteria 7044
531 Ga0395905_0017320 3300037471 Bacteria 6841
532 Ga0395905_0019078 3300037471 Bacteria 6505
533 Ga0395905_0028173 3300037471 Bacteria 5294
534 Ga0395905_0035912 3300037471 Bacteria 4654
535 Ga0395905_0048975 3300037471 Bacteria 3959
536 Ga0395905_0080444 3300037471 Bacteria 3054
537 Ga0395905_0103640 3300037471 Bacteria 2671
538 Ga0395905_0130308 3300037471 Bacteria 2365
539 Ga0395905_0142390 3300037471 Bacteria 2255
540 Ga0395905_0170664 3300037471 Bacteria 2043
541 Ga0395905_0183984 3300037471 Bacteria 1961
542 Ga0395905_0232077 3300037471 Bacteria 1725
543 Ga0395905_0296687 3300037471 Bacteria 1503
544 Ga0395905_0386038 3300037471 Bacteria 1295
545 Ga0395905_1764311 3300037471 Bacteria 524
546 Ga0395901_0000140 3300038443 Bacteria 94487
547 Ga0395901_0000763 3300038443 Bacteria 36070
548 Ga0395901_0001340 3300038443 Bacteria 25815
549 Ga0395901_0011095 3300038443 Bacteria 9132
550 Ga0395901_0014941 3300038443 Bacteria 7889
551 Ga0395901_0058571 3300038443 Bacteria 4006
552 Ga0395901_0067335 3300038443 Bacteria 3729
553 Ga0395901_0088199 3300038443 Bacteria 3244
554 Ga0395901_0120157 3300038443 Bacteria 2761
555 Ga0395901_0124654 3300038443 Bacteria 2707
556 Ga0395901_0320511 3300038443 Bacteria 1604
557 Ga0395901_0348166 3300038443 Bacteria 1529
558 Ga0395901_0369066 3300038443 Bacteria 1479
559 Ga0395901_0766945 3300038443 Bacteria 956
560 Ga0395901_2012223 3300038443 Bacteria 524
561 Ga0436363_1043700 3300039450 Bacteria 960
562 Ga0439448_0004115 3300042005 Bacteria 4095
563 Ga0439455_0005145 3300042012 Bacteria 2638
564 Ga0439458_0000121 3300042157 Bacteria 16048
565 Ga0466972_0086148 3300044658 Bacteria 1493
566 Ga0466961_0217647 3300044693 Bacteria 1178
567 Ga0466963_0221786 3300044694 Bacteria 1324
568 Ga0466963_0271196 3300044694 Bacteria 1192
569 Ga0466971_0044595 3300044719 Bacteria 1991
570 Ga0466957_0171718 3300044842 Bacteria 1413
571 Ga0466957_0742952 3300044842 Bacteria 694
572 Ga0466960_0006236 3300044901 Bacteria 4775
573 Ga0466960_0011100 3300044901 Bacteria 3756
574 Ga0466960_0049289 3300044901 Bacteria 2027
575 Ga0466959_0121477 3300045049 Bacteria 1857
576 Ga0466967_0070058 3300045976 Bacteria 3136
577 Ga0466967_0083890 3300045976 Bacteria 2882
578 Ga0466967_0187198 3300045976 Bacteria 1955
579 Ga0466967_0239965 3300045976 Bacteria 1729
580 Ga0466967_0315573 3300045976 Bacteria 1506
581 Ga0466967_0316288 3300045976 Bacteria 1505
582 Ga0495596_0119316 3300046500 Bacteria 1024
583 Ga0495621_0069891 3300046539 Bacteria 1291
584 Ga0495597_0256270 3300046542 Bacteria 686
585 Ga0495668_0260433 3300046616 Bacteria 949
586 Ga0495625_0500623 3300046660 Bacteria 743
587 Ga0495669_0012380 3300046684 Bacteria 3631
588 Ga0495669_0012712 3300046684 Bacteria 3584
589 Ga0495669_0016930 3300046684 Bacteria 3127
590 Ga0495669_0020378 3300046684 Bacteria 2869
591 Ga0495669_0110463 3300046684 Bacteria 1283
592 Ga0495669_0500967 3300046684 Bacteria 590
593 Ga0495636_0178608 3300047318 Bacteria 963
594 Ga0495677_0002354 3300047445 Bacteria 7423
595 Ga0495677_0010044 3300047445 Bacteria 3484
596 Ga0496101_0254349 3300048904 Bacteria 1369
597 Ga0496101_0814695 3300048904 Bacteria 736
598 Ga0496104_0320841 3300048907 Bacteria 1462
599 Ga0496106_0530016 3300048909 Bacteria 946
600 Ga0496107_0113716 3300048910 Bacteria 1991
601 Ga0496107_0171165 3300048910 Bacteria 1612
602 Ga0496107_0639038 3300048910 Bacteria 785
603 Ga0496108_0009557 3300048911 Bacteria 7861
604 Ga0496108_0034723 3300048911 Bacteria 4190
605 Ga0496109_0009641 3300048912 Bacteria 8237
606 Ga0496109_0261255 3300048912 Bacteria 1631
607 Ga0496109_0471444 3300048912 Bacteria 1185
608 Ga0496110_0041658 3300048913 Bacteria 4008
609 Ga0496111_0014914 3300048914 Bacteria 5320
610 Ga0496112_0080201 3300048915 Bacteria 3227
611 Ga0496113_0045532 3300048916 Bacteria 3254
612 Ga0496114_0114230 3300048917 Bacteria 2315
613 Ga0501067_0043074 3300049583 Bacteria 2507
614 Ga0501067_0546717 3300049583 Bacteria 648
615 Ga0501069_0455233 3300049585 Bacteria 761
616 Ga0501070_0116398 3300049586 Bacteria 2208
617 nmdc:mga05p37_835540_c1 3300050507 Unclassified 1002
618 nmdc:mga0a205_42599_c1 3300050515 Bacteria 4375
619 Ga0587078_038668 3300059646 Bacteria 668
620 Ga0395899_0157022
621 JGI24740J21852_10009351
622 JGI24740J21852_10019066
623 JGI24740J21852_10057275
624 JGI24739J22299_10032182
625 JGI24737J22298_10037330
626 JGI24735J21928_10016410
627 JGI24735J21928_10017707
628 JGI24735J21928_10111264
629 JGI24735J21928_10130278
630 JGI24738J21930_10014568
631 JGI24742J22300_10016259
632 Ga0065707_10622712
633 Ga0070658_10000130
634 Ga0070658_10017023
635 Ga0070658_10020966
636 Ga0070658_10033970
637 Ga0070658_10066130
638 Ga0070658_10230382
639 Ga0070658_10395067
640 Ga0070676_10011590
641 Ga0070676_10018463
642 Ga0070676_10709385
643 Ga0070683_100008548
644 Ga0070683_100023386
645 Ga0070683_100147505
646 Ga0070683_101455176
647 Ga0070690_100073519
648 Ga0068869_100083787
649 Ga0070666_10002432
650 Ga0070666_10005625
651 Ga0070680_100008823
652 Ga0070680_100053203
653 Ga0070680_100164809
654 Ga0070680_100691198
655 Ga0068868_100114477
656 Ga0068868_100358137
657 Ga0068868_100670652
658 Ga0070660_100000075
659 Ga0070660_100003716
660 Ga0070660_100003741
661 Ga0070660_100016251
662 Ga0070660_100099522
663 Ga0070660_101496590
664 Ga0070660_101660676
665 Ga0070689_101332485
666 Ga0070691_10610611
667 Ga0070661_100000882
668 Ga0070661_100049744
669 Ga0070661_100141387
670 Ga0070661_100248264
671 Ga0070661_101280930
672 Ga0070692_10330405
673 Ga0070668_100009798
674 Ga0070668_100053761
675 Ga0070668_100205153
676 Ga0070668_100301796
677 Ga0070668_100381044
678 Ga0070668_100428807
679 Ga0070669_100186755
680 Ga0070669_100268439
681 Ga0070669_101907339
682 Ga0070675_100057377
683 Ga0070671_100001544
684 Ga0070671_100033017
685 Ga0070671_100197768
686 Ga0070674_100067775
687 Ga0070674_100117031
688 Ga0070674_100584787
689 Ga0070674_100643862
690 Ga0070673_100004701
691 Ga0070673_100064103
692 Ga0070673_100083185
693 Ga0070659_100000084
694 Ga0070659_100008782
695 Ga0070659_100016609
696 Ga0070659_100387615
697 Ga0070659_100423399
698 Ga0070659_101318110
699 Ga0070659_101745906
700 Ga0070667_100019436
701 Ga0070667_100040532
702 Ga0070667_100123392
703 Ga0070667_100296460
704 Ga0070667_100324312
705 Ga0070667_100439955
706 Ga0070663_100000440
707 Ga0070663_100002673
708 Ga0070663_100055943
709 Ga0070663_100613869
710 Ga0070678_100001074
711 Ga0070678_100071676
712 Ga0070678_100689936
713 Ga0070678_101281479
714 Ga0070662_100000058
715 Ga0070662_100002595
716 Ga0070662_100010796
717 Ga0070662_100132824
718 Ga0070662_100260148
719 Ga0070662_100740309
720 Ga0070681_10054174
721 Ga0070681_10130378
722 Ga0070681_10396589
723 Ga0070681_10455221
724 Ga0068867_100096951
725 Ga0068867_100117114
726 Ga0070685_10077557
727 Ga0070706_100898142
728 Ga0070679_100081500
729 Ga0070679_100369277
730 Ga0070684_100004713
731 Ga0070684_100019198
732 Ga0070684_100059811
733 Ga0070684_100202979
734 Ga0068853_100003940
735 Ga0068853_100006461
736 Ga0068853_100074152
737 Ga0068853_100634709
738 Ga0068853_100739858
739 Ga0070672_100004242
740 Ga0070672_100050536
741 Ga0070672_100057683
742 Ga0070672_100068085
743 Ga0070686_101382895
744 Ga0070696_100304699
745 Ga0070696_100779851
746 Ga0070693_100004555
747 Ga0070665_100003576
748 Ga0070665_100005110
749 Ga0070665_100013915
750 Ga0070665_100040476
751 Ga0070665_100055080
752 Ga0070665_101033911
753 Ga0068855_100019280
754 Ga0068855_100042872
755 Ga0068855_100216113
756 Ga0068855_100246878
757 Ga0068855_100420715
758 Ga0068855_100591469
759 Ga0068855_100615715
760 Ga0070664_100000032
761 Ga0070664_100005333
762 Ga0070664_100010573
763 Ga0070664_100029580
764 Ga0070664_100425530
765 Ga0070664_101059883
766 Ga0070664_101129374
767 Ga0068857_100012379
768 Ga0068854_100014800
769 Ga0068854_100033082
770 Ga0068854_100630886
771 Ga0068856_100000161
772 Ga0068856_100090963
773 Ga0068856_100281709
774 Ga0068856_100979884
775 Ga0068852_100001870
776 Ga0068852_100013250
777 Ga0068852_100033821
778 Ga0068852_100057720
779 Ga0068852_100111824
780 Ga0068852_100214408
781 Ga0068852_100339458
782 Ga0068859_100020226
783 Ga0068859_100333440
784 Ga0068859_102428314
785 Ga0068864_100008096
786 Ga0068864_100008774
787 Ga0068864_100270926
788 Ga0068866_10229625
789 Ga0068861_100083075
790 Ga0068851_10030390
791 Ga0068851_10064780
792 Ga0068851_10706425
793 Ga0068870_10256733
794 Ga0068870_10389698
795 Ga0068863_100015256
796 Ga0068863_100137528
797 Ga0068858_100032114
798 Ga0068858_100070220
799 Ga0068858_100965672
800 Ga0068858_101162521
801 Ga0068860_100005579
802 Ga0068860_100197949
803 Ga0068860_101552560
804 Ga0068860_101694118
805 Ga0068862_100006729
806 Ga0068862_100031118
807 Ga0068862_100577635
808 Ga0068862_100694063
809 Ga0081539_10072198
810 Ga0081539_10150294
811 Ga0075427_10052183
812 Ga0097621_100002273
813 Ga0097621_100072520
814 Ga0097621_100318458
815 Ga0097621_101329818
816 Ga0068871_100012063
817 Ga0068871_100584251
818 Ga0068871_101193296
819 Ga0068865_100014521
820 Ga0068865_100257278
821 Ga0068865_100905831
822 Ga0097620_100020226
823 Ga0097620_100333437
824 Ga0097620_102428361
825 Ga0075435_101736643
826 Ga0105240_10075618
827 Ga0105240_11566655
828 Ga0105245_10273263
829 Ga0114129_11168022
830 Ga0105243_10118692
831 Ga0105243_10931326
832 Ga0105241_10231901
833 Ga0105248_10000223
834 Ga0105248_10009313
835 Ga0105248_10114288
836 Ga0105248_10190591
837 Ga0105237_12118112
838 Ga0105238_10261354
839 Ga0105238_12269905
840 Ga0105249_10086749
841 Ga0105249_10243019
842 Ga0105249_11303195
843 Ga0157373_10020082
844 Ga0157373_10047016
845 Ga0157373_10052326
846 Ga0157373_10225878
847 Ga0157373_10238176
848 Ga0157373_10942489
849 Ga0157371_10006556
850 Ga0157371_10054077
851 Ga0157371_10070048
852 Ga0157371_10190539
853 Ga0157371_10193978
854 Ga0157371_10257778
855 Ga0157371_10497833
856 Ga0157371_10508888
857 Ga0157370_10111012
858 Ga0157370_10112075
859 Ga0157370_10179680
860 Ga0157370_10333562
861 Ga0157370_10409568
862 Ga0157369_10006870
863 Ga0157369_10078237
864 Ga0157369_10086267
865 Ga0157369_10325268
866 Ga0157369_10370965
867 Ga0157369_11017943
868 Ga0157369_11745109
869 Ga0157374_10044572
870 Ga0157374_10066675
871 Ga0157374_10289591
872 Ga0157378_11548074
873 Ga0163162_10002607
874 Ga0163162_10068537
875 Ga0163162_10093991
876 Ga0157372_10007165
877 Ga0157372_10113809
878 Ga0157372_10508122
879 Ga0157372_11617336
880 Ga0157372_12023944
881 Ga0157375_10028216
882 Ga0157375_10202522
883 Ga0157375_10480127
884 Ga0163163_10000371
885 Ga0163163_10004898
886 Ga0157380_10013699
887 Ga0157380_10114676
888 Ga0182008_10296244
889 Ga0157377_10018985
890 Ga0157379_11050957
891 Ga0157376_11826820
892 Ga0163161_10009313
893 Ga0207697_10028805
894 Ga0207697_10065600
895 Ga0207697_10390264
896 Ga0207656_10052637
897 Ga0207656_10181431
898 Ga0207688_10045895
899 Ga0207680_10035754
900 Ga0207680_10321751
901 Ga0207647_10003878
902 Ga0207647_10012508
903 Ga0207647_10036127
904 Ga0207647_10126409
905 Ga0207645_10014880
906 Ga0207645_10728625
907 Ga0207643_10193979
908 Ga0207705_10000200
909 Ga0207705_10012684
910 Ga0207705_10049670
911 Ga0207705_10063505
912 Ga0207705_10082998
913 Ga0207705_10215135
914 Ga0207705_10380524
915 Ga0207684_10273552
916 Ga0207654_10156650
917 Ga0207707_10013218
918 Ga0207707_10133233
919 Ga0207707_10144229
920 Ga0207707_10211975
921 Ga0207695_10023725
922 Ga0207695_10090417
923 Ga0207671_10029345
924 Ga0207660_10003824
925 Ga0207660_10135188
926 Ga0207660_10405260
927 Ga0207660_10488565
928 Ga0207657_10000164
929 Ga0207657_10000856
930 Ga0207657_10002745
931 Ga0207657_10008436
932 Ga0207657_10012539
933 Ga0207657_10030342
934 Ga0207657_10036255
935 Ga0207657_10097994
936 Ga0207649_10000043
937 Ga0207649_10001075
938 Ga0207649_10081928
939 Ga0207649_10412757
940 Ga0207649_10431344
941 Ga0207652_10022384
942 Ga0207652_10174632
943 Ga0207652_10395477
944 Ga0207652_10578561
945 Ga0207681_10017557
946 Ga0207681_10165955
947 Ga0207681_11262405
948 Ga0207694_10001883
949 Ga0207694_10168311
950 Ga0207694_11139451
951 Ga0207650_10010570
952 Ga0207650_10108605
953 Ga0207650_10371387
954 Ga0207650_11664094
955 Ga0207687_10035446
956 Ga0207644_10017727
957 Ga0207644_10040053
958 Ga0207644_10040797
959 Ga0207644_10132221
960 Ga0207644_10133146
961 Ga0207690_10000062
962 Ga0207690_10002095
963 Ga0207690_10028058
964 Ga0207690_10362790
965 Ga0207690_10593404
966 Ga0207706_10000196
967 Ga0207706_10000866
968 Ga0207706_10013730
969 Ga0207706_10046640
970 Ga0207706_11402574
971 Ga0207709_10076629
972 Ga0207669_10025916
973 Ga0207669_10055019
974 Ga0207669_10604941
975 Ga0207704_10038289
976 Ga0207704_10070586
977 Ga0207691_10002422
978 Ga0207691_10059756
979 Ga0207691_10061715
980 Ga0207691_10073928
981 Ga0207711_10001232
982 Ga0207711_10006175
983 Ga0207711_10388746
984 Ga0207689_10030278
985 Ga0207661_10006015
986 Ga0207661_10374772
987 Ga0207661_10551170
988 Ga0207661_10624760
989 Ga0207679_10000380
990 Ga0207679_10021718
991 Ga0207679_10137981
992 Ga0207667_10004130
993 Ga0207667_10006431
994 Ga0207667_10020593
995 Ga0207667_10156644
996 Ga0207667_10283242
997 Ga0207667_10291399
998 Ga0207651_10006332
999 Ga0207651_10114624
1000 Ga0207712_10161820
1001 Ga0207712_10164835
1002 Ga0207712_10838802
1003 Ga0207668_10000150
1004 Ga0207668_10183365
1005 Ga0207668_10224904
1006 Ga0207668_10236357
1007 Ga0207668_10395393
1008 Ga0207668_11404134
1009 Ga0207640_10010760
1010 Ga0207640_10129479
1011 Ga0207640_10230106
1012 Ga0207640_10498502
1013 Ga0207640_10914059
1014 Ga0207658_10020996
1015 Ga0207658_10028395
1016 Ga0207658_10055391
1017 Ga0207658_10385675
1018 Ga0207658_10599488
1019 Ga0207677_10454254
1020 Ga0207677_10582122
1021 Ga0207703_10036465
1022 Ga0207703_10436059
1023 Ga0207639_10000124
1024 Ga0207639_10019688
1025 Ga0207639_10024653
1026 Ga0207639_10058239
1027 Ga0207639_10162598
1028 Ga0207639_10246307
1029 Ga0207639_10305680
1030 Ga0207639_11077904
1031 Ga0207678_10002492
1032 Ga0207678_10030174
1033 Ga0207678_10114797
1034 Ga0207678_10169981
1035 Ga0207708_11502140
1036 Ga0207702_10001652
1037 Ga0207702_10308247
1038 Ga0207702_10644897
1039 Ga0207702_11578825
1040 Ga0207641_10066034
1041 Ga0207641_10136385
1042 Ga0207648_10096886
1043 Ga0207648_10167279
1044 Ga0207676_10006241
1045 Ga0207676_10045650
1046 Ga0207674_10008190
1047 Ga0207674_10028824
1048 Ga0207674_10441309
1049 Ga0207675_100501200
1050 Ga0207683_10007362
1051 Ga0207683_10080082
1052 Ga0207698_10001193
1053 Ga0207698_10005408
1054 Ga0207698_10039952
1055 Ga0207698_10061495
1056 Ga0207698_10094363
1057 Ga0207698_10214061
1058 Ga0209967_1021050
1059 Ga0209971_1016251
1060 Ga0209974_10000170
1061 Ga0268266_10004016
1062 Ga0268266_10021340
1063 Ga0268266_10038925
1064 Ga0268266_10040084
1065 Ga0268266_10108328
1066 Ga0268266_10706888
1067 Ga0268265_10003010
1068 Ga0268265_10007372
1069 Ga0268265_10055683
1070 Ga0268264_10114302
1071 Ga0268264_10178203
1072 Ga0268264_11209543
1073 Ga0268264_12033054
1074 Ga0307408_100053607
1075 Ga0307408_100203984
1076 Ga0307408_100943058
1077 Ga0307405_10017875
1078 Ga0307405_10026548
1079 Ga0307413_10131395
1080 Ga0307413_10194863
1081 Ga0307410_10165100
1082 Ga0307410_10250509
1083 Ga0307410_10326903
1084 Ga0307406_10051002
1085 Ga0307406_10480360
1086 Ga0307407_10197906
1087 Ga0307407_10791963
1088 Ga0307412_10039503
1089 Ga0307412_10044991
1090 Ga0307409_100006806
1091 Ga0307409_100010410
1092 Ga0307409_100540865
1093 Ga0307416_100029173
1094 Ga0307416_100081953
1095 Ga0307416_100144176
1096 Ga0307416_100394325
1097 Ga0307416_100791382
1098 Ga0307414_10038694
1099 Ga0307414_10041221
1100 Ga0307414_10098666
1101 Ga0307411_10112951
1102 Ga0307411_10143616
1103 Ga0307411_10249217
1104 Ga0307415_100019483
1105 Ga0307415_100038501
1106 Ga0307415_100155232
1107 Ga0373940_0137358
1108 Ga0373951_0066310
1109 Ga0373931_0038920
1110 Ga0395899_0001919
1111 Ga0395899_0017481
1112 Ga0395899_0025364
1113 Ga0395899_0030981
1114 Ga0395899_0052799
1115 Ga0395899_0125166
1116 Ga0395899_0225304
1117 Ga0395899_0517540
1118 Ga0395900_0001171
1119 Ga0395900_0002717
1120 Ga0395900_0004022
1121 Ga0395900_0020668
1122 Ga0395900_0046164
1123 Ga0395900_0049349
1124 Ga0395900_0058867
1125 Ga0395900_0060965
1126 Ga0395900_0068480
1127 Ga0395900_0079131
1128 Ga0395900_0103496
1129 Ga0395900_0128553
1130 Ga0395900_0201061
1131 Ga0395900_0247879
1132 Ga0395900_0412718
1133 Ga0395900_0664442
1134 Ga0395900_1083555
1135 Ga0395898_0001741
1136 Ga0395898_0014122
1137 Ga0395898_0027353
1138 Ga0395898_0073112
1139 Ga0395898_0163818
1140 Ga0395898_0185545
1141 Ga0395898_0670882
1142 Ga0395898_0705445
1143 Ga0395898_0760695
1144 Ga0395898_0985582
1145 Ga0395898_1546626
1146 Ga0395905_0004734
1147 Ga0395905_0008446
1148 Ga0395905_0011028
1149 Ga0395905_0016371
1150 Ga0395905_0017320
1151 Ga0395905_0019078
1152 Ga0395905_0028173
1153 Ga0395905_0035912
1154 Ga0395905_0048975
1155 Ga0395905_0080444
1156 Ga0395905_0103640
1157 Ga0395905_0130308
1158 Ga0395905_0142390
1159 Ga0395905_0170664
1160 Ga0395905_0183984
1161 Ga0395905_0232077
1162 Ga0395905_0296687
1163 Ga0395905_0386038
1164 Ga0395905_1764311
1165 Ga0395901_0000140
1166 Ga0395901_0000763
1167 Ga0395901_0001340
1168 Ga0395901_0011095
1169 Ga0395901_0014941
1170 Ga0395901_0058571
1171 Ga0395901_0067335
1172 Ga0395901_0088199
1173 Ga0395901_0120157
1174 Ga0395901_0124654
1175 Ga0395901_0320511
1176 Ga0395901_0348166
1177 Ga0395901_0369066
1178 Ga0395901_0766945
1179 Ga0395901_2012223
1180 Ga0436363_1043700
1181 Ga0439448_0004115
1182 Ga0439455_0005145
1183 Ga0439458_0000121
1184 Ga0466972_0086148
1185 Ga0466961_0217647
1186 Ga0466963_0221786
1187 Ga0466963_0271196
1188 Ga0466971_0044595
1189 Ga0466957_0171718
1190 Ga0466957_0742952
1191 Ga0466960_0006236
1192 Ga0466960_0011100
1193 Ga0466960_0049289
1194 Ga0466959_0121477
1195 Ga0466967_0070058
1196 Ga0466967_0083890
1197 Ga0466967_0187198
1198 Ga0466967_0239965
1199 Ga0466967_0315573
1200 Ga0466967_0316288
1201 Ga0495596_0119316
1202 Ga0495621_0069891
1203 Ga0495597_0256270
1204 Ga0495668_0260433
1205 Ga0495625_0500623
1206 Ga0495669_0012380
1207 Ga0495669_0012712
1208 Ga0495669_0016930
1209 Ga0495669_0020378
1210 Ga0495669_0110463
1211 Ga0495669_0500967
1212 Ga0495636_0178608
1213 Ga0495677_0002354
1214 Ga0495677_0010044
1215 Ga0496101_0254349
1216 Ga0496101_0814695
1217 Ga0496104_0320841
1218 Ga0496106_0530016
1219 Ga0496107_0113716
1220 Ga0496107_0171165
1221 Ga0496107_0639038
1222 Ga0496108_0009557
1223 Ga0496108_0034723
1224 Ga0496109_0009641
1225 Ga0496109_0261255
1226 Ga0496109_0471444
1227 Ga0496110_0041658
1228 Ga0496111_0014914
1229 Ga0496112_0080201
1230 Ga0496113_0045532
1231 Ga0496114_0114230
1232 Ga0501067_0043074
1233 Ga0501067_0546717
1234 Ga0501069_0455233
1235 Ga0501070_0116398
1236 nmdc:mga05p37_835540_c1
1237 nmdc:mga0a205_42599_c1
1238 Ga0587078_038668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13430

DUF4112

Domain of unknown function (DUF4112)

36

139

0.98

Map