F469818

General Info

Members Datasets Scaffolds Average Seq Length
619 285 618 222

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10051775|Ga0163162_100517754
Length 254
Sequence MGGTVTGRSFTAELWDGITRIYDAILAHPFLAGLTDGTLPESAFTYYLVQDALFLKDYARALAAVASRAPGNAGTELFAGHAVGIIADEQKLHEFLLADLGLDPAVTERAEPAPATVAYTSYLLSAVRGGSYAEGIGAILPCYWIYWEVGKELSRRGSPSPRYQRWIDTYASEDFGDVARAVLDIADGLGPGLGAAERALVHRHFLTTSRYEWMFWDMGYREETWPVGAGQGRLAGCAELRRSRWDWSPREPGD

Samples

Sample ID Description Type Environment
1 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
128 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
133 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
149 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.16
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.55
Rhizosphere 93.38
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10352835 3300005295 Unclassified 916
2 Ga0070658_10000213 3300005327 Bacteria 51512
3 Ga0070676_10529918 3300005328 Unclassified 840
4 Ga0070683_100063735 3300005329 Bacteria 3429
5 Ga0070683_100423772 3300005329 Unclassified 1270
6 Ga0070690_100570593 3300005330 Unclassified 855
7 Ga0070680_100000019 3300005336 Bacteria 83282
8 Ga0070682_100192951 3300005337 Bacteria 1431
9 Ga0070660_100040646 3300005339 Bacteria 3540
10 Ga0070691_10110322 3300005341 Bacteria 1375
11 Ga0070691_10149758 3300005341 Bacteria 1195
12 Ga0070687_100073080 3300005343 Bacteria 1847
13 Ga0070661_100035206 3300005344 Bacteria 3635
14 Ga0070661_100590751 3300005344 Unclassified 897
15 Ga0070692_10216816 3300005345 Bacteria 1129
16 Ga0070669_100269210 3300005353 Bacteria 1362
17 Ga0070673_100011807 3300005364 Bacteria 5977
18 Ga0070659_100152964 3300005366 Unclassified 1883
19 Ga0070709_10205593 3300005434 Bacteria 1397
20 Ga0070709_10226220 3300005434 Bacteria 1336
21 Ga0070709_10287240 3300005434 Unclassified 1197
22 Ga0070709_10377977 3300005434 Bacteria 1052
23 Ga0070714_100007177 3300005435 Bacteria 8645
24 Ga0070714_100012659 3300005435 Bacteria 6737
25 Ga0070714_100040400 3300005435 Bacteria 3932
26 Ga0070714_100157323 3300005435 Bacteria 2053
27 Ga0070714_100313884 3300005435 Bacteria 1464
28 Ga0070714_100462441 3300005435 Unclassified 1206
29 Ga0070713_100012336 3300005436 Bacteria 6263
30 Ga0070713_100012427 3300005436 Bacteria 6244
31 Ga0070713_100112132 3300005436 Bacteria 2379
32 Ga0070713_100140281 3300005436 Bacteria 2140
33 Ga0070713_100346535 3300005436 Unclassified 1377
34 Ga0070713_100856856 3300005436 Bacteria 873
35 Ga0070710_10049701 3300005437 Bacteria 2347
36 Ga0070710_10050765 3300005437 Bacteria 2326
37 Ga0070710_10075875 3300005437 Bacteria 1949
38 Ga0070710_10111568 3300005437 Bacteria 1643
39 Ga0070710_10157257 3300005437 Bacteria 1406
40 Ga0070710_10216143 3300005437 Bacteria 1217
41 Ga0070711_100282899 3300005439 Unclassified 1313
42 Ga0070711_100338567 3300005439 Unclassified 1206
43 Ga0070711_100383241 3300005439 Bacteria 1137
44 Ga0070711_100464121 3300005439 Bacteria 1038
45 Ga0070705_100286352 3300005440 Bacteria 1174
46 Ga0070694_100505631 3300005444 Bacteria 962
47 Ga0070708_100011947 3300005445 Bacteria 7075
48 Ga0070708_100014738 3300005445 Bacteria 6440
49 Ga0070708_100356331 3300005445 Bacteria 1379
50 Ga0070708_100460479 3300005445 Bacteria 1200
51 Ga0070708_100526568 3300005445 Bacteria 1115
52 Ga0070663_100038124 3300005455 Bacteria 3351
53 Ga0070662_100219152 3300005457 Bacteria 1517
54 Ga0070681_10000017 3300005458 Bacteria 125537
55 Ga0070681_10055498 3300005458 Bacteria 3944
56 Ga0070681_10299334 3300005458 Bacteria 1518
57 Ga0070706_100051531 3300005467 Bacteria 3799
58 Ga0070706_100057239 3300005467 Bacteria 3597
59 Ga0070706_100116324 3300005467 Bacteria 2490
60 Ga0070706_100119634 3300005467 Unclassified 2455
61 Ga0070706_100161218 3300005467 Bacteria 2094
62 Ga0070706_100188359 3300005467 Bacteria 1928
63 Ga0070706_100322559 3300005467 Bacteria 1440
64 Ga0070707_100005906 3300005468 Bacteria 11425
65 Ga0070707_100008251 3300005468 Bacteria 9666
66 Ga0070707_100028448 3300005468 Bacteria 5320
67 Ga0070707_100059720 3300005468 Bacteria 3657
68 Ga0070707_100084629 3300005468 Bacteria 3064
69 Ga0070707_100166290 3300005468 Bacteria 2150
70 Ga0070707_100271661 3300005468 Unclassified 1648
71 Ga0070707_100557090 3300005468 Bacteria 1108
72 Ga0070698_100010686 3300005471 Bacteria 9781
73 Ga0070698_100017421 3300005471 Bacteria 7572
74 Ga0070698_100086656 3300005471 Bacteria 3118
75 Ga0070698_100124991 3300005471 Bacteria 2529
76 Ga0070698_100131186 3300005471 Bacteria 2461
77 Ga0070698_100258134 3300005471 Bacteria 1675
78 Ga0070699_100004942 3300005518 Bacteria 11759
79 Ga0070699_100058112 3300005518 Bacteria 3350
80 Ga0070699_100090514 3300005518 Unclassified 2674
81 Ga0070699_100101812 3300005518 Bacteria 2518
82 Ga0070679_100000009 3300005530 Bacteria 191579
83 Ga0070684_100064911 3300005535 Bacteria 3203
84 Ga0070684_100200352 3300005535 Bacteria 1818
85 Ga0070697_100028812 3300005536 Bacteria 4448
86 Ga0070697_100089181 3300005536 Bacteria 2548
87 Ga0070665_100061688 3300005548 Bacteria 3759
88 Ga0070665_100946208 3300005548 Unclassified 874
89 Ga0070704_100037895 3300005549 Bacteria 3298
90 Ga0068855_100077532 3300005563 Bacteria 3856
91 Ga0068855_100317339 3300005563 Bacteria 1723
92 Ga0070664_100544292 3300005564 Bacteria 1073
93 Ga0068857_100392285 3300005577 Bacteria 1291
94 Ga0068856_100170286 3300005614 Unclassified 2190
95 Ga0068856_100226395 3300005614 Bacteria 1885
96 Ga0068856_100538817 3300005614 Bacteria 1188
97 Ga0068859_100228327 3300005617 Bacteria 1949
98 Ga0068859_100787040 3300005617 Unclassified 1039
99 Ga0068864_100098619 3300005618 Bacteria 2588
100 Ga0068864_100519775 3300005618 Unclassified 1147
101 Ga0068861_100250557 3300005719 Bacteria 1511
102 Ga0068858_100166590 3300005842 Bacteria 2077
103 Ga0068862_100654012 3300005844 Bacteria 1014
104 Ga0081455_10007614 3300005937 Bacteria 11383
105 Ga0081538_10010200 3300005981 Bacteria 7719
106 Ga0081538_10017617 3300005981 Bacteria 5412
107 Ga0081540_1001003 3300005983 Bacteria 25342
108 Ga0081540_1006443 3300005983 Bacteria 8543
109 Ga0081539_10021393 3300005985 Bacteria 4324
110 Ga0081539_10142467 3300005985 Bacteria 1163
111 Ga0070717_10034799 3300006028 Bacteria 4074
112 Ga0070717_10038844 3300006028 Bacteria 3870
113 Ga0070717_10167481 3300006028 Bacteria 1909
114 Ga0070717_10220044 3300006028 Bacteria 1668
115 Ga0070717_10235358 3300006028 Bacteria 1613
116 Ga0070717_10356217 3300006028 Bacteria 1309
117 Ga0070717_10417728 3300006028 Unclassified 1206
118 Ga0070717_10477563 3300006028 Bacteria 1125
119 Ga0070715_10021712 3300006163 Bacteria 2493
120 Ga0070715_10026962 3300006163 Bacteria 2291
121 Ga0070716_100014070 3300006173 Bacteria 4093
122 Ga0070716_100341553 3300006173 Unclassified 1056
123 Ga0070712_100117716 3300006175 Bacteria 1994
124 Ga0070712_100154048 3300006175 Bacteria 1768
125 Ga0070712_100351578 3300006175 Unclassified 1206
126 Ga0097621_100161280 3300006237 Bacteria 1928
127 Ga0075428_100039263 3300006844 Bacteria 5209
128 Ga0075428_100100883 3300006844 Bacteria 3147
129 Ga0075430_100005155 3300006846 Bacteria 11003
130 Ga0075430_100023570 3300006846 Bacteria 5240
131 Ga0075430_100158417 3300006846 Bacteria 1885
132 Ga0075431_100013919 3300006847 Bacteria 8124
133 Ga0075431_100050743 3300006847 Unclassified 4277
134 Ga0075431_100146661 3300006847 Unclassified 2432
135 Ga0075431_100209294 3300006847 Bacteria 1993
136 Ga0075433_10179335 3300006852 Bacteria 1885
137 Ga0075433_10223274 3300006852 Bacteria 1673
138 Ga0075434_100842351 3300006871 Bacteria 933
139 Ga0075429_100048052 3300006880 Unclassified 3711
140 Ga0075429_100387439 3300006880 Bacteria 1224
141 Ga0075436_100241566 3300006914 Bacteria 1285
142 Ga0075436_100246773 3300006914 Bacteria 1271
143 Ga0075436_100444179 3300006914 Bacteria 944
144 Ga0097620_100228320 3300006931 Bacteria 1949
145 Ga0097620_100787164 3300006931 Unclassified 1039
146 Ga0075435_100325381 3300007076 Bacteria 1316
147 Ga0099794_10003212 3300007265 Bacteria 6196
148 Ga0099795_10165202 3300007788 Bacteria 916
149 Ga0111539_10015400 3300009094 Bacteria 9516
150 Ga0105245_10049940 3300009098 Bacteria 3747
151 Ga0105245_10730042 3300009098 Bacteria 1025
152 Ga0105247_10168889 3300009101 Bacteria 1453
153 Ga0114129_10005178 3300009147 Bacteria 18354
154 Ga0114129_10057911 3300009147 Bacteria 5421
155 Ga0114129_10070995 3300009147 Unclassified 4856
156 Ga0114129_10954083 3300009147 Bacteria 1083
157 Ga0105243_10025687 3300009148 Bacteria 4504
158 Ga0105237_10684978 3300009545 Bacteria 1032
159 Ga0105238_10038274 3300009551 Bacteria 4871
160 Ga0105238_10052582 3300009551 Bacteria 4095
161 Ga0105249_10251688 3300009553 Bacteria 1752
162 Ga0105239_10517413 3300010375 Bacteria 1357
163 Ga0157371_10382259 3300013102 Bacteria 1028
164 Ga0157370_10034424 3300013104 Bacteria 4933
165 Ga0157370_10043258 3300013104 Bacteria 4335
166 Ga0157369_10033922 3300013105 Bacteria 5605
167 Ga0157369_10205929 3300013105 Bacteria 2063
168 Ga0157369_10357058 3300013105 Bacteria 1517
169 Ga0157369_10765738 3300013105 Bacteria 993
170 Ga0157374_10113015 3300013296 Bacteria 2614
171 Ga0163162_10051775 3300013306 Bacteria 4121
172 Ga0163162_10070078 3300013306 Bacteria 3558
173 Ga0163162_10306636 3300013306 Unclassified 1720
174 Ga0163162_10322635 3300013306 Archaea 1677
175 Ga0157375_10222742 3300013308 Bacteria 2045
176 Ga0163163_10016647 3300014325 Bacteria 6836
177 Ga0163163_10219566 3300014325 Bacteria 1949
178 Ga0163163_10624886 3300014325 Bacteria 1140
179 Ga0157379_10059364 3300014968 Unclassified 3420
180 Ga0157379_10083252 3300014968 Bacteria 2867
181 Ga0157376_10076382 3300014969 Bacteria 2862
182 Ga0157376_10609678 3300014969 Bacteria 1087
183 Ga0163161_10160835 3300017792 Bacteria 1712
184 Ga0213874_10065941 3300021377 Bacteria 1145
185 Ga0213875_10000331 3300021388 Bacteria 44957
186 Ga0213875_10054073 3300021388 Unclassified 1881
187 Ga0213875_10097003 3300021388 Bacteria 1375
188 Ga0213875_10127527 3300021388 Bacteria 1189
189 Ga0224572_1025526 3300024225 Bacteria 1134
190 Ga0207653_10048321 3300025885 Bacteria 1410
191 Ga0207692_10015529 3300025898 Bacteria 3353
192 Ga0207692_10027667 3300025898 Bacteria 2673
193 Ga0207692_10068899 3300025898 Bacteria 1857
194 Ga0207692_10104511 3300025898 Bacteria 1561
195 Ga0207692_10181926 3300025898 Unclassified 1225
196 Ga0207647_10071880 3300025904 Bacteria 2087
197 Ga0207685_10027521 3300025905 Bacteria 1991
198 Ga0207685_10191682 3300025905 Bacteria 955
199 Ga0207685_10311852 3300025905 Bacteria 782
200 Ga0207699_10107661 3300025906 Bacteria 1781
201 Ga0207699_10110563 3300025906 Bacteria 1760
202 Ga0207699_10210643 3300025906 Bacteria 1322
203 Ga0207699_10238970 3300025906 Unclassified 1247
204 Ga0207645_10271538 3300025907 Bacteria 1124
205 Ga0207705_10001330 3300025909 Bacteria 19780
206 Ga0207684_10016693 3300025910 Bacteria 6305
207 Ga0207684_10042949 3300025910 Bacteria 3832
208 Ga0207684_10091706 3300025910 Unclassified 2590
209 Ga0207684_10150379 3300025910 Bacteria 2003
210 Ga0207684_10239457 3300025910 Bacteria 1565
211 Ga0207684_10267333 3300025910 Archaea 1475
212 Ga0207684_10280246 3300025910 Bacteria 1438
213 Ga0207684_10743950 3300025910 Bacteria 831
214 Ga0207707_10000257 3300025912 Bacteria 57640
215 Ga0207707_10259492 3300025912 Bacteria 1508
216 Ga0207707_10461405 3300025912 Bacteria 1086
217 Ga0207707_10863149 3300025912 Bacteria 750
218 Ga0207693_10019644 3300025915 Bacteria 5373
219 Ga0207693_10047210 3300025915 Bacteria 3384
220 Ga0207693_10057674 3300025915 Bacteria 3043
221 Ga0207693_10308146 3300025915 Unclassified 1240
222 Ga0207693_10313667 3300025915 Unclassified 1228
223 Ga0207663_10021075 3300025916 Bacteria 3703
224 Ga0207660_10000169 3300025917 Bacteria 41207
225 Ga0207660_10458591 3300025917 Bacteria 1031
226 Ga0207662_10136641 3300025918 Unclassified 1550
227 Ga0207657_10010424 3300025919 Bacteria 9277
228 Ga0207657_10055235 3300025919 Bacteria 3431
229 Ga0207652_10000124 3300025921 Bacteria 82835
230 Ga0207646_10016556 3300025922 Bacteria 6918
231 Ga0207646_10023573 3300025922 Bacteria 5651
232 Ga0207646_10025085 3300025922 Bacteria 5457
233 Ga0207646_10033750 3300025922 Bacteria 4627
234 Ga0207646_10089448 3300025922 Unclassified 2756
235 Ga0207646_10102650 3300025922 Bacteria 2564
236 Ga0207646_10181456 3300025922 Unclassified 1901
237 Ga0207681_10264734 3300025923 Bacteria 1347
238 Ga0207700_10005513 3300025928 Bacteria 7590
239 Ga0207700_10035499 3300025928 Bacteria 3592
240 Ga0207700_10083172 3300025928 Bacteria 2505
241 Ga0207700_10084842 3300025928 Bacteria 2484
242 Ga0207700_10129193 3300025928 Bacteria 2060
243 Ga0207700_10460771 3300025928 Bacteria 1121
244 Ga0207700_10553457 3300025928 Bacteria 1021
245 Ga0207700_10667170 3300025928 Unclassified 927
246 Ga0207664_10002531 3300025929 Bacteria 12083
247 Ga0207664_10026427 3300025929 Bacteria 4387
248 Ga0207664_10027387 3300025929 Bacteria 4320
249 Ga0207664_10056586 3300025929 Bacteria 3115
250 Ga0207664_10076759 3300025929 Bacteria 2705
251 Ga0207664_10380323 3300025929 Bacteria 1253
252 Ga0207664_10504769 3300025929 Bacteria 1083
253 Ga0207686_10382862 3300025934 Bacteria 1067
254 Ga0207665_10006674 3300025939 Bacteria 7658
255 Ga0207665_10069021 3300025939 Bacteria 2409
256 Ga0207665_10246261 3300025939 Bacteria 1319
257 Ga0207711_10068743 3300025941 Bacteria 3068
258 Ga0207661_10143164 3300025944 Bacteria 2059
259 Ga0207661_10153555 3300025944 Bacteria 1992
260 Ga0207679_10451031 3300025945 Bacteria 1141
261 Ga0207667_10416216 3300025949 Bacteria 1368
262 Ga0207667_10488126 3300025949 Bacteria 1250
263 Ga0207712_10140674 3300025961 Bacteria 1851
264 Ga0207640_10354140 3300025981 Bacteria 1180
265 Ga0207677_10113236 3300026023 Bacteria 2025
266 Ga0207639_10397522 3300026041 Unclassified 1241
267 Ga0207678_10067299 3300026067 Plasmid 3075
268 Ga0207678_10072705 3300026067 Bacteria 2946
269 Ga0207702_10208083 3300026078 Bacteria 1817
270 Ga0207641_10245596 3300026088 Bacteria 1670
271 Ga0207676_10070288 3300026095 Bacteria 2807
272 Ga0207674_10124424 3300026116 Bacteria 2545
273 Ga0207674_10169117 3300026116 Bacteria 2140
274 Ga0207698_10222015 3300026142 Bacteria 1708
275 Ga0207428_10034409 3300027907 Unclassified 4152
276 Ga0207428_10300508 3300027907 Unclassified 1188
277 Ga0224573_1005249 3300028019 Bacteria 952
278 Ga0268266_10072709 3300028379 Bacteria 2983
279 Ga0268264_10060648 3300028381 Bacteria 3171
280 Ga0268264_10158167 3300028381 Bacteria 2038
281 Ga0265337_1000465 3300028556 Bacteria 21445
282 Ga0265326_10000855 3300028558 Bacteria 11121
283 Ga0265319_1001167 3300028563 Bacteria 16251
284 Ga0265334_10000280 3300028573 Bacteria 28789
285 Ga0265318_10067509 3300028577 Bacteria 1327
286 Ga0265323_10010781 3300028653 Bacteria 3700
287 Ga0265322_10001558 3300028654 Bacteria 7349
288 Ga0265336_10005134 3300028666 Bacteria 4865
289 Ga0265338_10005484 3300028800 Bacteria 16544
290 Ga0265338_10279663 3300028800 Bacteria 1220
291 Ga0265324_10009764 3300029957 Bacteria 3731
292 Ga0265332_10008155 3300031238 Bacteria 4710
293 Ga0265320_10002222 3300031240 Bacteria 13614
294 Ga0265325_10017199 3300031241 Bacteria 4021
295 Ga0265340_10001655 3300031247 Bacteria 12799
296 Ga0265316_10007304 3300031344 Bacteria 10423
297 Ga0265314_10002495 3300031711 Bacteria 18792
298 Ga0265342_10018782 3300031712 Bacteria 4468
299 Ga0316576_10366548 3300031727 Bacteria 1071
300 Ga0307407_10433358 3300031903 Bacteria 950
301 Ga0307416_100061502 3300032002 Bacteria 3065
302 Ga0307411_10861925 3300032005 Bacteria 802
303 Ga0316212_1001321 3300033547 Bacteria 3369
304 Ga0373930_0046579 3300034816 Bacteria 937
305 Ga0373948_0018821 3300034817 Bacteria 1301
306 Ga0373926_0000431 3300035083 Bacteria 10840
307 Ga0373926_0000476 3300035083 Bacteria 10596
308 Ga0373934_0000168 3300035086 Bacteria 23941
309 Ga0373934_0033700 3300035086 Bacteria 2011
310 Ga0373934_0033970 3300035086 Bacteria 2003
311 Ga0373934_0062423 3300035086 Bacteria 1485
312 Ga0373934_0150192 3300035086 Bacteria 954
313 Ga0373944_0001774 3300035089 Bacteria 5448
314 Ga0373944_0005054 3300035089 Bacteria 3462
315 Ga0373923_0056980 3300035111 Bacteria 1651
316 Ga0373923_0091919 3300035111 Unclassified 1328
317 Ga0373936_0000300 3300035113 Bacteria 16641
318 Ga0373945_0000765 3300035116 Bacteria 9383
319 Ga0373953_0000792 3300035117 Bacteria 8812
320 Ga0373953_0031879 3300035117 Bacteria 2052
321 Ga0373954_0050896 3300035118 Bacteria 1944
322 Ga0373954_0053232 3300035118 Bacteria 1903
323 Ga0373954_0054664 3300035118 Bacteria 1878
324 Ga0373954_0183070 3300035118 Bacteria 1027
325 Ga0373956_0000659 3300035119 Bacteria 14189
326 Ga0373956_0014132 3300035119 Bacteria 3330
327 Ga0373956_0039402 3300035119 Bacteria 2094
328 Ga0373956_0111090 3300035119 Unclassified 1276
329 Ga0373957_0000030 3300035120 Bacteria 37344
330 Ga0373957_0098899 3300035120 Unclassified 1166
331 Ga0373960_0031436 3300035121 Bacteria 1485
332 Ga0373943_0000210 3300035170 Bacteria 23878
333 Ga0373946_0000983 3300035171 Bacteria 9777
334 Ga0373955_0008436 3300035172 Bacteria 4786
335 Ga0373955_0098089 3300035172 Bacteria 1678
336 Ga0373955_0151230 3300035172 Bacteria 1366
337 Ga0373955_0247420 3300035172 Bacteria 1068
338 Ga0373924_0000066 3300035410 Bacteria 27663
339 Ga0373924_0043919 3300035410 Bacteria 1836
340 Ga0373924_0044247 3300035410 Bacteria 1829
341 Ga0373924_0050410 3300035410 Bacteria 1724
342 Ga0373935_0000262 3300035692 Bacteria 25962
343 Ga0373935_0085329 3300035692 Bacteria 2058
344 Ga0373935_0295564 3300035692 Bacteria 1143
345 Ga0373927_0001724 3300035695 Bacteria 16345
346 Ga0373927_0006501 3300035695 Bacteria 7961
347 Ga0373933_0000004 3300035724 Bacteria 143741
348 Ga0373933_0016413 3300035724 Bacteria 4140
349 Ga0373933_0116032 3300035724 Bacteria 1673
350 Ga0373933_0170042 3300035724 Bacteria 1386
351 Ga0373933_0569345 3300035724 Bacteria 743
352 Ga0373947_0000034 3300035725 Bacteria 71054
353 Ga0373947_0008501 3300035725 Bacteria 5912
354 Ga0373947_0162130 3300035725 Bacteria 1447
355 Ga0373937_0000012 3300036401 Bacteria 159418
356 Ga0373937_0064228 3300036401 Bacteria 3376
357 Ga0373937_0071950 3300036401 Bacteria 3189
358 Ga0373937_0192107 3300036401 Unclassified 1918
359 Ga0373937_0213318 3300036401 Bacteria 1817
360 Ga0373937_0502039 3300036401 Bacteria 1152
361 Ga0372808_006243 3300036459 Bacteria 1601
362 Ga0373925_0000360 3300037068 Bacteria 47318
363 Ga0373925_0000989 3300037068 Bacteria 25847
364 Ga0373925_0276248 3300037068 Bacteria 1352
365 Ga0373925_0277191 3300037068 Bacteria 1350
366 Ga0373925_0762832 3300037068 Bacteria 797
367 Ga0395900_0596293 3300037418 Bacteria 1046
368 Ga0395898_0331429 3300037466 Bacteria 1451
369 Ga0395898_0370733 3300037466 Bacteria 1365
370 Ga0395905_0198737 3300037471 Bacteria 1880
371 Ga0436364_0081252 3300037853 Bacteria 6633
372 Ga0436364_0279121 3300037853 Bacteria 2480
373 Ga0436364_0481924 3300037853 Bacteria 17385
374 Ga0436364_0640653 3300037853 Bacteria 839
375 Ga0436364_0931640 3300037853 Bacteria 5092
376 Ga0436364_1069957 3300037853 Bacteria 1993
377 Ga0395901_0038423 3300038443 Bacteria 4951
378 Ga0436365_1509215 3300039437 Bacteria 1444
379 Ga0436363_1093036 3300039450 Bacteria 1185
380 Ga0439448_0033007 3300042005 Bacteria 1650
381 Ga0439464_0038133 3300042439 Bacteria 1365
382 Ga0439460_0061036 3300042461 Unclassified 1151
383 Ga0439440_0051429 3300042993 Bacteria 1030
384 Ga0466969_0274987 3300044656 Bacteria 763
385 Ga0466961_0323258 3300044693 Bacteria 941
386 Ga0466963_0068331 3300044694 Bacteria 2386
387 Ga0466963_0682382 3300044694 Bacteria 725
388 Ga0466971_0029818 3300044719 Bacteria 2440
389 Ga0466971_0195098 3300044719 Bacteria 955
390 Ga0466968_0114067 3300044735 Bacteria 1217
391 Ga0466959_0484227 3300045049 Bacteria 837
392 Ga0466958_0220146 3300045836 Bacteria 1211
393 Ga0466967_0005844 3300045976 Bacteria 8609
394 Ga0466967_0125664 3300045976 Bacteria 2375
395 Ga0466967_0916253 3300045976 Bacteria 872
396 Ga0495592_0000183 3300046454 Bacteria 55068
397 Ga0495592_0151049 3300046454 Unclassified 1606
398 Ga0495592_0162484 3300046454 Unclassified 1535
399 Ga0495629_0059445 3300046459 Bacteria 2672
400 Ga0495629_0210909 3300046459 Bacteria 1341
401 Ga0495641_0013441 3300046461 Bacteria 4499
402 Ga0495651_0000020 3300046462 Bacteria 120523
403 Ga0495651_0032308 3300046462 Bacteria 4083
404 Ga0495651_0033325 3300046462 Bacteria 4018
405 Ga0495651_0099585 3300046462 Unclassified 2167
406 Ga0495651_0105886 3300046462 Unclassified 2085
407 Ga0495653_0000289 3300046463 Bacteria 40642
408 Ga0495653_0007471 3300046463 Bacteria 8938
409 Ga0495653_0042478 3300046463 Bacteria 3541
410 Ga0495653_0059142 3300046463 Bacteria 2910
411 Ga0495653_0128772 3300046463 Unclassified 1794
412 Ga0495580_0155547 3300046472 Bacteria 1583
413 Ga0495580_0605213 3300046472 Bacteria 724
414 Ga0495582_0033971 3300046473 Bacteria 2804
415 Ga0495582_0050029 3300046473 Bacteria 2302
416 Ga0495639_0040539 3300046475 Bacteria 2095
417 Ga0495639_0281658 3300046475 Bacteria 826
418 Ga0495662_0012422 3300046476 Bacteria 4156
419 Ga0495662_0169911 3300046476 Bacteria 1074
420 Ga0495664_0023647 3300046477 Bacteria 3567
421 Ga0495664_0158577 3300046477 Bacteria 1373
422 Ga0495664_0274092 3300046477 Bacteria 1019
423 Ga0495664_0403300 3300046477 Bacteria 821
424 Ga0495594_0165712 3300046499 Bacteria 1257
425 Ga0495608_0000015 3300046511 Bacteria 200266
426 Ga0495608_0014584 3300046511 Bacteria 5453
427 Ga0495608_0046288 3300046511 Bacteria 2895
428 Ga0495618_0014530 3300046514 Bacteria 4799
429 Ga0495618_0021949 3300046514 Bacteria 3939
430 Ga0495618_0035943 3300046514 Bacteria 3109
431 Ga0495618_0147155 3300046514 Unclassified 1505
432 Ga0495628_0000055 3300046516 Bacteria 89993
433 Ga0495628_0040013 3300046516 Bacteria 3748
434 Ga0495628_0123679 3300046516 Bacteria 1982
435 Ga0495628_0375735 3300046516 Unclassified 1041
436 Ga0495630_0003270 3300046517 Bacteria 11304
437 Ga0495666_0017641 3300046526 Bacteria 3554
438 Ga0495652_0000074 3300046529 Bacteria 105662
439 Ga0495652_0028707 3300046529 Bacteria 4892
440 Ga0495652_0064465 3300046529 Bacteria 3081
441 Ga0495652_0100692 3300046529 Bacteria 2343
442 Ga0495652_0436508 3300046529 Unclassified 919
443 Ga0495665_0009541 3300046531 Bacteria 5258
444 Ga0495665_0413171 3300046531 Bacteria 684
445 Ga0495640_0059189 3300046533 Bacteria 2610
446 Ga0495640_0061467 3300046533 Bacteria 2551
447 Ga0495640_0141437 3300046533 Bacteria 1551
448 Ga0495586_0108232 3300046535 Bacteria 1546
449 Ga0495587_0000085 3300046536 Bacteria 72715
450 Ga0495587_0024712 3300046536 Bacteria 3679
451 Ga0495587_0062499 3300046536 Bacteria 2180
452 Ga0495587_0081208 3300046536 Bacteria 1878
453 Ga0495587_0225123 3300046536 Bacteria 1057
454 Ga0495645_0035156 3300046543 Bacteria 3654
455 Ga0495645_0083380 3300046543 Unclassified 2291
456 Ga0495645_0235470 3300046543 Bacteria 1224
457 Ga0495645_0236634 3300046543 Bacteria 1220
458 Ga0495667_0000033 3300046559 Bacteria 143083
459 Ga0495667_0005551 3300046559 Bacteria 8526
460 Ga0495667_0006827 3300046559 Bacteria 7749
461 Ga0495667_0069820 3300046559 Unclassified 2292
462 Ga0495667_0081279 3300046559 Bacteria 2106
463 Ga0495667_0092475 3300046559 Bacteria 1958
464 Ga0495634_0023786 3300046642 Bacteria 4304
465 Ga0495634_0026887 3300046642 Bacteria 4011
466 Ga0495634_0102073 3300046642 Bacteria 1852
467 Ga0495634_0163962 3300046642 Bacteria 1400
468 Ga0495634_0181017 3300046642 Bacteria 1319
469 Ga0495635_0001020 3300046663 Bacteria 18505
470 Ga0495635_0005268 3300046663 Bacteria 8995
471 Ga0495635_0012670 3300046663 Bacteria 5914
472 Ga0495635_0104534 3300046663 Bacteria 1935
473 Ga0495657_0000097 3300046675 Bacteria 76773
474 Ga0495657_0007027 3300046675 Bacteria 8734
475 Ga0495657_0040639 3300046675 Bacteria 3188
476 Ga0495657_0046134 3300046675 Bacteria 2952
477 Ga0495657_0112606 3300046675 Bacteria 1722
478 Ga0495657_0147023 3300046675 Bacteria 1465
479 Ga0495599_0000018 3300046678 Bacteria 144334
480 Ga0495599_0055195 3300046678 Bacteria 2488
481 Ga0495599_0145324 3300046678 Bacteria 1470
482 Ga0495623_0000036 3300046679 Bacteria 83368
483 Ga0495623_0056901 3300046679 Bacteria 2461
484 Ga0495623_0190014 3300046679 Unclassified 1187
485 Ga0495646_0045035 3300046680 Bacteria 2696
486 Ga0495646_0107196 3300046680 Unclassified 1594
487 Ga0495646_0315317 3300046680 Bacteria 825
488 Ga0495647_0303859 3300046681 Bacteria 720
489 Ga0495658_0290269 3300046683 Bacteria 1033
490 Ga0495624_0003117 3300046690 Bacteria 12395
491 Ga0495624_0181888 3300046690 Bacteria 1281
492 Ga0495600_0039549 3300046809 Bacteria 3071
493 Ga0495600_0049946 3300046809 Bacteria 2729
494 Ga0495600_0069645 3300046809 Bacteria 2299
495 Ga0495600_0100585 3300046809 Bacteria 1884
496 Ga0495581_0006497 3300047315 Bacteria 6780
497 Ga0495581_0326684 3300047315 Bacteria 896
498 Ga0495604_0000025 3300047317 Bacteria 145481
499 Ga0495604_0042463 3300047317 Bacteria 3563
500 Ga0495604_0100949 3300047317 Bacteria 2120
501 Ga0495604_0129088 3300047317 Bacteria 1819
502 Ga0495674_0001674 3300047319 Bacteria 21807
503 Ga0495674_0127417 3300047319 Bacteria 2146
504 Ga0495674_0130166 3300047319 Bacteria 2120
505 Ga0495674_0140246 3300047319 Unclassified 2032
506 Ga0495676_0008328 3300047321 Bacteria 9509
507 Ga0495680_0000015 3300047322 Bacteria 131335
508 Ga0495680_0006577 3300047322 Bacteria 10782
509 Ga0495680_0011182 3300047322 Bacteria 7969
510 Ga0495680_0052508 3300047322 Bacteria 3177
511 Ga0495680_0075950 3300047322 Bacteria 2549
512 Ga0495680_0102874 3300047322 Bacteria 2126
513 Ga0495680_0115438 3300047322 Bacteria 1986
514 Ga0495675_0000672 3300047444 Bacteria 21567
515 Ga0495675_0019498 3300047444 Bacteria 4309
516 Ga0495675_0290299 3300047444 Unclassified 973
517 Ga0495684_0011011 3300047471 Bacteria 6993
518 Ga0495684_0023450 3300047471 Bacteria 4744
519 Ga0495684_0025658 3300047471 Bacteria 4528
520 Ga0495684_0122954 3300047471 Bacteria 1953
521 Ga0495684_0196589 3300047471 Bacteria 1488
522 Ga0495593_0041891 3300047673 Bacteria 2460
523 Ga0495602_0000065 3300048088 Bacteria 104080
524 Ga0495602_0141713 3300048088 Bacteria 1902
525 Ga0496100_0872076 3300048903 Bacteria 706
526 Ga0496101_0595456 3300048904 Bacteria 874
527 Ga0496101_0684704 3300048904 Bacteria 810
528 Ga0496102_0104498 3300048905 Bacteria 2634
529 Ga0496102_0402250 3300048905 Bacteria 1287
530 Ga0496102_0748614 3300048905 Bacteria 900
531 Ga0496104_0029706 3300048907 Bacteria 5072
532 Ga0496104_0445110 3300048907 Unclassified 1207
533 Ga0496104_0695724 3300048907 Bacteria 924
534 Ga0496105_0036243 3300048908 Bacteria 4063
535 Ga0496105_0372443 3300048908 Unclassified 1137
536 Ga0496108_0378535 3300048911 Bacteria 1236
537 Ga0496109_0530188 3300048912 Bacteria 1111
538 Ga0496109_0663475 3300048912 Bacteria 980
539 Ga0496110_0269452 3300048913 Bacteria 1550
540 Ga0496110_0692628 3300048913 Bacteria 920
541 Ga0496111_0207040 3300048914 Bacteria 1458
542 Ga0496112_0964095 3300048915 Bacteria 773
543 Ga0496113_0226106 3300048916 Bacteria 1492
544 Ga0496113_0566236 3300048916 Bacteria 911
545 Ga0496114_0469182 3300048917 Bacteria 1114
546 Ga0496115_0063207 3300048918 Bacteria 2986
547 Ga0496121_0011538 3300048924 Bacteria 9790
548 Ga0496126_0047852 3300048929 Bacteria 3913
549 Ga0496126_0471972 3300048929 Bacteria 1007
550 Ga0501031_0018654 3300049568 Bacteria 4518
551 Ga0501033_0091046 3300049570 Bacteria 2231
552 Ga0501033_0160848 3300049570 Bacteria 1617
553 Ga0501036_0130669 3300049572 Bacteria 2120
554 Ga0501037_0099178 3300049573 Bacteria 2104
555 Ga0501038_0260862 3300049574 Unclassified 1370
556 Ga0501039_0010812 3300049575 Bacteria 6953
557 Ga0501039_0591038 3300049575 Unclassified 870
558 Ga0501041_0054564 3300049577 Bacteria 2438
559 Ga0501041_0340862 3300049577 Unclassified 947
560 Ga0501042_0048807 3300049578 Bacteria 3018
561 Ga0501042_0132373 3300049578 Bacteria 1798
562 Ga0501046_0192742 3300049580 Bacteria 1519
563 Ga0501046_0416335 3300049580 Unclassified 969
564 Ga0501047_0486706 3300049581 Bacteria 1061
565 Ga0501048_0118144 3300049582 Bacteria 1873
566 Ga0501071_0090056 3300049587 Bacteria 2252
567 Ga0501072_0082620 3300049588 Bacteria 2546
568 Ga0501074_0099573 3300049590 Bacteria 2081
569 Ga0501075_0096827 3300049591 Bacteria 2239
570 Ga0501076_0050939 3300049592 Bacteria 3276
571 Ga0501076_0589148 3300049592 Bacteria 917
572 Ga0501077_0011611 3300049593 Bacteria 5506
573 Ga0501079_0038445 3300049741 Bacteria 3690
574 Ga0501079_0546756 3300049741 Unclassified 911
575 Ga0501080_0109491 3300049742 Bacteria 2561
576 Ga0501080_0256749 3300049742 Bacteria 1593
577 Ga0501080_0763573 3300049742 Unclassified 850
578 Ga0501081_0011714 3300049743 Bacteria 5740
579 Ga0501081_0107876 3300049743 Bacteria 1975
580 Ga0501045_0022809 3300049824 Bacteria 4484
581 Ga0501045_0714765 3300049824 Unclassified 739
582 nmdc:mga05p37_22111_c1 3300050507 Bacteria 7710
583 nmdc:mga05p37_238108_c1 3300050507 Bacteria 2190
584 nmdc:mga05p37_4010_c1 3300050507 Bacteria 17215
585 nmdc:mga05p37_57246_c1 3300050507 Bacteria 4801
586 nmdc:mga09592_13996_c1 3300050508 Bacteria 6550
587 nmdc:mga09592_354894_c1 3300050508 Bacteria 1269
588 nmdc:mga09592_38531_c1 3300050508 Bacteria 4013
589 nmdc:mga09592_803233_c1 3300050508 Unclassified 796
590 nmdc:mga0qj67_1425_c1 3300050509 Bacteria 16740
591 nmdc:mga0qj67_150343_c1 3300050509 Bacteria 1889
592 nmdc:mga0qj67_21951_c1 3300050509 Bacteria 4898
593 nmdc:mga0qj67_557137_c1 3300050509 Unclassified 919
594 nmdc:mga06r32_10754_c1 3300050510 Bacteria 8242
595 nmdc:mga06r32_67971_c1 3300050510 Unclassified 3441
596 nmdc:mga06r32_69419_c1 3300050510 Bacteria 3406
597 nmdc:mga06r32_9139_c1 3300050510 Bacteria 8933
598 nmdc:mga08y16_24791_c1 3300050511 Bacteria 6329
599 nmdc:mga08y16_248175_c1 3300050511 Unclassified 1839
600 nmdc:mga08y16_249766_c1 3300050511 Bacteria 1833
601 nmdc:mga0n895_149348_c1 3300050512 Bacteria 2366
602 nmdc:mga0n895_61735_c1 3300050512 Bacteria 3701
603 nmdc:mga0n895_61903_c1 3300050512 Bacteria 3696
604 nmdc:mga0rr50_83850_c1 3300050513 Bacteria 2465
605 nmdc:mga08x19_106142_c1 3300050514 Bacteria 1869
606 nmdc:mga08x19_540327_c1 3300050514 Bacteria 824
607 nmdc:mga0a205_120526_c1 3300050515 Bacteria 2523
608 Ga0495601_0165081 3300053077 Unclassified 1447
609 Ga0495612_0255209 3300053078 Bacteria 780
610 Ga0495595_0000838 3300053084 Bacteria 11765
611 Ga0495619_0005205 3300053085 Bacteria 8245
612 Ga0495619_0071878 3300053085 Bacteria 2316
613 Ga0501084_0091282 3300054114 Bacteria 2557
614 Ga0501084_0353320 3300054114 Bacteria 1242
615 Ga0501082_0408978 3300060353 Bacteria 1184
616 Ga0501082_0600049 3300060353 Bacteria 963
617 Ga0530510_0096353 3300061734 Bacteria 2163
618 Ga0530510_0161353 3300061734 Bacteria 1658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042439 Ga0439464_0038133 Ga0439464_0038133_16_609 197
2 3300049742 Ga0501080_0763573 Ga0501080_0763573_242_835 197
3 3300049578 Ga0501042_0048807 Ga0501042_0048807_1519_2199 201
4 3300054114 Ga0501084_0091282 Ga0501084_0091282_868_1548 201
5 3300060353 Ga0501082_0600049 Ga0501082_0600049_83_763 201
6 3300005336 Ga0070680_100000019 Ga0070680_10000001947 204
7 3300005337 Ga0070682_100192951 Ga0070682_1001929512 204
8 3300005458 Ga0070681_10000017 Ga0070681_1000001755 204
9 3300005530 Ga0070679_100000009 Ga0070679_10000000961 204
10 3300025912 Ga0207707_10000257 Ga0207707_1000025756 204
11 3300025917 Ga0207660_10000169 Ga0207660_1000016932 204
12 3300025921 Ga0207652_10000124 Ga0207652_1000012413 204
13 3300025944 Ga0207661_10153555 Ga0207661_101535552 204
14 3300049582 Ga0501048_0118144 Ga0501048_0118144_38_718 206
15 3300049568 Ga0501031_0018654 Ga0501031_0018654_1761_2441 209
16 3300049570 Ga0501033_0091046 Ga0501033_0091046_601_1281 209
17 3300049572 Ga0501036_0130669 Ga0501036_0130669_351_1031 209
18 3300049573 Ga0501037_0099178 Ga0501037_0099178_1206_1886 209
19 3300049575 Ga0501039_0010812 Ga0501039_0010812_835_1515 209
20 3300049580 Ga0501046_0192742 Ga0501046_0192742_754_1434 209
21 3300049587 Ga0501071_0090056 Ga0501071_0090056_880_1560 209
22 3300049588 Ga0501072_0082620 Ga0501072_0082620_201_881 209
23 3300049590 Ga0501074_0099573 Ga0501074_0099573_987_1667 209
24 3300049591 Ga0501075_0096827 Ga0501075_0096827_704_1384 209
25 3300049592 Ga0501076_0050939 Ga0501076_0050939_820_1500 209
26 3300049593 Ga0501077_0011611 Ga0501077_0011611_3540_4220 209
27 3300049741 Ga0501079_0038445 Ga0501079_0038445_1515_2195 209
28 3300049742 Ga0501080_0256749 Ga0501080_0256749_382_1062 209
29 3300049743 Ga0501081_0011714 Ga0501081_0011714_4807_5487 209
30 3300049824 Ga0501045_0022809 Ga0501045_0022809_966_1646 209
31 3300009148 Ga0105243_10025687 Ga0105243_100256871 210
32 3300013102 Ga0157371_10382259 Ga0157371_103822591 210
33 3300049743 Ga0501081_0107876 Ga0501081_0107876_51_716 210
34 3300037068 Ga0373925_0000360 Ga0373925_0000360_24244_24912 212
35 3300005563 Ga0068855_100077532 Ga0068855_1000775322 214
36 3300006852 Ga0075433_10223274 Ga0075433_102232742 214
37 3300009147 Ga0114129_10005178 Ga0114129_1000517810 214
38 3300025949 Ga0207667_10488126 Ga0207667_104881262 214
39 3300026023 Ga0207677_10113236 Ga0207677_101132361 214
40 3300046531 Ga0495665_0413171 Ga0495665_0413171_26_670 214
41 3300050507 nmdc:mga05p37_4010_c1 nmdc:mga05p37_4010_c1_3464_4132 214
42 3300050511 nmdc:mga08y16_249766_c1 nmdc:mga08y16_249766_c1_837_1505 214
43 3300050514 nmdc:mga08x19_106142_c1 nmdc:mga08x19_106142_c1_1185_1853 214
44 3300050515 nmdc:mga0a205_120526_c1 nmdc:mga0a205_120526_c1_1055_1723 214
45 3300005329 Ga0070683_100063735 Ga0070683_1000637353 216
46 3300005344 Ga0070661_100035206 Ga0070661_1000352063 216
47 3300005436 Ga0070713_100856856 Ga0070713_1008568561 216
48 3300005458 Ga0070681_10055498 Ga0070681_100554984 216
49 3300005535 Ga0070684_100064911 Ga0070684_1000649112 216
50 3300005577 Ga0068857_100392285 Ga0068857_1003922851 216
51 3300005614 Ga0068856_100170286 Ga0068856_1001702863 216
52 3300013104 Ga0157370_10043258 Ga0157370_100432584 216
53 3300013105 Ga0157369_10205929 Ga0157369_102059292 216
54 3300025912 Ga0207707_10461405 Ga0207707_104614051 216
55 3300025928 Ga0207700_10460771 Ga0207700_104607712 216
56 3300025929 Ga0207664_10504769 Ga0207664_105047691 216
57 3300025944 Ga0207661_10143164 Ga0207661_101431642 216
58 3300026078 Ga0207702_10208083 Ga0207702_102080832 216
59 3300026116 Ga0207674_10169117 Ga0207674_101691173 216
60 3300006028 Ga0070717_10477563 Ga0070717_104775632 217
61 3300006914 Ga0075436_100444179 Ga0075436_1004441792 217
62 3300037853 Ga0436364_0640653 Ga0436364_0640653_117_773 217
63 3300044693 Ga0466961_0323258 Ga0466961_0323258_44_700 217
64 3300044694 Ga0466963_0682382 Ga0466963_0682382_51_707 217
65 3300044719 Ga0466971_0195098 Ga0466971_0195098_279_935 217
66 3300045976 Ga0466967_0916253 Ga0466967_0916253_54_710 217
67 3300028019 Ga0224573_1005249 Ga0224573_10052491 218
68 3300005327 Ga0070658_10000213 Ga0070658_1000021346 219
69 3300005330 Ga0070690_100570593 Ga0070690_1005705931 219
70 3300005353 Ga0070669_100269210 Ga0070669_1002692102 219
71 3300005549 Ga0070704_100037895 Ga0070704_1000378953 219
72 3300005618 Ga0068864_100519775 Ga0068864_1005197752 219
73 3300005844 Ga0068862_100654012 Ga0068862_1006540122 219
74 3300006847 Ga0075431_100013919 Ga0075431_10001391910 219
75 3300009553 Ga0105249_10251688 Ga0105249_102516882 219
76 3300013306 Ga0163162_10322635 Ga0163162_103226353 219
77 3300025909 Ga0207705_10001330 Ga0207705_1000133011 219
78 3300025923 Ga0207681_10264734 Ga0207681_102647342 219
79 3300026142 Ga0207698_10222015 Ga0207698_102220151 219
80 3300031727 Ga0316576_10366548 Ga0316576_103665482 219
81 3300049581 Ga0501047_0486706 Ga0501047_0486706_208_870 219
82 3300049742 Ga0501080_0109491 Ga0501080_0109491_29_691 219
83 3300050510 nmdc:mga06r32_9139_c1 nmdc:mga06r32_9139_c1_170_832 219
84 3300013105 Ga0157369_10033922 Ga0157369_100339225 220
85 3300005981 Ga0081538_10017617 Ga0081538_100176174 221
86 3300049575 Ga0501039_0591038 Ga0501039_0591038_116_781 221
87 3300049580 Ga0501046_0416335 Ga0501046_0416335_252_917 221
88 3300049592 Ga0501076_0589148 Ga0501076_0589148_205_870 221
89 3300060353 Ga0501082_0408978 Ga0501082_0408978_163_828 221
90 3300061734 Ga0530510_0096353 Ga0530510_0096353_1302_1967 221
91 3300005329 Ga0070683_100423772 Ga0070683_1004237722 222
92 3300005339 Ga0070660_100040646 Ga0070660_1000406463 222
93 3300005341 Ga0070691_10149758 Ga0070691_101497582 222
94 3300005344 Ga0070661_100590751 Ga0070661_1005907511 222
95 3300005345 Ga0070692_10216816 Ga0070692_102168162 222
96 3300005364 Ga0070673_100011807 Ga0070673_1000118075 222
97 3300005366 Ga0070659_100152964 Ga0070659_1001529641 222
98 3300005434 Ga0070709_10205593 Ga0070709_102055932 222
99 3300005434 Ga0070709_10226220 Ga0070709_102262202 222
100 3300005434 Ga0070709_10287240 Ga0070709_102872402 222
101 3300005434 Ga0070709_10377977 Ga0070709_103779771 222
102 3300005435 Ga0070714_100007177 Ga0070714_1000071776 222
103 3300005435 Ga0070714_100012659 Ga0070714_1000126597 222
104 3300005435 Ga0070714_100040400 Ga0070714_1000404005 222
105 3300005435 Ga0070714_100157323 Ga0070714_1001573232 222
106 3300005435 Ga0070714_100313884 Ga0070714_1003138842 222
107 3300005435 Ga0070714_100462441 Ga0070714_1004624412 222
108 3300005436 Ga0070713_100012336 Ga0070713_1000123365 222
109 3300005436 Ga0070713_100012427 Ga0070713_1000124274 222
110 3300005436 Ga0070713_100112132 Ga0070713_1001121322 222
111 3300005436 Ga0070713_100140281 Ga0070713_1001402813 222
112 3300005436 Ga0070713_100346535 Ga0070713_1003465352 222
113 3300005437 Ga0070710_10049701 Ga0070710_100497012 222
114 3300005437 Ga0070710_10050765 Ga0070710_100507652 222
115 3300005437 Ga0070710_10075875 Ga0070710_100758753 222
116 3300005437 Ga0070710_10111568 Ga0070710_101115681 222
117 3300005437 Ga0070710_10157257 Ga0070710_101572572 222
118 3300005437 Ga0070710_10216143 Ga0070710_102161432 222
119 3300005439 Ga0070711_100282899 Ga0070711_1002828992 222
120 3300005439 Ga0070711_100338567 Ga0070711_1003385672 222
121 3300005439 Ga0070711_100464121 Ga0070711_1004641212 222
122 3300005440 Ga0070705_100286352 Ga0070705_1002863522 222
123 3300005445 Ga0070708_100011947 Ga0070708_1000119474 222
124 3300005445 Ga0070708_100014738 Ga0070708_1000147388 222
125 3300005445 Ga0070708_100356331 Ga0070708_1003563312 222
126 3300005445 Ga0070708_100460479 Ga0070708_1004604792 222
127 3300005455 Ga0070663_100038124 Ga0070663_1000381242 222
128 3300005457 Ga0070662_100219152 Ga0070662_1002191521 222
129 3300005467 Ga0070706_100051531 Ga0070706_1000515313 222
130 3300005467 Ga0070706_100057239 Ga0070706_1000572394 222
131 3300005467 Ga0070706_100116324 Ga0070706_1001163241 222
132 3300005467 Ga0070706_100161218 Ga0070706_1001612183 222
133 3300005467 Ga0070706_100188359 Ga0070706_1001883594 222
134 3300005467 Ga0070706_100322559 Ga0070706_1003225592 222
135 3300005468 Ga0070707_100005906 Ga0070707_1000059069 222
136 3300005468 Ga0070707_100008251 Ga0070707_10000825110 222
137 3300005468 Ga0070707_100028448 Ga0070707_1000284485 222
138 3300005468 Ga0070707_100059720 Ga0070707_1000597203 222
139 3300005468 Ga0070707_100084629 Ga0070707_1000846292 222
140 3300005468 Ga0070707_100557090 Ga0070707_1005570902 222
141 3300005471 Ga0070698_100010686 Ga0070698_10001068611 222
142 3300005471 Ga0070698_100017421 Ga0070698_1000174215 222
143 3300005471 Ga0070698_100086656 Ga0070698_1000866565 222
144 3300005471 Ga0070698_100124991 Ga0070698_1001249913 222
145 3300005471 Ga0070698_100131186 Ga0070698_1001311863 222
146 3300005518 Ga0070699_100004942 Ga0070699_1000049428 222
147 3300005518 Ga0070699_100058112 Ga0070699_1000581125 222
148 3300005518 Ga0070699_100090514 Ga0070699_1000905142 222
149 3300005518 Ga0070699_100101812 Ga0070699_1001018122 222
150 3300005535 Ga0070684_100200352 Ga0070684_1002003522 222
151 3300005536 Ga0070697_100028812 Ga0070697_1000288122 222
152 3300005536 Ga0070697_100089181 Ga0070697_1000891811 222
153 3300005548 Ga0070665_100061688 Ga0070665_1000616883 222
154 3300005563 Ga0068855_100317339 Ga0068855_1003173392 222
155 3300005564 Ga0070664_100544292 Ga0070664_1005442922 222
156 3300005614 Ga0068856_100226395 Ga0068856_1002263952 222
157 3300005614 Ga0068856_100538817 Ga0068856_1005388171 222
158 3300005617 Ga0068859_100228327 Ga0068859_1002283273 222
159 3300005719 Ga0068861_100250557 Ga0068861_1002505572 222
160 3300005983 Ga0081540_1001003 Ga0081540_10010038 222
161 3300006028 Ga0070717_10034799 Ga0070717_100347991 222
162 3300006028 Ga0070717_10038844 Ga0070717_100388444 222
163 3300006028 Ga0070717_10167481 Ga0070717_101674812 222
164 3300006028 Ga0070717_10220044 Ga0070717_102200442 222
165 3300006028 Ga0070717_10235358 Ga0070717_102353582 222
166 3300006028 Ga0070717_10356217 Ga0070717_103562171 222
167 3300006028 Ga0070717_10417728 Ga0070717_104177282 222
168 3300006163 Ga0070715_10021712 Ga0070715_100217122 222
169 3300006173 Ga0070716_100014070 Ga0070716_1000140705 222
170 3300006173 Ga0070716_100341553 Ga0070716_1003415531 222
171 3300006175 Ga0070712_100117716 Ga0070712_1001177163 222
172 3300006175 Ga0070712_100154048 Ga0070712_1001540482 222
173 3300006175 Ga0070712_100351578 Ga0070712_1003515782 222
174 3300006914 Ga0075436_100241566 Ga0075436_1002415662 222
175 3300006914 Ga0075436_100246773 Ga0075436_1002467732 222
176 3300006931 Ga0097620_100228320 Ga0097620_1002283203 222
177 3300007076 Ga0075435_100325381 Ga0075435_1003253811 222
178 3300007265 Ga0099794_10003212 Ga0099794_100032122 222
179 3300007788 Ga0099795_10165202 Ga0099795_101652021 222
180 3300009098 Ga0105245_10730042 Ga0105245_107300421 222
181 3300009551 Ga0105238_10052582 Ga0105238_100525825 222
182 3300010375 Ga0105239_10517413 Ga0105239_105174132 222
183 3300013105 Ga0157369_10765738 Ga0157369_107657382 222
184 3300014325 Ga0163163_10219566 Ga0163163_102195661 222
185 3300014325 Ga0163163_10624886 Ga0163163_106248862 222
186 3300014969 Ga0157376_10609678 Ga0157376_106096781 222
187 3300017792 Ga0163161_10160835 Ga0163161_101608353 222
188 3300021377 Ga0213874_10065941 Ga0213874_100659411 222
189 3300021388 Ga0213875_10000331 Ga0213875_100003313 222
190 3300021388 Ga0213875_10054073 Ga0213875_100540731 222
191 3300021388 Ga0213875_10127527 Ga0213875_101275271 222
192 3300024225 Ga0224572_1025526 Ga0224572_10255262 222
193 3300025885 Ga0207653_10048321 Ga0207653_100483211 222
194 3300025898 Ga0207692_10015529 Ga0207692_100155295 222
195 3300025898 Ga0207692_10027667 Ga0207692_100276673 222
196 3300025898 Ga0207692_10068899 Ga0207692_100688992 222
197 3300025898 Ga0207692_10104511 Ga0207692_101045111 222
198 3300025898 Ga0207692_10181926 Ga0207692_101819262 222
199 3300025904 Ga0207647_10071880 Ga0207647_100718803 222
200 3300025905 Ga0207685_10027521 Ga0207685_100275213 222
201 3300025905 Ga0207685_10191682 Ga0207685_101916821 222
202 3300025906 Ga0207699_10107661 Ga0207699_101076612 222
203 3300025906 Ga0207699_10110563 Ga0207699_101105633 222
204 3300025906 Ga0207699_10210643 Ga0207699_102106432 222
205 3300025906 Ga0207699_10238970 Ga0207699_102389702 222
206 3300025907 Ga0207645_10271538 Ga0207645_102715381 222
207 3300025910 Ga0207684_10016693 Ga0207684_100166934 222
208 3300025910 Ga0207684_10042949 Ga0207684_100429491 222
209 3300025910 Ga0207684_10150379 Ga0207684_101503792 222
210 3300025910 Ga0207684_10239457 Ga0207684_102394571 222
211 3300025910 Ga0207684_10267333 Ga0207684_102673332 222
212 3300025910 Ga0207684_10280246 Ga0207684_102802461 222
213 3300025910 Ga0207684_10743950 Ga0207684_107439501 222
214 3300025912 Ga0207707_10259492 Ga0207707_102594921 222
215 3300025912 Ga0207707_10863149 Ga0207707_108631492 222
216 3300025915 Ga0207693_10019644 Ga0207693_100196446 222
217 3300025915 Ga0207693_10047210 Ga0207693_100472102 222
218 3300025915 Ga0207693_10308146 Ga0207693_103081462 222
219 3300025915 Ga0207693_10313667 Ga0207693_103136671 222
220 3300025916 Ga0207663_10021075 Ga0207663_100210755 222
221 3300025919 Ga0207657_10010424 Ga0207657_100104245 222
222 3300025919 Ga0207657_10055235 Ga0207657_100552353 222
223 3300025922 Ga0207646_10016556 Ga0207646_100165565 222
224 3300025922 Ga0207646_10023573 Ga0207646_100235737 222
225 3300025922 Ga0207646_10025085 Ga0207646_100250851 222
226 3300025922 Ga0207646_10033750 Ga0207646_100337505 222
227 3300025922 Ga0207646_10181456 Ga0207646_101814561 222
228 3300025928 Ga0207700_10005513 Ga0207700_100055132 222
229 3300025928 Ga0207700_10035499 Ga0207700_100354992 222
230 3300025928 Ga0207700_10083172 Ga0207700_100831723 222
231 3300025928 Ga0207700_10084842 Ga0207700_100848423 222
232 3300025928 Ga0207700_10129193 Ga0207700_101291933 222
233 3300025928 Ga0207700_10553457 Ga0207700_105534573 222
234 3300025928 Ga0207700_10667170 Ga0207700_106671702 222
235 3300025929 Ga0207664_10002531 Ga0207664_100025314 222
236 3300025929 Ga0207664_10026427 Ga0207664_100264272 222
237 3300025929 Ga0207664_10027387 Ga0207664_100273872 222
238 3300025929 Ga0207664_10056586 Ga0207664_100565862 222
239 3300025929 Ga0207664_10076759 Ga0207664_100767593 222
240 3300025929 Ga0207664_10380323 Ga0207664_103803231 222
241 3300025934 Ga0207686_10382862 Ga0207686_103828621 222
242 3300025939 Ga0207665_10006674 Ga0207665_100066748 222
243 3300025939 Ga0207665_10246261 Ga0207665_102462612 222
244 3300025945 Ga0207679_10451031 Ga0207679_104510312 222
245 3300025949 Ga0207667_10416216 Ga0207667_104162162 222
246 3300026041 Ga0207639_10397522 Ga0207639_103975221 222
247 3300026067 Ga0207678_10067299 Ga0207678_100672993 222
248 3300026067 Ga0207678_10072705 Ga0207678_100727051 222
249 3300028379 Ga0268266_10072709 Ga0268266_100727092 222
250 3300028381 Ga0268264_10158167 Ga0268264_101581672 222
251 3300028556 Ga0265337_1000465 Ga0265337_100046512 222
252 3300028558 Ga0265326_10000855 Ga0265326_100008555 222
253 3300028563 Ga0265319_1001167 Ga0265319_100116710 222
254 3300028573 Ga0265334_10000280 Ga0265334_1000028014 222
255 3300028577 Ga0265318_10067509 Ga0265318_100675092 222
256 3300028653 Ga0265323_10010781 Ga0265323_100107814 222
257 3300028654 Ga0265322_10001558 Ga0265322_100015583 222
258 3300028666 Ga0265336_10005134 Ga0265336_100051345 222
259 3300028800 Ga0265338_10005484 Ga0265338_100054845 222
260 3300028800 Ga0265338_10279663 Ga0265338_102796631 222
261 3300029957 Ga0265324_10009764 Ga0265324_100097643 222
262 3300031238 Ga0265332_10008155 Ga0265332_100081554 222
263 3300031240 Ga0265320_10002222 Ga0265320_100022225 222
264 3300031241 Ga0265325_10017199 Ga0265325_100171993 222
265 3300031247 Ga0265340_10001655 Ga0265340_100016553 222
266 3300031344 Ga0265316_10007304 Ga0265316_100073042 222
267 3300031711 Ga0265314_10002495 Ga0265314_1000249515 222
268 3300031712 Ga0265342_10018782 Ga0265342_100187822 222
269 3300033547 Ga0316212_1001321 Ga0316212_10013213 222
270 3300034817 Ga0373948_0018821 Ga0373948_0018821_106_774 222
271 3300035083 Ga0373926_0000431 Ga0373926_0000431_5434_6102 222
272 3300035083 Ga0373926_0000476 Ga0373926_0000476_2927_3595 222
273 3300035086 Ga0373934_0000168 Ga0373934_0000168_4043_4711 222
274 3300035086 Ga0373934_0033970 Ga0373934_0033970_953_1621 222
275 3300035086 Ga0373934_0062423 Ga0373934_0062423_147_815 222
276 3300035086 Ga0373934_0150192 Ga0373934_0150192_161_829 222
277 3300035089 Ga0373944_0001774 Ga0373944_0001774_4303_4971 222
278 3300035111 Ga0373923_0056980 Ga0373923_0056980_864_1532 222
279 3300035111 Ga0373923_0091919 Ga0373923_0091919_123_791 222
280 3300035113 Ga0373936_0000300 Ga0373936_0000300_8636_9304 222
281 3300035116 Ga0373945_0000765 Ga0373945_0000765_6726_7394 222
282 3300035117 Ga0373953_0000792 Ga0373953_0000792_4849_5517 222
283 3300035118 Ga0373954_0050896 Ga0373954_0050896_678_1346 222
284 3300035118 Ga0373954_0053232 Ga0373954_0053232_288_956 222
285 3300035118 Ga0373954_0054664 Ga0373954_0054664_1040_1708 222
286 3300035118 Ga0373954_0183070 Ga0373954_0183070_187_855 222
287 3300035119 Ga0373956_0000659 Ga0373956_0000659_3054_3722 222
288 3300035119 Ga0373956_0039402 Ga0373956_0039402_1040_1708 222
289 3300035119 Ga0373956_0111090 Ga0373956_0111090_331_999 222
290 3300035120 Ga0373957_0000030 Ga0373957_0000030_16134_16802 222
291 3300035120 Ga0373957_0098899 Ga0373957_0098899_21_689 222
292 3300035121 Ga0373960_0031436 Ga0373960_0031436_376_1044 222
293 3300035170 Ga0373943_0000210 Ga0373943_0000210_7277_7945 222
294 3300035171 Ga0373946_0000983 Ga0373946_0000983_7272_7940 222
295 3300035172 Ga0373955_0008436 Ga0373955_0008436_1234_1902 222
296 3300035172 Ga0373955_0098089 Ga0373955_0098089_593_1261 222
297 3300035172 Ga0373955_0151230 Ga0373955_0151230_260_928 222
298 3300035410 Ga0373924_0000066 Ga0373924_0000066_13997_14665 222
299 3300035410 Ga0373924_0043919 Ga0373924_0043919_614_1282 222
300 3300035410 Ga0373924_0044247 Ga0373924_0044247_568_1236 222
301 3300035410 Ga0373924_0050410 Ga0373924_0050410_944_1612 222
302 3300035692 Ga0373935_0000262 Ga0373935_0000262_21724_22392 222
303 3300035692 Ga0373935_0085329 Ga0373935_0085329_727_1395 222
304 3300035695 Ga0373927_0001724 Ga0373927_0001724_14760_15428 222
305 3300035695 Ga0373927_0006501 Ga0373927_0006501_26_694 222
306 3300035724 Ga0373933_0000004 Ga0373933_0000004_67694_68362 222
307 3300035724 Ga0373933_0016413 Ga0373933_0016413_2086_2754 222
308 3300035724 Ga0373933_0116032 Ga0373933_0116032_46_714 222
309 3300035724 Ga0373933_0170042 Ga0373933_0170042_101_769 222
310 3300035724 Ga0373933_0569345 Ga0373933_0569345_43_711 222
311 3300035725 Ga0373947_0000034 Ga0373947_0000034_37056_37724 222
312 3300035725 Ga0373947_0008501 Ga0373947_0008501_3070_3738 222
313 3300035725 Ga0373947_0162130 Ga0373947_0162130_232_900 222
314 3300036401 Ga0373937_0000012 Ga0373937_0000012_26851_27519 222
315 3300036401 Ga0373937_0064228 Ga0373937_0064228_2218_2886 222
316 3300036401 Ga0373937_0071950 Ga0373937_0071950_2096_2764 222
317 3300036401 Ga0373937_0192107 Ga0373937_0192107_753_1421 222
318 3300036401 Ga0373937_0213318 Ga0373937_0213318_726_1394 222
319 3300036459 Ga0372808_006243 Ga0372808_006243_711_1379 222
320 3300037068 Ga0373925_0000989 Ga0373925_0000989_21164_21832 222
321 3300037068 Ga0373925_0276248 Ga0373925_0276248_502_1170 222
322 3300037068 Ga0373925_0277191 Ga0373925_0277191_179_847 222
323 3300037466 Ga0395898_0370733 Ga0395898_0370733_564_1232 222
324 3300037853 Ga0436364_0081252 Ga0436364_0081252_5596_6264 222
325 3300037853 Ga0436364_0279121 Ga0436364_0279121_1482_2150 222
326 3300037853 Ga0436364_0481924 Ga0436364_0481924_702_1370 222
327 3300037853 Ga0436364_1069957 Ga0436364_1069957_486_1154 222
328 3300039437 Ga0436365_1509215 Ga0436365_1509215_731_1399 222
329 3300039450 Ga0436363_1093036 Ga0436363_1093036_83_751 222
330 3300044694 Ga0466963_0068331 Ga0466963_0068331_1269_1937 222
331 3300045049 Ga0466959_0484227 Ga0466959_0484227_61_729 222
332 3300045836 Ga0466958_0220146 Ga0466958_0220146_195_863 222
333 3300045976 Ga0466967_0005844 Ga0466967_0005844_6898_7566 222
334 3300045976 Ga0466967_0125664 Ga0466967_0125664_247_915 222
335 3300046454 Ga0495592_0000183 Ga0495592_0000183_46526_47194 222
336 3300046454 Ga0495592_0151049 Ga0495592_0151049_442_1110 222
337 3300046454 Ga0495592_0162484 Ga0495592_0162484_355_1023 222
338 3300046459 Ga0495629_0059445 Ga0495629_0059445_1857_2525 222
339 3300046461 Ga0495641_0013441 Ga0495641_0013441_1645_2313 222
340 3300046462 Ga0495651_0000020 Ga0495651_0000020_52035_52703 222
341 3300046462 Ga0495651_0032308 Ga0495651_0032308_250_918 222
342 3300046462 Ga0495651_0033325 Ga0495651_0033325_2171_2839 222
343 3300046462 Ga0495651_0099585 Ga0495651_0099585_811_1479 222
344 3300046462 Ga0495651_0105886 Ga0495651_0105886_856_1524 222
345 3300046463 Ga0495653_0000289 Ga0495653_0000289_10557_11225 222
346 3300046463 Ga0495653_0007471 Ga0495653_0007471_2775_3443 222
347 3300046463 Ga0495653_0059142 Ga0495653_0059142_1856_2524 222
348 3300046463 Ga0495653_0128772 Ga0495653_0128772_644_1312 222
349 3300046472 Ga0495580_0605213 Ga0495580_0605213_45_713 222
350 3300046473 Ga0495582_0050029 Ga0495582_0050029_316_984 222
351 3300046475 Ga0495639_0040539 Ga0495639_0040539_672_1340 222
352 3300046476 Ga0495662_0012422 Ga0495662_0012422_2275_2943 222
353 3300046477 Ga0495664_0023647 Ga0495664_0023647_2235_2903 222
354 3300046477 Ga0495664_0158577 Ga0495664_0158577_323_991 222
355 3300046477 Ga0495664_0403300 Ga0495664_0403300_55_723 222
356 3300046511 Ga0495608_0000015 Ga0495608_0000015_67722_68390 222
357 3300046511 Ga0495608_0014584 Ga0495608_0014584_739_1407 222
358 3300046511 Ga0495608_0046288 Ga0495608_0046288_1515_2183 222
359 3300046514 Ga0495618_0021949 Ga0495618_0021949_1950_2618 222
360 3300046514 Ga0495618_0035943 Ga0495618_0035943_1093_1761 222
361 3300046514 Ga0495618_0147155 Ga0495618_0147155_127_795 222
362 3300046516 Ga0495628_0000055 Ga0495628_0000055_59217_59885 222
363 3300046516 Ga0495628_0040013 Ga0495628_0040013_792_1460 222
364 3300046516 Ga0495628_0375735 Ga0495628_0375735_357_1025 222
365 3300046517 Ga0495630_0003270 Ga0495630_0003270_4660_5328 222
366 3300046529 Ga0495652_0000074 Ga0495652_0000074_31268_31936 222
367 3300046529 Ga0495652_0064465 Ga0495652_0064465_140_808 222
368 3300046529 Ga0495652_0100692 Ga0495652_0100692_1195_1863 222
369 3300046529 Ga0495652_0436508 Ga0495652_0436508_46_714 222
370 3300046531 Ga0495665_0009541 Ga0495665_0009541_1015_1683 222
371 3300046533 Ga0495640_0059189 Ga0495640_0059189_458_1126 222
372 3300046533 Ga0495640_0141437 Ga0495640_0141437_547_1215 222
373 3300046536 Ga0495587_0000085 Ga0495587_0000085_11594_12262 222
374 3300046536 Ga0495587_0062499 Ga0495587_0062499_231_899 222
375 3300046536 Ga0495587_0081208 Ga0495587_0081208_676_1344 222
376 3300046536 Ga0495587_0225123 Ga0495587_0225123_57_725 222
377 3300046543 Ga0495645_0035156 Ga0495645_0035156_152_820 222
378 3300046543 Ga0495645_0083380 Ga0495645_0083380_1294_1962 222
379 3300046559 Ga0495667_0000033 Ga0495667_0000033_75755_76423 222
380 3300046559 Ga0495667_0005551 Ga0495667_0005551_3602_4270 222
381 3300046559 Ga0495667_0006827 Ga0495667_0006827_1915_2583 222
382 3300046559 Ga0495667_0069820 Ga0495667_0069820_880_1548 222
383 3300046559 Ga0495667_0092475 Ga0495667_0092475_70_738 222
384 3300046642 Ga0495634_0023786 Ga0495634_0023786_3065_3733 222
385 3300046642 Ga0495634_0102073 Ga0495634_0102073_618_1286 222
386 3300046642 Ga0495634_0163962 Ga0495634_0163962_647_1315 222
387 3300046642 Ga0495634_0181017 Ga0495634_0181017_494_1162 222
388 3300046663 Ga0495635_0001020 Ga0495635_0001020_10560_11228 222
389 3300046663 Ga0495635_0005268 Ga0495635_0005268_5452_6120 222
390 3300046663 Ga0495635_0104534 Ga0495635_0104534_286_954 222
391 3300046675 Ga0495657_0000097 Ga0495657_0000097_46653_47321 222
392 3300046675 Ga0495657_0007027 Ga0495657_0007027_5505_6173 222
393 3300046675 Ga0495657_0040639 Ga0495657_0040639_1551_2219 222
394 3300046675 Ga0495657_0112606 Ga0495657_0112606_555_1223 222
395 3300046675 Ga0495657_0147023 Ga0495657_0147023_58_726 222
396 3300046678 Ga0495599_0000018 Ga0495599_0000018_68116_68784 222
397 3300046678 Ga0495599_0055195 Ga0495599_0055195_1219_1887 222
398 3300046678 Ga0495599_0145324 Ga0495599_0145324_427_1095 222
399 3300046679 Ga0495623_0000036 Ga0495623_0000036_75806_76474 222
400 3300046679 Ga0495623_0056901 Ga0495623_0056901_1280_1948 222
401 3300046679 Ga0495623_0190014 Ga0495623_0190014_420_1088 222
402 3300046680 Ga0495646_0107196 Ga0495646_0107196_585_1253 222
403 3300046680 Ga0495646_0315317 Ga0495646_0315317_133_801 222
404 3300046690 Ga0495624_0003117 Ga0495624_0003117_3056_3724 222
405 3300046690 Ga0495624_0181888 Ga0495624_0181888_511_1179 222
406 3300046809 Ga0495600_0039549 Ga0495600_0039549_1951_2619 222
407 3300046809 Ga0495600_0049946 Ga0495600_0049946_1001_1669 222
408 3300046809 Ga0495600_0069645 Ga0495600_0069645_597_1265 222
409 3300046809 Ga0495600_0100585 Ga0495600_0100585_436_1104 222
410 3300047315 Ga0495581_0006497 Ga0495581_0006497_2041_2709 222
411 3300047315 Ga0495581_0326684 Ga0495581_0326684_185_853 222
412 3300047317 Ga0495604_0000025 Ga0495604_0000025_75489_76157 222
413 3300047317 Ga0495604_0100949 Ga0495604_0100949_580_1248 222
414 3300047317 Ga0495604_0129088 Ga0495604_0129088_556_1224 222
415 3300047319 Ga0495674_0001674 Ga0495674_0001674_13857_14525 222
416 3300047319 Ga0495674_0127417 Ga0495674_0127417_20_688 222
417 3300047319 Ga0495674_0140246 Ga0495674_0140246_818_1486 222
418 3300047321 Ga0495676_0008328 Ga0495676_0008328_4967_5635 222
419 3300047322 Ga0495680_0000015 Ga0495680_0000015_75596_76264 222
420 3300047322 Ga0495680_0006577 Ga0495680_0006577_9309_9977 222
421 3300047322 Ga0495680_0011182 Ga0495680_0011182_19_687 222
422 3300047322 Ga0495680_0052508 Ga0495680_0052508_545_1213 222
423 3300047322 Ga0495680_0075950 Ga0495680_0075950_670_1338 222
424 3300047322 Ga0495680_0115438 Ga0495680_0115438_488_1156 222
425 3300047444 Ga0495675_0000672 Ga0495675_0000672_2165_2833 222
426 3300047444 Ga0495675_0290299 Ga0495675_0290299_210_878 222
427 3300047471 Ga0495684_0011011 Ga0495684_0011011_2378_3046 222
428 3300047471 Ga0495684_0023450 Ga0495684_0023450_2852_3520 222
429 3300047471 Ga0495684_0025658 Ga0495684_0025658_2016_2684 222
430 3300047471 Ga0495684_0122954 Ga0495684_0122954_608_1276 222
431 3300047471 Ga0495684_0196589 Ga0495684_0196589_321_989 222
432 3300047673 Ga0495593_0041891 Ga0495593_0041891_542_1210 222
433 3300048088 Ga0495602_0000065 Ga0495602_0000065_75581_76249 222
434 3300048088 Ga0495602_0141713 Ga0495602_0141713_560_1228 222
435 3300048903 Ga0496100_0872076 Ga0496100_0872076_22_690 222
436 3300048904 Ga0496101_0595456 Ga0496101_0595456_53_721 222
437 3300048904 Ga0496101_0684704 Ga0496101_0684704_122_790 222
438 3300048905 Ga0496102_0748614 Ga0496102_0748614_139_837 222
439 3300048907 Ga0496104_0445110 Ga0496104_0445110_454_1122 222
440 3300048907 Ga0496104_0695724 Ga0496104_0695724_206_874 222
441 3300048908 Ga0496105_0372443 Ga0496105_0372443_100_768 222
442 3300048911 Ga0496108_0378535 Ga0496108_0378535_387_1055 222
443 3300048912 Ga0496109_0530188 Ga0496109_0530188_127_795 222
444 3300048912 Ga0496109_0663475 Ga0496109_0663475_231_899 222
445 3300048913 Ga0496110_0692628 Ga0496110_0692628_72_740 222
446 3300048914 Ga0496111_0207040 Ga0496111_0207040_45_713 222
447 3300048915 Ga0496112_0964095 Ga0496112_0964095_32_700 222
448 3300048916 Ga0496113_0226106 Ga0496113_0226106_220_888 222
449 3300048917 Ga0496114_0469182 Ga0496114_0469182_121_789 222
450 3300048918 Ga0496115_0063207 Ga0496115_0063207_2034_2702 222
451 3300048929 Ga0496126_0047852 Ga0496126_0047852_2862_3530 222
452 3300048929 Ga0496126_0471972 Ga0496126_0471972_320_988 222
453 3300050512 nmdc:mga0n895_61735_c1 nmdc:mga0n895_61735_c1_13_681 222
454 3300050514 nmdc:mga08x19_540327_c1 nmdc:mga08x19_540327_c1_69_737 222
455 3300053077 Ga0495601_0165081 Ga0495601_0165081_217_885 222
456 3300053084 Ga0495595_0000838 Ga0495595_0000838_2672_3340 222
457 3300053085 Ga0495619_0071878 Ga0495619_0071878_363_1031 222
458 3300005295 Ga0065707_10352835 Ga0065707_103528351 223
459 3300005328 Ga0070676_10529918 Ga0070676_105299181 223
460 3300005341 Ga0070691_10110322 Ga0070691_101103222 223
461 3300005343 Ga0070687_100073080 Ga0070687_1000730804 223
462 3300005439 Ga0070711_100383241 Ga0070711_1003832412 223
463 3300005444 Ga0070694_100505631 Ga0070694_1005056311 223
464 3300005445 Ga0070708_100526568 Ga0070708_1005265682 223
465 3300005458 Ga0070681_10299334 Ga0070681_102993342 223
466 3300005467 Ga0070706_100119634 Ga0070706_1001196342 223
467 3300005468 Ga0070707_100166290 Ga0070707_1001662902 223
468 3300005468 Ga0070707_100271661 Ga0070707_1002716612 223
469 3300005471 Ga0070698_100258134 Ga0070698_1002581342 223
470 3300005548 Ga0070665_100946208 Ga0070665_1009462081 223
471 3300005617 Ga0068859_100787040 Ga0068859_1007870402 223
472 3300005618 Ga0068864_100098619 Ga0068864_1000986192 223
473 3300005842 Ga0068858_100166590 Ga0068858_1001665902 223
474 3300005937 Ga0081455_10007614 Ga0081455_100076143 223
475 3300005981 Ga0081538_10010200 Ga0081538_100102002 223
476 3300005983 Ga0081540_1006443 Ga0081540_100644311 223
477 3300005985 Ga0081539_10021393 Ga0081539_100213935 223
478 3300005985 Ga0081539_10142467 Ga0081539_101424672 223
479 3300006163 Ga0070715_10026962 Ga0070715_100269622 223
480 3300006237 Ga0097621_100161280 Ga0097621_1001612803 223
481 3300006844 Ga0075428_100039263 Ga0075428_1000392636 223
482 3300006844 Ga0075428_100100883 Ga0075428_1001008832 223
483 3300006846 Ga0075430_100005155 Ga0075430_1000051554 223
484 3300006846 Ga0075430_100023570 Ga0075430_1000235702 223
485 3300006846 Ga0075430_100158417 Ga0075430_1001584174 223
486 3300006847 Ga0075431_100050743 Ga0075431_1000507433 223
487 3300006847 Ga0075431_100146661 Ga0075431_1001466613 223
488 3300006847 Ga0075431_100209294 Ga0075431_1002092942 223
489 3300006852 Ga0075433_10179335 Ga0075433_101793352 223
490 3300006871 Ga0075434_100842351 Ga0075434_1008423512 223
491 3300006880 Ga0075429_100048052 Ga0075429_1000480523 223
492 3300006880 Ga0075429_100387439 Ga0075429_1003874392 223
493 3300006931 Ga0097620_100787164 Ga0097620_1007871642 223
494 3300009094 Ga0111539_10015400 Ga0111539_100154009 223
495 3300009098 Ga0105245_10049940 Ga0105245_100499403 223
496 3300009101 Ga0105247_10168889 Ga0105247_101688892 223
497 3300009147 Ga0114129_10057911 Ga0114129_100579113 223
498 3300009147 Ga0114129_10070995 Ga0114129_100709954 223
499 3300009147 Ga0114129_10954083 Ga0114129_109540831 223
500 3300009545 Ga0105237_10684978 Ga0105237_106849782 223
501 3300009551 Ga0105238_10038274 Ga0105238_100382744 223
502 3300013104 Ga0157370_10034424 Ga0157370_100344242 223
503 3300013105 Ga0157369_10357058 Ga0157369_103570582 223
504 3300013296 Ga0157374_10113015 Ga0157374_101130152 223
505 3300013306 Ga0163162_10051775 Ga0163162_100517754 223
506 3300013306 Ga0163162_10070078 Ga0163162_100700783 223
507 3300013306 Ga0163162_10306636 Ga0163162_103066361 223
508 3300013308 Ga0157375_10222742 Ga0157375_102227423 223
509 3300014325 Ga0163163_10016647 Ga0163163_100166475 223
510 3300014968 Ga0157379_10059364 Ga0157379_100593644 223
511 3300014968 Ga0157379_10083252 Ga0157379_100832523 223
512 3300014969 Ga0157376_10076382 Ga0157376_100763822 223
513 3300021388 Ga0213875_10097003 Ga0213875_100970032 223
514 3300025905 Ga0207685_10311852 Ga0207685_103118521 223
515 3300025910 Ga0207684_10091706 Ga0207684_100917065 223
516 3300025915 Ga0207693_10057674 Ga0207693_100576744 223
517 3300025917 Ga0207660_10458591 Ga0207660_104585912 223
518 3300025918 Ga0207662_10136641 Ga0207662_101366411 223
519 3300025922 Ga0207646_10089448 Ga0207646_100894482 223
520 3300025922 Ga0207646_10102650 Ga0207646_101026502 223
521 3300025939 Ga0207665_10069021 Ga0207665_100690212 223
522 3300025941 Ga0207711_10068743 Ga0207711_100687433 223
523 3300025961 Ga0207712_10140674 Ga0207712_101406743 223
524 3300025981 Ga0207640_10354140 Ga0207640_103541402 223
525 3300026088 Ga0207641_10245596 Ga0207641_102455962 223
526 3300026095 Ga0207676_10070288 Ga0207676_100702883 223
527 3300026116 Ga0207674_10124424 Ga0207674_101244244 223
528 3300027907 Ga0207428_10034409 Ga0207428_100344093 223
529 3300027907 Ga0207428_10300508 Ga0207428_103005081 223
530 3300028381 Ga0268264_10060648 Ga0268264_100606482 223
531 3300031903 Ga0307407_10433358 Ga0307407_104333581 223
532 3300032002 Ga0307416_100061502 Ga0307416_1000615023 223
533 3300032005 Ga0307411_10861925 Ga0307411_108619251 223
534 3300034816 Ga0373930_0046579 Ga0373930_0046579_136_822 223
535 3300035086 Ga0373934_0033700 Ga0373934_0033700_994_1665 223
536 3300035089 Ga0373944_0005054 Ga0373944_0005054_1548_2219 223
537 3300035117 Ga0373953_0031879 Ga0373953_0031879_588_1259 223
538 3300035119 Ga0373956_0014132 Ga0373956_0014132_2337_3008 223
539 3300035172 Ga0373955_0247420 Ga0373955_0247420_81_752 223
540 3300035692 Ga0373935_0295564 Ga0373935_0295564_397_1068 223
541 3300036401 Ga0373937_0502039 Ga0373937_0502039_186_857 223
542 3300037068 Ga0373925_0762832 Ga0373925_0762832_28_699 223
543 3300037418 Ga0395900_0596293 Ga0395900_0596293_291_962 223
544 3300037466 Ga0395898_0331429 Ga0395898_0331429_562_1272 223
545 3300037471 Ga0395905_0198737 Ga0395905_0198737_880_1590 223
546 3300037853 Ga0436364_0931640 Ga0436364_0931640_4033_4704 223
547 3300038443 Ga0395901_0038423 Ga0395901_0038423_2984_3694 223
548 3300042005 Ga0439448_0033007 Ga0439448_0033007_927_1598 223
549 3300042461 Ga0439460_0061036 Ga0439460_0061036_104_775 223
550 3300042993 Ga0439440_0051429 Ga0439440_0051429_90_764 223
551 3300044656 Ga0466969_0274987 Ga0466969_0274987_57_731 223
552 3300044719 Ga0466971_0029818 Ga0466971_0029818_952_1641 223
553 3300044735 Ga0466968_0114067 Ga0466968_0114067_83_772 223
554 3300046459 Ga0495629_0210909 Ga0495629_0210909_657_1328 223
555 3300046463 Ga0495653_0042478 Ga0495653_0042478_54_725 223
556 3300046472 Ga0495580_0155547 Ga0495580_0155547_146_817 223
557 3300046473 Ga0495582_0033971 Ga0495582_0033971_1761_2432 223
558 3300046475 Ga0495639_0281658 Ga0495639_0281658_103_774 223
559 3300046476 Ga0495662_0169911 Ga0495662_0169911_161_832 223
560 3300046477 Ga0495664_0274092 Ga0495664_0274092_190_861 223
561 3300046499 Ga0495594_0165712 Ga0495594_0165712_356_1027 223
562 3300046514 Ga0495618_0014530 Ga0495618_0014530_428_1099 223
563 3300046516 Ga0495628_0123679 Ga0495628_0123679_939_1610 223
564 3300046526 Ga0495666_0017641 Ga0495666_0017641_1192_1863 223
565 3300046529 Ga0495652_0028707 Ga0495652_0028707_225_896 223
566 3300046533 Ga0495640_0061467 Ga0495640_0061467_1749_2420 223
567 3300046535 Ga0495586_0108232 Ga0495586_0108232_782_1453 223
568 3300046536 Ga0495587_0024712 Ga0495587_0024712_1902_2573 223
569 3300046543 Ga0495645_0235470 Ga0495645_0235470_275_961 223
570 3300046543 Ga0495645_0236634 Ga0495645_0236634_190_861 223
571 3300046559 Ga0495667_0081279 Ga0495667_0081279_589_1260 223
572 3300046642 Ga0495634_0026887 Ga0495634_0026887_1595_2266 223
573 3300046663 Ga0495635_0012670 Ga0495635_0012670_1269_1940 223
574 3300046675 Ga0495657_0046134 Ga0495657_0046134_457_1128 223
575 3300046680 Ga0495646_0045035 Ga0495646_0045035_141_812 223
576 3300046681 Ga0495647_0303859 Ga0495647_0303859_13_684 223
577 3300046683 Ga0495658_0290269 Ga0495658_0290269_347_1018 223
578 3300047317 Ga0495604_0042463 Ga0495604_0042463_995_1666 223
579 3300047319 Ga0495674_0130166 Ga0495674_0130166_225_896 223
580 3300047322 Ga0495680_0102874 Ga0495680_0102874_549_1220 223
581 3300047444 Ga0495675_0019498 Ga0495675_0019498_1031_1702 223
582 3300048905 Ga0496102_0104498 Ga0496102_0104498_1134_1826 223
583 3300048905 Ga0496102_0402250 Ga0496102_0402250_410_1093 223
584 3300048907 Ga0496104_0029706 Ga0496104_0029706_2580_3263 223
585 3300048908 Ga0496105_0036243 Ga0496105_0036243_1216_1899 223
586 3300048913 Ga0496110_0269452 Ga0496110_0269452_411_1094 223
587 3300048916 Ga0496113_0566236 Ga0496113_0566236_151_834 223
588 3300048924 Ga0496121_0011538 Ga0496121_0011538_1532_2224 223
589 3300049570 Ga0501033_0160848 Ga0501033_0160848_57_728 223
590 3300049574 Ga0501038_0260862 Ga0501038_0260862_110_781 223
591 3300049577 Ga0501041_0054564 Ga0501041_0054564_318_989 223
592 3300049577 Ga0501041_0340862 Ga0501041_0340862_91_762 223
593 3300049578 Ga0501042_0132373 Ga0501042_0132373_158_829 223
594 3300049741 Ga0501079_0546756 Ga0501079_0546756_181_852 223
595 3300049824 Ga0501045_0714765 Ga0501045_0714765_21_692 223
596 3300050507 nmdc:mga05p37_22111_c1 nmdc:mga05p37_22111_c1_1148_1819 223
597 3300050507 nmdc:mga05p37_238108_c1 nmdc:mga05p37_238108_c1_1121_1792 223
598 3300050507 nmdc:mga05p37_57246_c1 nmdc:mga05p37_57246_c1_1300_1992 223
599 3300050508 nmdc:mga09592_13996_c1 nmdc:mga09592_13996_c1_1499_2170 223
600 3300050508 nmdc:mga09592_354894_c1 nmdc:mga09592_354894_c1_251_943 223
601 3300050508 nmdc:mga09592_38531_c1 nmdc:mga09592_38531_c1_492_1184 223
602 3300050508 nmdc:mga09592_803233_c1 nmdc:mga09592_803233_c1_55_726 223
603 3300050509 nmdc:mga0qj67_1425_c1 nmdc:mga0qj67_1425_c1_11746_12438 223
604 3300050509 nmdc:mga0qj67_150343_c1 nmdc:mga0qj67_150343_c1_1178_1849 223
605 3300050509 nmdc:mga0qj67_21951_c1 nmdc:mga0qj67_21951_c1_3559_4251 223
606 3300050509 nmdc:mga0qj67_557137_c1 nmdc:mga0qj67_557137_c1_10_681 223
607 3300050510 nmdc:mga06r32_10754_c1 nmdc:mga06r32_10754_c1_3762_4454 223
608 3300050510 nmdc:mga06r32_67971_c1 nmdc:mga06r32_67971_c1_2149_2820 223
609 3300050510 nmdc:mga06r32_69419_c1 nmdc:mga06r32_69419_c1_1984_2655 223
610 3300050511 nmdc:mga08y16_24791_c1 nmdc:mga08y16_24791_c1_2846_3517 223
611 3300050511 nmdc:mga08y16_248175_c1 nmdc:mga08y16_248175_c1_930_1601 223
612 3300050512 nmdc:mga0n895_149348_c1 nmdc:mga0n895_149348_c1_1129_1800 223
613 3300050512 nmdc:mga0n895_61903_c1 nmdc:mga0n895_61903_c1_323_994 223
614 3300050513 nmdc:mga0rr50_83850_c1 nmdc:mga0rr50_83850_c1_1203_1886 223
615 3300053078 Ga0495612_0255209 Ga0495612_0255209_26_697 223
616 3300053085 Ga0495619_0005205 Ga0495619_0005205_3765_4436 223
617 3300054114 Ga0501084_0353320 Ga0501084_0353320_472_1143 223
618 3300061734 Ga0530510_0161353 Ga0530510_0161353_602_1273 223
619 iso_pu_bacteria 2799112218 2799183522 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03070

TENA_THI-4

TENA/THI-4/PQQC family

15

222

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qcx-assembly1.cif.gz_B crystal structure of bacillus subtilis tena y112f mutant complexed with formyl aminomethyl pyrimidine 0.9665 4 221
1to9-assembly1.cif.gz_A crystal structure of thi-4 protein from bacillus subtilis 0.9599 6 221
2rd3-assembly1.cif.gz_A crystal structure of tena homologue (hp1287) from helicobacter pylori 0.9591 3 217
1rtw-assembly1.cif.gz_D x-ray structure of pf1337, a tena homologue from pyrococcus furiosus. northeast structural genomics research consortium (nesg) target pfr34 0.9557 6 215
3ibx-assembly1.cif.gz_A-2 crystal structure of f47y variant of tena (hp1287) from helicobacter pylori 0.9537 3 217
ID Description Score Start End Superfamily
1to9A00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9585 6 221 1.20.910.10
1rtwA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9525 7 215 1.20.910.10
3ibxD00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9521 3 217 1.20.910.10
1uddA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9517 4 217 1.20.910.10
2gm8D00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9512 4 218 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A3D4B735-F1-model_v4 Aminopyrimidine aminohydrolase (EC 3.5.99.2) 0.989 12 223 GO:0005829
GO:0009228
GO:0009229
GO:0050334
AF-A0A2W6DCR4-F1-model_v4 Aminopyrimidine aminohydrolase (EC 3.5.99.2) 0.989 4 213 GO:0005829
GO:0009228
GO:0009229
GO:0050334
AF-A0A2G1X8L3-F1-model_v4 Thiaminase II 0.9882 6 131 GO:0005829
GO:0006790
GO:0044281
GO:0072527
GO:1901615
AF-A0A6L7MEM3-F1-model_v4 Aminopyrimidine aminohydrolase (EC 3.5.99.2) 0.9858 2 223 GO:0005829
GO:0009228
GO:0009229
GO:0050334
AF-A0A357B601-F1-model_v4 Aminopyrimidine aminohydrolase (EC 3.5.99.2) 0.9854 1 223 GO:0005829
GO:0009228
GO:0009229
GO:0050334

Feature Viewer

pLDDT pTM Quality
94.66 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map