F469793

General Info

Members Datasets Scaffolds Average Seq Length
619 230 619 157

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10138632|Ga0065715_101386323
Length 183
Sequence MIADCRLRFQIGNRQLEIGNKETVMPMRIGTPMPGLDGATEWFNGTQAYAEAEAAGHPTLIHFWSVSCSICKDNLPRVAQWRDEMKDLGLRVIAVHMPRYEADTDVEKVRDQISQHKLTEPVAVDNEHKLRDAFQNDQGYVPAYYLFDAEGKLKSFAAGERGLDMLKSAIERLLASEESAVAS

Samples

Sample ID Description Type Environment
1 2124908026 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
196 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
201 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
202 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
203 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
206 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
207 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
208 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
209 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
210 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
211 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
212 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
215 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
219 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
220 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.78
Rhizosphere 98.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1a_Contig_3010 2124908026 Bacteria 699
2 JGI24751J29686_10002236 3300002459 Bacteria 3921
3 JGI25406J46586_10013237 3300003203 Bacteria 3552
4 Ga0058862_12851999 3300004803 Bacteria 909
5 Ga0065714_10002186 3300005288 Bacteria 191932
6 Ga0065704_10090256 3300005289 Bacteria 2801
7 Ga0065704_10228633 3300005289 Bacteria 1050
8 Ga0065712_10000113 3300005290 Bacteria 191931
9 Ga0065712_10002087 3300005290 Bacteria 7323
10 Ga0065712_10025335 3300005290 Bacteria 1211
11 Ga0065715_10106753 3300005293 Bacteria 2811
12 Ga0065715_10138632 3300005293 Bacteria 1888
13 Ga0065715_10182925 3300005293 Unclassified 1453
14 Ga0065707_10005341 3300005295 Bacteria 5420
15 Ga0065707_10128745 3300005295 Bacteria 1960
16 Ga0065707_10168407 3300005295 Bacteria 1499
17 Ga0070676_10032499 3300005328 Bacteria 2990
18 Ga0070676_10050130 3300005328 Bacteria 2447
19 Ga0070690_100043353 3300005330 Bacteria 2853
20 Ga0070690_100738572 3300005330 Unclassified 759
21 Ga0070690_101270976 3300005330 Unclassified 589
22 Ga0070670_100000364 3300005331 Bacteria 37748
23 Ga0070670_100000564 3300005331 Bacteria 29365
24 Ga0070670_100075567 3300005331 Bacteria 2894
25 Ga0070670_100112936 3300005331 Bacteria 2342
26 Ga0070670_100128241 3300005331 Bacteria 2190
27 Ga0070670_100536932 3300005331 Unclassified 1042
28 Ga0070670_100560843 3300005331 Unclassified 1019
29 Ga0070670_101296809 3300005331 Unclassified 667
30 Ga0068869_100030527 3300005334 Bacteria 3784
31 Ga0068869_100097078 3300005334 Bacteria 2225
32 Ga0068869_100377832 3300005334 Bacteria 1161
33 Ga0068869_100557524 3300005334 Bacteria 963
34 Ga0068869_100910253 3300005334 Bacteria 762
35 Ga0070680_100001614 3300005336 Bacteria 16489
36 Ga0070680_100054384 3300005336 Bacteria 3269
37 Ga0070682_100017149 3300005337 Unclassified 4220
38 Ga0070682_100058283 3300005337 Bacteria 2435
39 Ga0068868_100043768 3300005338 Bacteria 3498
40 Ga0070660_100109155 3300005339 Bacteria 2200
41 Ga0070689_100000225 3300005340 Bacteria 33836
42 Ga0070689_100180077 3300005340 Unclassified 1716
43 Ga0070689_100506897 3300005340 Bacteria 1034
44 Ga0070689_101325990 3300005340 Unclassified 649
45 Ga0070687_100038148 3300005343 Bacteria 2407
46 Ga0070687_100163113 3300005343 Bacteria 1319
47 Ga0070687_100623627 3300005343 Bacteria 744
48 Ga0070661_100167949 3300005344 Bacteria 1665
49 Ga0070661_100329677 3300005344 Bacteria 1194
50 Ga0070692_10166960 3300005345 Bacteria 1266
51 Ga0070692_10352077 3300005345 Unclassified 915
52 Ga0070692_10420899 3300005345 Unclassified 848
53 Ga0070692_10484879 3300005345 Bacteria 798
54 Ga0070668_101001872 3300005347 Unclassified 751
55 Ga0070669_100004225 3300005353 Bacteria 10388
56 Ga0070669_100004750 3300005353 Bacteria 9795
57 Ga0070669_100031660 3300005353 Bacteria 3821
58 Ga0070669_100073012 3300005353 Bacteria 2541
59 Ga0070669_101342759 3300005353 Unclassified 620
60 Ga0070675_100093358 3300005354 Unclassified 2523
61 Ga0070675_100151597 3300005354 Bacteria 1988
62 Ga0070671_100077576 3300005355 Bacteria 2776
63 Ga0070671_100178058 3300005355 Bacteria 1800
64 Ga0070674_100099163 3300005356 Bacteria 2119
65 Ga0070674_100153827 3300005356 Bacteria 1738
66 Ga0070673_100016583 3300005364 Bacteria 5213
67 Ga0070673_100210065 3300005364 Bacteria 1680
68 Ga0070673_100361391 3300005364 Unclassified 1291
69 Ga0070673_100823937 3300005364 Unclassified 858
70 Ga0070673_101419400 3300005364 Bacteria 654
71 Ga0070688_100012293 3300005365 Unclassified 4792
72 Ga0070659_100014691 3300005366 Bacteria 5855
73 Ga0070659_100734958 3300005366 Bacteria 855
74 Ga0070659_101210996 3300005366 Unclassified 668
75 Ga0070667_100023034 3300005367 Bacteria 5165
76 Ga0070667_100112456 3300005367 Unclassified 2362
77 Ga0070709_10078453 3300005434 Bacteria 2149
78 Ga0070701_10034767 3300005438 Bacteria 2526
79 Ga0070701_10195579 3300005438 Bacteria 1192
80 Ga0070705_100980566 3300005440 Bacteria 685
81 Ga0070700_100000295 3300005441 Bacteria 26208
82 Ga0070700_100005450 3300005441 Bacteria 6746
83 Ga0070700_100176157 3300005441 Bacteria 1484
84 Ga0070694_100014572 3300005444 Bacteria 4922
85 Ga0070694_100048669 3300005444 Bacteria 2852
86 Ga0070694_100072654 3300005444 Bacteria 2374
87 Ga0070694_100194026 3300005444 Bacteria 1510
88 Ga0070694_100289638 3300005444 Bacteria 1251
89 Ga0070694_100558741 3300005444 Bacteria 917
90 Ga0070708_100000851 3300005445 Bacteria 22967
91 Ga0070678_100406718 3300005456 Bacteria 1184
92 Ga0070662_100419248 3300005457 Unclassified 1107
93 Ga0070662_100529344 3300005457 Bacteria 986
94 Ga0070662_100599761 3300005457 Unclassified 926
95 Ga0070681_10001343 3300005458 Bacteria 21466
96 Ga0070681_10016984 3300005458 Bacteria 7272
97 Ga0070681_10098038 3300005458 Unclassified 2877
98 Ga0070681_10121089 3300005458 Bacteria 2552
99 Ga0070681_10475710 3300005458 Unclassified 1162
100 Ga0068867_100016077 3300005459 Bacteria 5312
101 Ga0068867_100127691 3300005459 Bacteria 1972
102 Ga0068867_100140381 3300005459 Bacteria 1888
103 Ga0068867_100492023 3300005459 Unclassified 1053
104 Ga0070685_10080591 3300005466 Bacteria 1951
105 Ga0070706_100000019 3300005467 Bacteria 166483
106 Ga0070706_100036266 3300005467 Bacteria 4554
107 Ga0070706_100284878 3300005467 Bacteria 1542
108 Ga0070706_101672054 3300005467 Unclassified 580
109 Ga0070707_100025127 3300005468 Bacteria 5650
110 Ga0070707_100119692 3300005468 Bacteria 2556
111 Ga0070698_100003467 3300005471 Bacteria 17358
112 Ga0070699_100003797 3300005518 Bacteria 13349
113 Ga0070699_100005259 3300005518 Bacteria 11363
114 Ga0070679_100001377 3300005530 Bacteria 21466
115 Ga0070679_100005438 3300005530 Bacteria 11807
116 Ga0070679_100407134 3300005530 Bacteria 1306
117 Ga0070684_100367658 3300005535 Bacteria 1324
118 Ga0070697_100009334 3300005536 Bacteria 7670
119 Ga0070697_100029801 3300005536 Bacteria 4379
120 Ga0070697_100046015 3300005536 Unclassified 3537
121 Ga0068853_100028512 3300005539 Bacteria 4697
122 Ga0068853_100173640 3300005539 Bacteria 1951
123 Ga0070672_100057941 3300005543 Bacteria 3043
124 Ga0070672_100139425 3300005543 Unclassified 1999
125 Ga0070672_100335498 3300005543 Bacteria 1287
126 Ga0070686_100019783 3300005544 Bacteria 3973
127 Ga0070686_100695128 3300005544 Unclassified 811
128 Ga0070695_100137709 3300005545 Bacteria 1689
129 Ga0070695_100270430 3300005545 Unclassified 1245
130 Ga0070695_100632692 3300005545 Unclassified 843
131 Ga0070695_100921934 3300005545 Bacteria 707
132 Ga0070696_100103479 3300005546 Unclassified 2043
133 Ga0070696_100284526 3300005546 Unclassified 1262
134 Ga0070696_100378628 3300005546 Bacteria 1102
135 Ga0070696_100396330 3300005546 Unclassified 1079
136 Ga0070696_100864071 3300005546 Unclassified 748
137 Ga0070696_101333634 3300005546 Unclassified 610
138 Ga0070693_100045637 3300005547 Bacteria 2485
139 Ga0070693_101397373 3300005547 Unclassified 544
140 Ga0070665_100223358 3300005548 Bacteria 1884
141 Ga0070704_100070796 3300005549 Bacteria 2532
142 Ga0070704_100204525 3300005549 Bacteria 1596
143 Ga0070704_100900510 3300005549 Unclassified 796
144 Ga0070664_100024778 3300005564 Bacteria 4967
145 Ga0070664_100123308 3300005564 Bacteria 2271
146 Ga0070664_100233251 3300005564 Bacteria 1650
147 Ga0070664_100305401 3300005564 Bacteria 1439
148 Ga0070664_100373281 3300005564 Bacteria 1301
149 Ga0070664_100406338 3300005564 Bacteria 1246
150 Ga0070664_101093722 3300005564 Bacteria 751
151 Ga0068857_100005327 3300005577 Bacteria 10956
152 Ga0068857_100173867 3300005577 Bacteria 1958
153 Ga0068857_100178634 3300005577 Bacteria 1931
154 Ga0068857_100255417 3300005577 Bacteria 1607
155 Ga0068857_100281598 3300005577 Bacteria 1530
156 Ga0068857_100304980 3300005577 Unclassified 1468
157 Ga0068857_100978161 3300005577 Bacteria 814
158 Ga0068857_101756748 3300005577 Bacteria 607
159 Ga0068854_100235375 3300005578 Bacteria 1456
160 Ga0068854_100469271 3300005578 Bacteria 1055
161 Ga0070702_100253727 3300005615 Bacteria 1194
162 Ga0070702_100651490 3300005615 Unclassified 796
163 Ga0068852_100078666 3300005616 Bacteria 2918
164 Ga0068859_100002151 3300005617 Bacteria 20025
165 Ga0068859_100029807 3300005617 Bacteria 5475
166 Ga0068859_100032766 3300005617 Bacteria 5219
167 Ga0068859_100215721 3300005617 Bacteria 2006
168 Ga0068859_100322591 3300005617 Bacteria 1638
169 Ga0068859_100345444 3300005617 Unclassified 1582
170 Ga0068859_100420998 3300005617 Bacteria 1432
171 Ga0068859_100499400 3300005617 Unclassified 1312
172 Ga0068859_100536439 3300005617 Unclassified 1265
173 Ga0068859_100578769 3300005617 Bacteria 1216
174 Ga0068859_100987305 3300005617 Bacteria 924
175 Ga0068864_100010455 3300005618 Bacteria 7669
176 Ga0068864_100010719 3300005618 Bacteria 7575
177 Ga0068864_100081403 3300005618 Bacteria 2838
178 Ga0068864_100087096 3300005618 Bacteria 2749
179 Ga0068864_100149363 3300005618 Bacteria 2115
180 Ga0068864_100268635 3300005618 Bacteria 1589
181 Ga0068864_100402697 3300005618 Bacteria 1301
182 Ga0068864_100423722 3300005618 Unclassified 1268
183 Ga0068864_100444900 3300005618 Unclassified 1238
184 Ga0068864_101106796 3300005618 Bacteria 788
185 Ga0068866_10010792 3300005718 Bacteria 3928
186 Ga0068866_10531282 3300005718 Unclassified 783
187 Ga0068861_100017277 3300005719 Bacteria 5118
188 Ga0068861_100031020 3300005719 Bacteria 3922
189 Ga0068861_100269066 3300005719 Unclassified 1462
190 Ga0068870_10010359 3300005840 Bacteria 4282
191 Ga0068870_10058717 3300005840 Bacteria 2060
192 Ga0068870_10315691 3300005840 Bacteria 991
193 Ga0068870_10528367 3300005840 Bacteria 791
194 Ga0068863_100011577 3300005841 Bacteria 8534
195 Ga0068863_100026417 3300005841 Bacteria 5539
196 Ga0068863_100088562 3300005841 Bacteria 2934
197 Ga0068863_100172043 3300005841 Bacteria 2078
198 Ga0068863_100290638 3300005841 Bacteria 1584
199 Ga0068863_100305591 3300005841 Unclassified 1543
200 Ga0068863_100364833 3300005841 Unclassified 1408
201 Ga0068863_100625128 3300005841 Unclassified 1067
202 Ga0068863_100803098 3300005841 Bacteria 938
203 Ga0068858_100366887 3300005842 Bacteria 1380
204 Ga0068858_100385131 3300005842 Bacteria 1346
205 Ga0068858_100484813 3300005842 Unclassified 1193
206 Ga0068860_100032354 3300005843 Bacteria 5025
207 Ga0068860_100052706 3300005843 Bacteria 3869
208 Ga0068860_100372806 3300005843 Unclassified 1408
209 Ga0068860_101212529 3300005843 Unclassified 775
210 Ga0068860_101935624 3300005843 Bacteria 611
211 Ga0068862_100006000 3300005844 Bacteria 10115
212 Ga0068862_100029319 3300005844 Bacteria 4636
213 Ga0068862_100038808 3300005844 Bacteria 4041
214 Ga0068862_100051778 3300005844 Bacteria 3512
215 Ga0068862_100147690 3300005844 Unclassified 2090
216 Ga0081539_10001547 3300005985 Bacteria 38393
217 Ga0081539_10099160 3300005985 Bacteria 1488
218 Ga0097621_100003606 3300006237 Bacteria 10698
219 Ga0097621_100014184 3300006237 Bacteria 5960
220 Ga0097621_100073829 3300006237 Bacteria 2824
221 Ga0068871_100005384 3300006358 Bacteria 8967
222 Ga0068871_100061825 3300006358 Bacteria 3059
223 Ga0068871_100151570 3300006358 Unclassified 1977
224 Ga0075428_100306308 3300006844 Unclassified 1708
225 Ga0075430_100105924 3300006846 Bacteria 2346
226 Ga0075431_100291554 3300006847 Unclassified 1650
227 Ga0075431_100333110 3300006847 Bacteria 1528
228 Ga0075433_10027256 3300006852 Unclassified 4843
229 Ga0075433_10035919 3300006852 Bacteria 4265
230 Ga0075433_10135630 3300006852 Bacteria 2188
231 Ga0075433_10177093 3300006852 Bacteria 1898
232 Ga0075433_10210594 3300006852 Unclassified 1727
233 Ga0075433_10519326 3300006852 Bacteria 1048
234 Ga0075433_10610336 3300006852 Unclassified 957
235 Ga0075434_100133315 3300006871 Bacteria 2504
236 Ga0075434_100236574 3300006871 Unclassified 1846
237 Ga0075434_100249456 3300006871 Bacteria 1794
238 Ga0075434_100474282 3300006871 Unclassified 1272
239 Ga0075429_100059209 3300006880 Bacteria 3336
240 Ga0075429_100083675 3300006880 Unclassified 2781
241 Ga0075429_100429593 3300006880 Unclassified 1157
242 Ga0075429_101015577 3300006880 Unclassified 725
243 Ga0068865_100010220 3300006881 Bacteria 5835
244 Ga0075436_100003502 3300006914 Bacteria 10759
245 Ga0075436_101100413 3300006914 Unclassified 598
246 Ga0097620_100002151 3300006931 Bacteria 20025
247 Ga0097620_100029806 3300006931 Bacteria 5475
248 Ga0097620_100032766 3300006931 Bacteria 5219
249 Ga0097620_100215707 3300006931 Bacteria 2006
250 Ga0097620_100322584 3300006931 Bacteria 1638
251 Ga0097620_100345450 3300006931 Unclassified 1582
252 Ga0097620_100420976 3300006931 Bacteria 1432
253 Ga0097620_100499406 3300006931 Unclassified 1312
254 Ga0097620_100536449 3300006931 Unclassified 1265
255 Ga0097620_100578763 3300006931 Bacteria 1216
256 Ga0097620_100987256 3300006931 Bacteria 924
257 Ga0075435_100128737 3300007076 Bacteria 2117
258 Ga0075435_100244166 3300007076 Unclassified 1528
259 Ga0105251_10109541 3300009011 Bacteria 1259
260 Ga0105251_10124086 3300009011 Bacteria 1172
261 Ga0111539_10141191 3300009094 Bacteria 2819
262 Ga0111539_10679041 3300009094 Unclassified 1199
263 Ga0111539_10741642 3300009094 Bacteria 1143
264 Ga0105245_10248383 3300009098 Bacteria 1727
265 Ga0105245_10701495 3300009098 Bacteria 1045
266 Ga0105245_10998951 3300009098 Bacteria 881
267 Ga0105245_12156426 3300009098 Bacteria 611
268 Ga0105247_10003928 3300009101 Bacteria 9578
269 Ga0105247_10144430 3300009101 Bacteria 1562
270 Ga0105247_10809122 3300009101 Bacteria 716
271 Ga0114129_10024517 3300009147 Bacteria 8546
272 Ga0114129_10047870 3300009147 Bacteria 6006
273 Ga0114129_10082801 3300009147 Bacteria 4458
274 Ga0114129_10152054 3300009147 Unclassified 3167
275 Ga0114129_10474194 3300009147 Bacteria 1638
276 Ga0114129_10482074 3300009147 Bacteria 1622
277 Ga0114129_10609926 3300009147 Unclassified 1413
278 Ga0114129_10957890 3300009147 Unclassified 1080
279 Ga0114129_12544476 3300009147 Unclassified 611
280 Ga0105243_10005889 3300009148 Bacteria 9493
281 Ga0105243_10069183 3300009148 Unclassified 2847
282 Ga0105243_10242109 3300009148 Bacteria 1606
283 Ga0105243_10568885 3300009148 Unclassified 1086
284 Ga0105241_10052311 3300009174 Bacteria 3117
285 Ga0105241_10227861 3300009174 Bacteria 1570
286 Ga0105241_10353005 3300009174 Bacteria 1277
287 Ga0105241_10360157 3300009174 Bacteria 1265
288 Ga0105241_10557109 3300009174 Unclassified 1030
289 Ga0105241_11546767 3300009174 Bacteria 640
290 Ga0105242_10015278 3300009176 Bacteria 5962
291 Ga0105242_10128319 3300009176 Bacteria 2185
292 Ga0105242_10221164 3300009176 Bacteria 1692
293 Ga0105242_10873093 3300009176 Unclassified 897
294 Ga0105242_10993510 3300009176 Unclassified 846
295 Ga0105248_10007032 3300009177 Bacteria 12328
296 Ga0105248_10014725 3300009177 Bacteria 8610
297 Ga0105248_10154679 3300009177 Bacteria 2588
298 Ga0105248_10498531 3300009177 Unclassified 1373
299 Ga0105248_10631484 3300009177 Bacteria 1208
300 Ga0105248_11684491 3300009177 Unclassified 719
301 Ga0105248_12147909 3300009177 Unclassified 635
302 Ga0105238_10011801 3300009551 Bacteria 8805
303 Ga0105249_10078970 3300009553 Bacteria 3054
304 Ga0105249_10279919 3300009553 Bacteria 1665
305 Ga0105249_10508924 3300009553 Bacteria 1250
306 Ga0105249_10733701 3300009553 Unclassified 1049
307 Ga0105239_10300965 3300010375 Bacteria 1806
308 Ga0105239_10576318 3300010375 Bacteria 1283
309 Ga0105239_12743848 3300010375 Unclassified 575
310 Ga0105246_10024495 3300011119 Bacteria 3922
311 Ga0105246_10028532 3300011119 Bacteria 3667
312 Ga0105246_10059353 3300011119 Bacteria 2653
313 Ga0105246_11887991 3300011119 Bacteria 573
314 Ga0157373_10022091 3300013100 Bacteria 4617
315 Ga0157373_10095880 3300013100 Bacteria 2088
316 Ga0157373_10147016 3300013100 Unclassified 1658
317 Ga0157373_10158365 3300013100 Unclassified 1593
318 Ga0157374_10005588 3300013296 Bacteria 10587
319 Ga0157374_10098699 3300013296 Bacteria 2797
320 Ga0157374_10425585 3300013296 Bacteria 1327
321 Ga0157378_10005669 3300013297 Bacteria 10924
322 Ga0157378_10023917 3300013297 Bacteria 5373
323 Ga0157378_10064667 3300013297 Unclassified 3273
324 Ga0157378_10153598 3300013297 Bacteria 2146
325 Ga0157378_10193836 3300013297 Bacteria 1918
326 Ga0157378_10409948 3300013297 Unclassified 1337
327 Ga0157378_10494911 3300013297 Bacteria 1220
328 Ga0157378_11470935 3300013297 Bacteria 725
329 Ga0157378_12251402 3300013297 Unclassified 596
330 Ga0163162_10004149 3300013306 Bacteria 13911
331 Ga0163162_10044402 3300013306 Bacteria 4451
332 Ga0163162_10301519 3300013306 Bacteria 1734
333 Ga0163162_10307429 3300013306 Bacteria 1718
334 Ga0163162_10557618 3300013306 Unclassified 1274
335 Ga0157372_10277294 3300013307 Bacteria 1949
336 Ga0157372_11164136 3300013307 Bacteria 891
337 Ga0157375_10005343 3300013308 Bacteria 11160
338 Ga0157375_10022236 3300013308 Bacteria 5835
339 Ga0157375_10025748 3300013308 Bacteria 5473
340 Ga0157375_10055951 3300013308 Bacteria 3892
341 Ga0157375_10149100 3300013308 Unclassified 2473
342 Ga0157375_10176870 3300013308 Bacteria 2284
343 Ga0157375_10232515 3300013308 Bacteria 2002
344 Ga0157375_10393394 3300013308 Bacteria 1553
345 Ga0157375_11584959 3300013308 Bacteria 774
346 Ga0163163_10002626 3300014325 Bacteria 15212
347 Ga0163163_10004963 3300014325 Bacteria 11453
348 Ga0163163_10005344 3300014325 Bacteria 11091
349 Ga0163163_10011752 3300014325 Bacteria 7955
350 Ga0163163_10093304 3300014325 Bacteria 3026
351 Ga0163163_10129244 3300014325 Bacteria 2566
352 Ga0163163_10178591 3300014325 Unclassified 2170
353 Ga0163163_10219325 3300014325 Bacteria 1950
354 Ga0157380_10006069 3300014326 Bacteria 8469
355 Ga0157380_10007967 3300014326 Bacteria 7546
356 Ga0157380_10013466 3300014326 Bacteria 5963
357 Ga0157380_10143567 3300014326 Bacteria 2054
358 Ga0157380_10195348 3300014326 Unclassified 1790
359 Ga0157377_10041274 3300014745 Bacteria 2559
360 Ga0157377_10120682 3300014745 Unclassified 1588
361 Ga0157377_10501399 3300014745 Bacteria 848
362 Ga0157379_10220231 3300014968 Bacteria 1719
363 Ga0157379_11028514 3300014968 Bacteria 786
364 Ga0157379_11099405 3300014968 Bacteria 761
365 Ga0157376_10014116 3300014969 Bacteria 5982
366 Ga0157376_10029542 3300014969 Bacteria 4367
367 Ga0157376_10094773 3300014969 Bacteria 2594
368 Ga0157376_11267212 3300014969 Bacteria 767
369 Ga0163161_10141652 3300017792 Bacteria 1821
370 Ga0207682_10043244 3300025893 Bacteria 1843
371 Ga0207642_10491016 3300025899 Unclassified 750
372 Ga0207710_10018809 3300025900 Bacteria 2941
373 Ga0207688_10092374 3300025901 Bacteria 1739
374 Ga0207688_11097830 3300025901 Unclassified 502
375 Ga0207647_10449507 3300025904 Unclassified 722
376 Ga0207645_10043706 3300025907 Bacteria 2867
377 Ga0207645_10061876 3300025907 Bacteria 2391
378 Ga0207643_10014127 3300025908 Bacteria 4336
379 Ga0207643_10105788 3300025908 Bacteria 1654
380 Ga0207643_10371142 3300025908 Bacteria 901
381 Ga0207684_10000982 3300025910 Bacteria 31991
382 Ga0207684_10032408 3300025910 Bacteria 4444
383 Ga0207654_10041546 3300025911 Bacteria 2597
384 Ga0207654_10101589 3300025911 Unclassified 1773
385 Ga0207654_10341705 3300025911 Bacteria 1028
386 Ga0207654_10440984 3300025911 Unclassified 912
387 Ga0207654_10477300 3300025911 Unclassified 878
388 Ga0207707_10000858 3300025912 Bacteria 29695
389 Ga0207707_10019275 3300025912 Bacteria 5953
390 Ga0207707_10071662 3300025912 Bacteria 3020
391 Ga0207707_10192266 3300025912 Bacteria 1780
392 Ga0207695_11109784 3300025913 Unclassified 671
393 Ga0207671_10345747 3300025914 Unclassified 1179
394 Ga0207660_10000695 3300025917 Bacteria 22515
395 Ga0207660_10328690 3300025917 Bacteria 1222
396 Ga0207662_10032453 3300025918 Bacteria 3040
397 Ga0207662_10597929 3300025918 Bacteria 767
398 Ga0207662_10865480 3300025918 Bacteria 639
399 Ga0207657_10173961 3300025919 Bacteria 1743
400 Ga0207649_10779431 3300025920 Unclassified 745
401 Ga0207649_10803474 3300025920 Bacteria 734
402 Ga0207652_10001260 3300025921 Bacteria 22535
403 Ga0207652_10042576 3300025921 Bacteria 3866
404 Ga0207652_10553422 3300025921 Bacteria 1034
405 Ga0207646_10064587 3300025922 Bacteria 3267
406 Ga0207681_10001916 3300025923 Bacteria 13318
407 Ga0207681_10095008 3300025923 Bacteria 2137
408 Ga0207650_10000001 3300025925 Bacteria 1545726
409 Ga0207650_10005510 3300025925 Bacteria 8636
410 Ga0207650_10086093 3300025925 Bacteria 2392
411 Ga0207650_10189827 3300025925 Unclassified 1641
412 Ga0207650_10235238 3300025925 Unclassified 1479
413 Ga0207650_10288221 3300025925 Bacteria 1338
414 Ga0207650_10456495 3300025925 Bacteria 1064
415 Ga0207659_10099383 3300025926 Bacteria 2191
416 Ga0207659_10170590 3300025926 Bacteria 1716
417 Ga0207659_10211626 3300025926 Bacteria 1554
418 Ga0207687_10921189 3300025927 Unclassified 748
419 Ga0207644_10052917 3300025931 Unclassified 2920
420 Ga0207690_10011695 3300025932 Bacteria 5248
421 Ga0207690_11442053 3300025932 Unclassified 576
422 Ga0207706_10219665 3300025933 Unclassified 1664
423 Ga0207706_10271719 3300025933 Bacteria 1479
424 Ga0207686_10029121 3300025934 Unclassified 3254
425 Ga0207686_10338538 3300025934 Bacteria 1129
426 Ga0207709_10088977 3300025935 Bacteria 2012
427 Ga0207709_10261153 3300025935 Bacteria 1270
428 Ga0207670_10000617 3300025936 Bacteria 19206
429 Ga0207670_10131368 3300025936 Bacteria 1835
430 Ga0207670_10151243 3300025936 Unclassified 1723
431 Ga0207670_10362544 3300025936 Unclassified 1150
432 Ga0207670_11151790 3300025936 Unclassified 656
433 Ga0207670_11421419 3300025936 Bacteria 589
434 Ga0207669_10236557 3300025937 Bacteria 1351
435 Ga0207704_10042332 3300025938 Bacteria 2680
436 Ga0207691_10010052 3300025940 Bacteria 9081
437 Ga0207691_10128907 3300025940 Unclassified 2236
438 Ga0207691_10162637 3300025940 Bacteria 1957
439 Ga0207711_10001994 3300025941 Bacteria 18482
440 Ga0207711_10019963 3300025941 Bacteria 5584
441 Ga0207711_10623571 3300025941 Unclassified 1006
442 Ga0207711_11100952 3300025941 Unclassified 735
443 Ga0207689_10123485 3300025942 Bacteria 2129
444 Ga0207689_10175608 3300025942 Bacteria 1767
445 Ga0207689_10238547 3300025942 Unclassified 1503
446 Ga0207689_10271231 3300025942 Bacteria 1405
447 Ga0207689_10537214 3300025942 Bacteria 981
448 Ga0207689_10632929 3300025942 Bacteria 901
449 Ga0207689_10730832 3300025942 Unclassified 835
450 Ga0207679_10163447 3300025945 Bacteria 1825
451 Ga0207679_10179413 3300025945 Bacteria 1751
452 Ga0207679_10362697 3300025945 Bacteria 1266
453 Ga0207679_11392113 3300025945 Unclassified 644
454 Ga0207651_10111773 3300025960 Bacteria 2052
455 Ga0207651_10112045 3300025960 Bacteria 2050
456 Ga0207651_10454239 3300025960 Bacteria 1100
457 Ga0207651_10721153 3300025960 Bacteria 880
458 Ga0207712_10144749 3300025961 Bacteria 1828
459 Ga0207640_10171332 3300025981 Bacteria 1618
460 Ga0207658_11783718 3300025986 Unclassified 562
461 Ga0207677_10004364 3300026023 Bacteria 7578
462 Ga0207677_10634566 3300026023 Bacteria 941
463 Ga0207703_10478927 3300026035 Unclassified 1166
464 Ga0207703_10534318 3300026035 Bacteria 1104
465 Ga0207703_10572142 3300026035 Bacteria 1067
466 Ga0207639_10168554 3300026041 Bacteria 1852
467 Ga0207678_10130683 3300026067 Bacteria 2142
468 Ga0207678_10666580 3300026067 Unclassified 914
469 Ga0207708_10000094 3300026075 Bacteria 67925
470 Ga0207708_10008029 3300026075 Bacteria 7824
471 Ga0207708_10061665 3300026075 Unclassified 2863
472 Ga0207708_10141373 3300026075 Bacteria 1888
473 Ga0207708_10400632 3300026075 Unclassified 1135
474 Ga0207641_10013396 3300026088 Bacteria 6723
475 Ga0207641_10062045 3300026088 Bacteria 3188
476 Ga0207641_10233839 3300026088 Unclassified 1709
477 Ga0207641_11271486 3300026088 Unclassified 736
478 Ga0207641_11862939 3300026088 Bacteria 603
479 Ga0207648_10023593 3300026089 Bacteria 5508
480 Ga0207648_10122739 3300026089 Bacteria 2284
481 Ga0207648_10200716 3300026089 Unclassified 1769
482 Ga0207676_10011259 3300026095 Bacteria 6390
483 Ga0207676_10013489 3300026095 Bacteria 5870
484 Ga0207676_10183493 3300026095 Bacteria 1834
485 Ga0207676_10249285 3300026095 Bacteria 1597
486 Ga0207676_10439944 3300026095 Bacteria 1227
487 Ga0207676_10452790 3300026095 Bacteria 1210
488 Ga0207676_10640926 3300026095 Bacteria 1024
489 Ga0207674_10000857 3300026116 Bacteria 39747
490 Ga0207674_10270296 3300026116 Bacteria 1647
491 Ga0207674_10529491 3300026116 Unclassified 1138
492 Ga0207674_10737008 3300026116 Bacteria 951
493 Ga0207674_11237997 3300026116 Unclassified 716
494 Ga0207674_11727617 3300026116 Bacteria 594
495 Ga0207675_100011072 3300026118 Bacteria 8450
496 Ga0207675_100017960 3300026118 Bacteria 6596
497 Ga0207675_100085601 3300026118 Bacteria 2958
498 Ga0207675_100090404 3300026118 Unclassified 2878
499 Ga0207675_101737116 3300026118 Unclassified 644
500 Ga0207683_10148882 3300026121 Bacteria 2112
501 Ga0207698_10151205 3300026142 Bacteria 2015
502 Ga0207698_10205346 3300026142 Bacteria 1768
503 Ga0207428_10075418 3300027907 Bacteria 2643
504 Ga0268266_10270583 3300028379 Bacteria 1577
505 Ga0268265_10012797 3300028380 Bacteria 5697
506 Ga0268265_10023447 3300028380 Bacteria 4350
507 Ga0268265_10503457 3300028380 Bacteria 1142
508 Ga0268265_10507759 3300028380 Unclassified 1137
509 Ga0268265_12333682 3300028380 Unclassified 542
510 Ga0268264_10123581 3300028381 Unclassified 2284
511 Ga0268264_10223206 3300028381 Unclassified 1736
512 Ga0268264_10238580 3300028381 Bacteria 1683
513 Ga0314311_1228007 3300030733 Bacteria 800
514 Ga0307408_100016693 3300031548 Unclassified 4907
515 Ga0307408_100653726 3300031548 Bacteria 940
516 Ga0307405_10047268 3300031731 Bacteria 2649
517 Ga0307413_10650505 3300031824 Bacteria 869
518 Ga0307406_10022881 3300031901 Unclassified 3712
519 Ga0307406_11028609 3300031901 Bacteria 708
520 Ga0307407_10442125 3300031903 Unclassified 942
521 Ga0307412_10024067 3300031911 Bacteria 3755
522 Ga0307412_10079658 3300031911 Bacteria 2260
523 Ga0307409_100272253 3300031995 Bacteria 1560
524 Ga0307416_100048659 3300032002 Unclassified 3365
525 Ga0307416_100407132 3300032002 Bacteria 1400
526 Ga0307416_100569335 3300032002 Bacteria 1208
527 Ga0307414_10003219 3300032004 Bacteria 8691
528 Ga0307414_10530686 3300032004 Unclassified 1046
529 Ga0307411_10011944 3300032005 Bacteria 4713
530 Ga0307411_10380751 3300032005 Bacteria 1160
531 Ga0307415_100058367 3300032126 Bacteria 2657
532 Ga0307415_100085610 3300032126 Unclassified 2265
533 Ga0373951_0001608 3300035091 Bacteria 5931
534 Ga0373951_0013025 3300035091 Unclassified 1870
535 Ga0373952_0135605 3300035092 Bacteria 680
536 Ga0373960_0035115 3300035121 Bacteria 1422
537 Ga0373931_0376854 3300035691 Bacteria 894
538 Ga0373937_0055844 3300036401 Bacteria 3626
539 Ga0395898_0370747 3300037466 Bacteria 1365
540 Ga0395898_0516485 3300037466 Unclassified 1136
541 Ga0395898_0866625 3300037466 Bacteria 842
542 Ga0395901_0160296 3300038443 Bacteria 2363
543 Ga0451807_2430403 3300041486 Unclassified 542
544 Ga0439448_0017840 3300042005 Unclassified 2171
545 Ga0439455_0000891 3300042012 Bacteria 4609
546 Ga0450889_009426 3300042144 Unclassified 1000
547 Ga0439458_0009720 3300042157 Unclassified 2141
548 Ga0451576_0520549 3300045051 Bacteria 1250
549 Ga0495656_0115965 3300046615 Bacteria 1259
550 Ga0496107_0332207 3300048910 Unclassified 1131
551 Ga0496108_1528297 3300048911 Unclassified 555
552 Ga0496109_0215180 3300048912 Unclassified 1807
553 Ga0496109_1618730 3300048912 Unclassified 582
554 Ga0496110_0347984 3300048913 Bacteria 1350
555 Ga0496112_0080302 3300048915 Unclassified 3225
556 Ga0496112_0556367 3300048915 Unclassified 1081
557 Ga0496112_1033352 3300048915 Unclassified 741
558 Ga0496112_1248462 3300048915 Unclassified 659
559 Ga0496112_1274381 3300048915 Unclassified 651
560 Ga0501305_005081 3300049161 Bacteria 1578
561 Ga0501296_003597 3300049519 Bacteria 1659
562 Ga0501298_002220 3300049521 Bacteria 2926
563 Ga0501040_0212147 3300049576 Bacteria 1377
564 Ga0501071_0172168 3300049587 Unclassified 1621
565 Ga0501075_0536233 3300049591 Unclassified 893
566 Ga0501198_003553 3300049649 Bacteria 2134
567 Ga0501202_022728 3300049652 Bacteria 1261
568 Ga0501209_015081 3300049656 Bacteria 1714
569 Ga0501209_116216 3300049656 Unclassified 792
570 Ga0501216_007195 3300049660 Bacteria 1725
571 Ga0501223_001138 3300049663 Bacteria 6270
572 Ga0501223_020560 3300049663 Bacteria 1292
573 Ga0501224_007585 3300049664 Bacteria 1582
574 Ga0501233_000525 3300049668 Bacteria 6149
575 Ga0501235_002751 3300049669 Bacteria 3782
576 Ga0501235_193996 3300049669 Unclassified 547
577 Ga0501239_037595 3300049672 Bacteria 658
578 Ga0501240_004181 3300049673 Bacteria 1660
579 Ga0501240_107390 3300049673 Unclassified 542
580 Ga0501243_009923 3300049675 Bacteria 1482
581 Ga0501253_052537 3300049683 Unclassified 857
582 Ga0501257_009614 3300049686 Bacteria 2186
583 Ga0501257_017485 3300049686 Bacteria 1668
584 Ga0501225_0026333 3300049705 Unclassified 1599
585 Ga0501225_0034241 3300049705 Unclassified 1398
586 Ga0501225_0294885 3300049705 Bacteria 547
587 Ga0501229_002874 3300049706 Bacteria 2038
588 Ga0501234_001653 3300049707 Bacteria 3494
589 Ga0501234_008249 3300049707 Bacteria 1627
590 Ga0501079_0357812 3300049741 Bacteria 1144
591 Ga0501081_0180712 3300049743 Bacteria 1526
592 Ga0501232_044316 3300049757 Unclassified 666
593 Ga0501266_087055 3300049763 Unclassified 537
594 Ga0501271_019201 3300049768 Bacteria 785
595 Ga0501045_0184379 3300049824 Bacteria 1555
596 nmdc:mga05p37_114237_c1 3300050507 Unclassified 3319
597 nmdc:mga05p37_1293158_c1 3300050507 Unclassified 744
598 nmdc:mga05p37_284688_c1 3300050507 Bacteria 1970
599 nmdc:mga05p37_453210_c1 3300050507 Unclassified 1484
600 nmdc:mga05p37_723858_c1 3300050507 Unclassified 1101
601 nmdc:mga09592_250783_c1 3300050508 Bacteria 1534
602 nmdc:mga09592_715682_c1 3300050508 Unclassified 851
603 nmdc:mga09592_79648_c1 3300050508 Bacteria 2789
604 nmdc:mga0qj67_35876_c1 3300050509 Bacteria 3878
605 nmdc:mga08y16_82121_c1 3300050511 Bacteria 3360
606 nmdc:mga0n895_440199_c1 3300050512 Unclassified 1317
607 nmdc:mga0n895_750871_c1 3300050512 Unclassified 969
608 nmdc:mga0rr50_1654873_c1 3300050513 Unclassified 540
609 nmdc:mga0rr50_198197_c1 3300050513 Bacteria 1649
610 nmdc:mga08x19_5744_c1 3300050514 Bacteria 7337
611 nmdc:mga08x19_964297_c1 3300050514 Unclassified 606
612 nmdc:mga0a205_122717_c1 3300050515 Bacteria 2498
613 nmdc:mga0a205_187748_c1 3300050515 Unclassified 1959
614 nmdc:mga0a205_21803_c1 3300050515 Bacteria 6058
615 nmdc:mga0a205_258205_c1 3300050515 Unclassified 1620
616 nmdc:mga0a205_354473_c1 3300050515 Unclassified 1334
617 nmdc:mga0a205_95243_c1 3300050515 Unclassified 2400
618 Ga0501084_0123491 3300054114 Bacteria 2178
619 Ga0501084_0196081 3300054114 Unclassified 1704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10153598 Ga0157378_101535983 145
2 3300005331 Ga0070670_100000364 Ga0070670_10000036416 146
3 3300005340 Ga0070689_100180077 Ga0070689_1001800773 146
4 3300005347 Ga0070668_101001872 Ga0070668_1010018722 146
5 3300005353 Ga0070669_100004750 Ga0070669_1000047505 146
6 3300005366 Ga0070659_100734958 Ga0070659_1007349582 146
7 3300005444 Ga0070694_100558741 Ga0070694_1005587412 146
8 3300005457 Ga0070662_100529344 Ga0070662_1005293441 146
9 3300005546 Ga0070696_100378628 Ga0070696_1003786281 146
10 3300005841 Ga0068863_100026417 Ga0068863_1000264172 146
11 3300006852 Ga0075433_10027256 Ga0075433_100272563 146
12 3300006914 Ga0075436_100003502 Ga0075436_1000035029 146
13 3300009147 Ga0114129_10047870 Ga0114129_100478704 146
14 3300009174 Ga0105241_11546767 Ga0105241_115467671 146
15 3300009553 Ga0105249_10733701 Ga0105249_107337012 146
16 3300013297 Ga0157378_10064667 Ga0157378_100646673 146
17 3300013297 Ga0157378_11470935 Ga0157378_114709352 146
18 3300013306 Ga0163162_10301519 Ga0163162_103015192 146
19 3300013308 Ga0157375_10232515 Ga0157375_102325153 146
20 3300025923 Ga0207681_10001916 Ga0207681_100019165 146
21 3300025925 Ga0207650_10005510 Ga0207650_100055109 146
22 3300025936 Ga0207670_10151243 Ga0207670_101512433 146
23 3300026088 Ga0207641_10013396 Ga0207641_100133967 146
24 3300049669 Ga0501235_193996 Ga0501235_193996_11_466 146
25 3300049705 Ga0501225_0294885 Ga0501225_0294885_10_462 146
26 3300050507 nmdc:mga05p37_114237_c1 nmdc:mga05p37_114237_c1_1036_1494 146
27 3300050508 nmdc:mga09592_79648_c1 nmdc:mga09592_79648_c1_1667_2119 146
28 3300005615 Ga0070702_100651490 Ga0070702_1006514902 148
29 3300005841 Ga0068863_100803098 Ga0068863_1008030982 148
30 3300002459 JGI24751J29686_10002236 JGI24751J29686_100022362 149
31 3300005334 Ga0068869_100910253 Ga0068869_1009102532 149
32 3300005337 Ga0070682_100017149 Ga0070682_1000171494 149
33 3300005340 Ga0070689_100506897 Ga0070689_1005068971 149
34 3300005345 Ga0070692_10166960 Ga0070692_101669602 149
35 3300005364 Ga0070673_100210065 Ga0070673_1002100652 149
36 3300005366 Ga0070659_101210996 Ga0070659_1012109962 149
37 3300005440 Ga0070705_100980566 Ga0070705_1009805661 149
38 3300005536 Ga0070697_100046015 Ga0070697_1000460152 149
39 3300006852 Ga0075433_10210594 Ga0075433_102105942 149
40 3300009011 Ga0105251_10109541 Ga0105251_101095412 149
41 3300025913 Ga0207695_11109784 Ga0207695_111097841 149
42 3300025986 Ga0207658_11783718 Ga0207658_117837181 149
43 3300005331 Ga0070670_100075567 Ga0070670_1000755673 150
44 3300005334 Ga0068869_100557524 Ga0068869_1005575241 150
45 3300005344 Ga0070661_100329677 Ga0070661_1003296771 150
46 3300005353 Ga0070669_101342759 Ga0070669_1013427591 150
47 3300005577 Ga0068857_100281598 Ga0068857_1002815982 150
48 3300005578 Ga0068854_100469271 Ga0068854_1004692712 150
49 3300005840 Ga0068870_10528367 Ga0068870_105283671 150
50 3300005842 Ga0068858_100366887 Ga0068858_1003668872 150
51 3300025920 Ga0207649_10779431 Ga0207649_107794311 150
52 3300025925 Ga0207650_10189827 Ga0207650_101898273 150
53 3300025942 Ga0207689_10123485 Ga0207689_101234852 150
54 3300025981 Ga0207640_10171332 Ga0207640_101713322 150
55 3300026067 Ga0207678_10666580 Ga0207678_106665802 150
56 3300031548 Ga0307408_100016693 Ga0307408_1000166933 150
57 3300031901 Ga0307406_10022881 Ga0307406_100228813 150
58 3300031911 Ga0307412_10024067 Ga0307412_100240671 150
59 3300032002 Ga0307416_100048659 Ga0307416_1000486593 150
60 3300032004 Ga0307414_10003219 Ga0307414_100032195 150
61 3300032005 Ga0307411_10011944 Ga0307411_100119443 150
62 3300032126 Ga0307415_100085610 Ga0307415_1000856102 150
63 3300045051 Ga0451576_0520549 Ga0451576_0520549_781_1233 150
64 3300048912 Ga0496109_1618730 Ga0496109_1618730_64_516 150
65 3300048915 Ga0496112_0080302 Ga0496112_0080302_1015_1467 150
66 3300049649 Ga0501198_003553 Ga0501198_003553_547_999 150
67 3300049652 Ga0501202_022728 Ga0501202_022728_796_1248 150
68 3300049656 Ga0501209_015081 Ga0501209_015081_1212_1664 150
69 3300049663 Ga0501223_001138 Ga0501223_001138_3113_3565 150
70 3300049664 Ga0501224_007585 Ga0501224_007585_1058_1510 150
71 3300049668 Ga0501233_000525 Ga0501233_000525_2112_2564 150
72 3300049669 Ga0501235_002751 Ga0501235_002751_73_525 150
73 3300049673 Ga0501240_004181 Ga0501240_004181_52_504 150
74 3300049686 Ga0501257_009614 Ga0501257_009614_479_931 150
75 3300049705 Ga0501225_0034241 Ga0501225_0034241_911_1363 150
76 3300049706 Ga0501229_002874 Ga0501229_002874_1024_1476 150
77 3300049707 Ga0501234_001653 Ga0501234_001653_35_487 150
78 3300049741 Ga0501079_0357812 Ga0501079_0357812_418_888 150
79 3300049757 Ga0501232_044316 Ga0501232_044316_51_503 150
80 3300049763 Ga0501266_087055 Ga0501266_087055_46_498 150
81 3300003203 JGI25406J46586_10013237 JGI25406J46586_100132374 151
82 3300005290 Ga0065712_10002087 Ga0065712_100020875 151
83 3300005331 Ga0070670_100000564 Ga0070670_1000005648 151
84 3300005331 Ga0070670_100128241 Ga0070670_1001282412 151
85 3300005331 Ga0070670_101296809 Ga0070670_1012968091 151
86 3300005334 Ga0068869_100377832 Ga0068869_1003778322 151
87 3300005364 Ga0070673_100361391 Ga0070673_1003613912 151
88 3300005438 Ga0070701_10034767 Ga0070701_100347673 151
89 3300005441 Ga0070700_100176157 Ga0070700_1001761571 151
90 3300005444 Ga0070694_100048669 Ga0070694_1000486692 151
91 3300005458 Ga0070681_10098038 Ga0070681_100980383 151
92 3300005458 Ga0070681_10475710 Ga0070681_104757102 151
93 3300005467 Ga0070706_101672054 Ga0070706_1016720541 151
94 3300005468 Ga0070707_100025127 Ga0070707_1000251274 151
95 3300005518 Ga0070699_100005259 Ga0070699_1000052593 151
96 3300005530 Ga0070679_100407134 Ga0070679_1004071341 151
97 3300005545 Ga0070695_100921934 Ga0070695_1009219341 151
98 3300005546 Ga0070696_100284526 Ga0070696_1002845261 151
99 3300005547 Ga0070693_100045637 Ga0070693_1000456372 151
100 3300005564 Ga0070664_101093722 Ga0070664_1010937222 151
101 3300005577 Ga0068857_100178634 Ga0068857_1001786343 151
102 3300005577 Ga0068857_100255417 Ga0068857_1002554172 151
103 3300005577 Ga0068857_101756748 Ga0068857_1017567481 151
104 3300005615 Ga0070702_100253727 Ga0070702_1002537272 151
105 3300005617 Ga0068859_100032766 Ga0068859_1000327666 151
106 3300005617 Ga0068859_100215721 Ga0068859_1002157213 151
107 3300005617 Ga0068859_100345444 Ga0068859_1003454443 151
108 3300005617 Ga0068859_100578769 Ga0068859_1005787692 151
109 3300005617 Ga0068859_100987305 Ga0068859_1009873052 151
110 3300005618 Ga0068864_100010719 Ga0068864_1000107197 151
111 3300005618 Ga0068864_100444900 Ga0068864_1004449002 151
112 3300005618 Ga0068864_101106796 Ga0068864_1011067962 151
113 3300005841 Ga0068863_100172043 Ga0068863_1001720433 151
114 3300005841 Ga0068863_100290638 Ga0068863_1002906383 151
115 3300005841 Ga0068863_100305591 Ga0068863_1003055912 151
116 3300005842 Ga0068858_100385131 Ga0068858_1003851313 151
117 3300005844 Ga0068862_100147690 Ga0068862_1001476904 151
118 3300005985 Ga0081539_10001547 Ga0081539_1000154713 151
119 3300005985 Ga0081539_10099160 Ga0081539_100991602 151
120 3300006237 Ga0097621_100073829 Ga0097621_1000738292 151
121 3300006358 Ga0068871_100151570 Ga0068871_1001515702 151
122 3300006852 Ga0075433_10135630 Ga0075433_101356304 151
123 3300006871 Ga0075434_100133315 Ga0075434_1001333154 151
124 3300006871 Ga0075434_100249456 Ga0075434_1002494562 151
125 3300006871 Ga0075434_100474282 Ga0075434_1004742822 151
126 3300006880 Ga0075429_101015577 Ga0075429_1010155771 151
127 3300006931 Ga0097620_100032766 Ga0097620_1000327666 151
128 3300006931 Ga0097620_100215707 Ga0097620_1002157073 151
129 3300006931 Ga0097620_100345450 Ga0097620_1003454502 151
130 3300006931 Ga0097620_100578763 Ga0097620_1005787632 151
131 3300006931 Ga0097620_100987256 Ga0097620_1009872562 151
132 3300009011 Ga0105251_10124086 Ga0105251_101240862 151
133 3300009098 Ga0105245_10998951 Ga0105245_109989512 151
134 3300009098 Ga0105245_12156426 Ga0105245_121564261 151
135 3300009101 Ga0105247_10003928 Ga0105247_100039285 151
136 3300009101 Ga0105247_10144430 Ga0105247_101444302 151
137 3300009101 Ga0105247_10809122 Ga0105247_108091221 151
138 3300009174 Ga0105241_10557109 Ga0105241_105571092 151
139 3300009176 Ga0105242_10128319 Ga0105242_101283193 151
140 3300009177 Ga0105248_10631484 Ga0105248_106314842 151
141 3300009551 Ga0105238_10011801 Ga0105238_100118015 151
142 3300009553 Ga0105249_10279919 Ga0105249_102799191 151
143 3300010375 Ga0105239_12743848 Ga0105239_127438481 151
144 3300013100 Ga0157373_10158365 Ga0157373_101583652 151
145 3300013297 Ga0157378_12251402 Ga0157378_122514021 151
146 3300013306 Ga0163162_10307429 Ga0163162_103074293 151
147 3300013308 Ga0157375_10393394 Ga0157375_103933941 151
148 3300013308 Ga0157375_11584959 Ga0157375_115849591 151
149 3300014325 Ga0163163_10004963 Ga0163163_100049635 151
150 3300014325 Ga0163163_10178591 Ga0163163_101785912 151
151 3300014326 Ga0157380_10195348 Ga0157380_101953482 151
152 3300014745 Ga0157377_10120682 Ga0157377_101206823 151
153 3300014745 Ga0157377_10501399 Ga0157377_105013992 151
154 3300014968 Ga0157379_11028514 Ga0157379_110285142 151
155 3300014968 Ga0157379_11099405 Ga0157379_110994051 151
156 3300014969 Ga0157376_11267212 Ga0157376_112672122 151
157 3300025900 Ga0207710_10018809 Ga0207710_100188093 151
158 3300025901 Ga0207688_11097830 Ga0207688_110978301 151
159 3300025911 Ga0207654_10101589 Ga0207654_101015893 151
160 3300025912 Ga0207707_10071662 Ga0207707_100716623 151
161 3300025912 Ga0207707_10192266 Ga0207707_101922664 151
162 3300025914 Ga0207671_10345747 Ga0207671_103457471 151
163 3300025918 Ga0207662_10597929 Ga0207662_105979291 151
164 3300025922 Ga0207646_10064587 Ga0207646_100645873 151
165 3300025923 Ga0207681_10095008 Ga0207681_100950083 151
166 3300025925 Ga0207650_10000001 Ga0207650_1000000150 151
167 3300025925 Ga0207650_10086093 Ga0207650_100860932 151
168 3300025926 Ga0207659_10099383 Ga0207659_100993833 151
169 3300025927 Ga0207687_10921189 Ga0207687_109211891 151
170 3300025932 Ga0207690_11442053 Ga0207690_114420531 151
171 3300025934 Ga0207686_10029121 Ga0207686_100291214 151
172 3300025935 Ga0207709_10261153 Ga0207709_102611531 151
173 3300025936 Ga0207670_10000617 Ga0207670_1000061711 151
174 3300025936 Ga0207670_10131368 Ga0207670_101313683 151
175 3300025936 Ga0207670_11421419 Ga0207670_114214191 151
176 3300025941 Ga0207711_10623571 Ga0207711_106235711 151
177 3300025942 Ga0207689_10271231 Ga0207689_102712313 151
178 3300025942 Ga0207689_10632929 Ga0207689_106329292 151
179 3300025942 Ga0207689_10730832 Ga0207689_107308322 151
180 3300025945 Ga0207679_11392113 Ga0207679_113921132 151
181 3300025960 Ga0207651_10112045 Ga0207651_101120453 151
182 3300025960 Ga0207651_10454239 Ga0207651_104542392 151
183 3300026035 Ga0207703_10478927 Ga0207703_104789272 151
184 3300026035 Ga0207703_10534318 Ga0207703_105343181 151
185 3300026035 Ga0207703_10572142 Ga0207703_105721422 151
186 3300026075 Ga0207708_10141373 Ga0207708_101413732 151
187 3300026088 Ga0207641_10233839 Ga0207641_102338392 151
188 3300026089 Ga0207648_10122739 Ga0207648_101227391 151
189 3300026089 Ga0207648_10200716 Ga0207648_102007162 151
190 3300026095 Ga0207676_10249285 Ga0207676_102492853 151
191 3300026116 Ga0207674_10270296 Ga0207674_102702962 151
192 3300026116 Ga0207674_11237997 Ga0207674_112379971 151
193 3300026116 Ga0207674_11727617 Ga0207674_117276171 151
194 3300026118 Ga0207675_100090404 Ga0207675_1000904044 151
195 3300026142 Ga0207698_10151205 Ga0207698_101512052 151
196 3300028380 Ga0268265_12333682 Ga0268265_123336821 151
197 3300028381 Ga0268264_10123581 Ga0268264_101235813 151
198 3300028381 Ga0268264_10223206 Ga0268264_102232063 151
199 3300035091 Ga0373951_0013025 Ga0373951_0013025_1343_1816 151
200 3300035092 Ga0373952_0135605 Ga0373952_0135605_186_641 151
201 3300037466 Ga0395898_0370747 Ga0395898_0370747_880_1335 151
202 3300042005 Ga0439448_0017840 Ga0439448_0017840_1247_1702 151
203 3300042012 Ga0439455_0000891 Ga0439455_0000891_2020_2475 151
204 3300042144 Ga0450889_009426 Ga0450889_009426_486_941 151
205 3300042157 Ga0439458_0009720 Ga0439458_0009720_287_742 151
206 3300048911 Ga0496108_1528297 Ga0496108_1528297_36_491 151
207 3300048912 Ga0496109_0215180 Ga0496109_0215180_405_860 151
208 3300048913 Ga0496110_0347984 Ga0496110_0347984_884_1339 151
209 3300048915 Ga0496112_1033352 Ga0496112_1033352_204_659 151
210 3300048915 Ga0496112_1248462 Ga0496112_1248462_17_472 151
211 3300048915 Ga0496112_1274381 Ga0496112_1274381_60_515 151
212 3300050512 nmdc:mga0n895_750871_c1 nmdc:mga0n895_750871_c1_173_628 151
213 3300050515 nmdc:mga0a205_122717_c1 nmdc:mga0a205_122717_c1_950_1405 151
214 3300050515 nmdc:mga0a205_95243_c1 nmdc:mga0a205_95243_c1_141_596 151
215 3300005289 Ga0065704_10090256 Ga0065704_100902563 152
216 3300005328 Ga0070676_10032499 Ga0070676_100324993 152
217 3300005330 Ga0070690_101270976 Ga0070690_1012709761 152
218 3300005331 Ga0070670_100112936 Ga0070670_1001129361 152
219 3300005331 Ga0070670_100560843 Ga0070670_1005608432 152
220 3300005336 Ga0070680_100054384 Ga0070680_1000543843 152
221 3300005337 Ga0070682_100058283 Ga0070682_1000582832 152
222 3300005339 Ga0070660_100109155 Ga0070660_1001091552 152
223 3300005353 Ga0070669_100004225 Ga0070669_1000042252 152
224 3300005356 Ga0070674_100153827 Ga0070674_1001538271 152
225 3300005364 Ga0070673_100823937 Ga0070673_1008239372 152
226 3300005441 Ga0070700_100005450 Ga0070700_1000054504 152
227 3300005444 Ga0070694_100014572 Ga0070694_1000145724 152
228 3300005458 Ga0070681_10016984 Ga0070681_100169844 152
229 3300005459 Ga0068867_100492023 Ga0068867_1004920232 152
230 3300005539 Ga0068853_100028512 Ga0068853_1000285124 152
231 3300005543 Ga0070672_100139425 Ga0070672_1001394252 152
232 3300005544 Ga0070686_100695128 Ga0070686_1006951282 152
233 3300005546 Ga0070696_101333634 Ga0070696_1013336341 152
234 3300005549 Ga0070704_100070796 Ga0070704_1000707963 152
235 3300005719 Ga0068861_100017277 Ga0068861_1000172774 152
236 3300005840 Ga0068870_10010359 Ga0068870_100103595 152
237 3300005843 Ga0068860_101212529 Ga0068860_1012125292 152
238 3300005844 Ga0068862_100051778 Ga0068862_1000517784 152
239 3300014325 Ga0163163_10093304 Ga0163163_100933043 152
240 3300025907 Ga0207645_10061876 Ga0207645_100618763 152
241 3300025925 Ga0207650_10456495 Ga0207650_104564952 152
242 3300025933 Ga0207706_10219665 Ga0207706_102196653 152
243 3300025937 Ga0207669_10236557 Ga0207669_102365571 152
244 3300025940 Ga0207691_10128907 Ga0207691_101289073 152
245 3300025940 Ga0207691_10162637 Ga0207691_101626373 152
246 3300025961 Ga0207712_10144749 Ga0207712_101447492 152
247 3300026075 Ga0207708_10008029 Ga0207708_100080294 152
248 3300026118 Ga0207675_100011072 Ga0207675_1000110724 152
249 3300027907 Ga0207428_10075418 Ga0207428_100754183 152
250 3300028380 Ga0268265_10012797 Ga0268265_100127972 152
251 3300028380 Ga0268265_10023447 Ga0268265_100234472 152
252 3300032126 Ga0307415_100058367 Ga0307415_1000583674 152
253 3300049519 Ga0501296_003597 Ga0501296_003597_491_967 152
254 3300049663 Ga0501223_020560 Ga0501223_020560_528_1004 152
255 3300049672 Ga0501239_037595 Ga0501239_037595_110_586 152
256 3300049768 Ga0501271_019201 Ga0501271_019201_251_727 152
257 3300005330 Ga0070690_100043353 Ga0070690_1000433536 153
258 3300005340 Ga0070689_100000225 Ga0070689_10000022521 153
259 3300005458 Ga0070681_10121089 Ga0070681_101210892 153
260 3300005617 Ga0068859_100499400 Ga0068859_1004994002 153
261 3300005843 Ga0068860_100372806 Ga0068860_1003728062 153
262 3300006931 Ga0097620_100499406 Ga0097620_1004994062 153
263 3300009147 Ga0114129_10082801 Ga0114129_100828014 153
264 3300009177 Ga0105248_11684491 Ga0105248_116844911 153
265 3300014326 Ga0157380_10143567 Ga0157380_101435674 153
266 3300025918 Ga0207662_10865480 Ga0207662_108654801 153
267 3300028380 Ga0268265_10507759 Ga0268265_105077592 153
268 3300028381 Ga0268264_10238580 Ga0268264_102385803 153
269 3300035091 Ga0373951_0001608 Ga0373951_0001608_3792_4253 153
270 3300048915 Ga0496112_0556367 Ga0496112_0556367_64_543 153
271 3300050515 nmdc:mga0a205_187748_c1 nmdc:mga0a205_187748_c1_1205_1681 153
272 3300004803 Ga0058862_12851999 Ga0058862_128519991 154
273 3300005289 Ga0065704_10228633 Ga0065704_102286332 154
274 3300005290 Ga0065712_10025335 Ga0065712_100253352 154
275 3300005293 Ga0065715_10138632 Ga0065715_101386323 154
276 3300005293 Ga0065715_10182925 Ga0065715_101829253 154
277 3300005295 Ga0065707_10005341 Ga0065707_100053415 154
278 3300005295 Ga0065707_10128745 Ga0065707_101287452 154
279 3300005295 Ga0065707_10168407 Ga0065707_101684071 154
280 3300005328 Ga0070676_10050130 Ga0070676_100501303 154
281 3300005330 Ga0070690_100738572 Ga0070690_1007385721 154
282 3300005331 Ga0070670_100536932 Ga0070670_1005369321 154
283 3300005334 Ga0068869_100030527 Ga0068869_1000305271 154
284 3300005334 Ga0068869_100097078 Ga0068869_1000970782 154
285 3300005336 Ga0070680_100001614 Ga0070680_1000016145 154
286 3300005338 Ga0068868_100043768 Ga0068868_1000437682 154
287 3300005340 Ga0070689_101325990 Ga0070689_1013259901 154
288 3300005343 Ga0070687_100038148 Ga0070687_1000381483 154
289 3300005343 Ga0070687_100163113 Ga0070687_1001631132 154
290 3300005343 Ga0070687_100623627 Ga0070687_1006236272 154
291 3300005344 Ga0070661_100167949 Ga0070661_1001679491 154
292 3300005345 Ga0070692_10352077 Ga0070692_103520772 154
293 3300005345 Ga0070692_10420899 Ga0070692_104208991 154
294 3300005345 Ga0070692_10484879 Ga0070692_104848792 154
295 3300005353 Ga0070669_100031660 Ga0070669_1000316603 154
296 3300005353 Ga0070669_100073012 Ga0070669_1000730123 154
297 3300005354 Ga0070675_100093358 Ga0070675_1000933582 154
298 3300005354 Ga0070675_100151597 Ga0070675_1001515974 154
299 3300005355 Ga0070671_100077576 Ga0070671_1000775763 154
300 3300005355 Ga0070671_100178058 Ga0070671_1001780583 154
301 3300005356 Ga0070674_100099163 Ga0070674_1000991632 154
302 3300005364 Ga0070673_100016583 Ga0070673_1000165835 154
303 3300005364 Ga0070673_101419400 Ga0070673_1014194001 154
304 3300005365 Ga0070688_100012293 Ga0070688_1000122935 154
305 3300005366 Ga0070659_100014691 Ga0070659_1000146918 154
306 3300005367 Ga0070667_100023034 Ga0070667_1000230343 154
307 3300005367 Ga0070667_100112456 Ga0070667_1001124562 154
308 3300005434 Ga0070709_10078453 Ga0070709_100784532 154
309 3300005438 Ga0070701_10195579 Ga0070701_101955792 154
310 3300005441 Ga0070700_100000295 Ga0070700_10000029523 154
311 3300005444 Ga0070694_100072654 Ga0070694_1000726542 154
312 3300005444 Ga0070694_100194026 Ga0070694_1001940261 154
313 3300005444 Ga0070694_100289638 Ga0070694_1002896382 154
314 3300005445 Ga0070708_100000851 Ga0070708_10000085111 154
315 3300005456 Ga0070678_100406718 Ga0070678_1004067182 154
316 3300005457 Ga0070662_100419248 Ga0070662_1004192482 154
317 3300005457 Ga0070662_100599761 Ga0070662_1005997612 154
318 3300005458 Ga0070681_10001343 Ga0070681_100013435 154
319 3300005459 Ga0068867_100016077 Ga0068867_1000160774 154
320 3300005459 Ga0068867_100127691 Ga0068867_1001276912 154
321 3300005459 Ga0068867_100140381 Ga0068867_1001403812 154
322 3300005466 Ga0070685_10080591 Ga0070685_100805913 154
323 3300005467 Ga0070706_100036266 Ga0070706_1000362664 154
324 3300005467 Ga0070706_100284878 Ga0070706_1002848782 154
325 3300005468 Ga0070707_100119692 Ga0070707_1001196923 154
326 3300005471 Ga0070698_100003467 Ga0070698_1000034679 154
327 3300005518 Ga0070699_100003797 Ga0070699_10000379711 154
328 3300005530 Ga0070679_100001377 Ga0070679_1000013775 154
329 3300005530 Ga0070679_100005438 Ga0070679_1000054386 154
330 3300005535 Ga0070684_100367658 Ga0070684_1003676583 154
331 3300005536 Ga0070697_100009334 Ga0070697_1000093343 154
332 3300005536 Ga0070697_100029801 Ga0070697_1000298015 154
333 3300005539 Ga0068853_100173640 Ga0068853_1001736402 154
334 3300005543 Ga0070672_100057941 Ga0070672_1000579414 154
335 3300005543 Ga0070672_100335498 Ga0070672_1003354982 154
336 3300005544 Ga0070686_100019783 Ga0070686_1000197833 154
337 3300005545 Ga0070695_100137709 Ga0070695_1001377092 154
338 3300005545 Ga0070695_100270430 Ga0070695_1002704302 154
339 3300005545 Ga0070695_100632692 Ga0070695_1006326922 154
340 3300005546 Ga0070696_100103479 Ga0070696_1001034794 154
341 3300005546 Ga0070696_100396330 Ga0070696_1003963302 154
342 3300005546 Ga0070696_100864071 Ga0070696_1008640712 154
343 3300005547 Ga0070693_101397373 Ga0070693_1013973731 154
344 3300005548 Ga0070665_100223358 Ga0070665_1002233582 154
345 3300005549 Ga0070704_100204525 Ga0070704_1002045252 154
346 3300005549 Ga0070704_100900510 Ga0070704_1009005101 154
347 3300005564 Ga0070664_100024778 Ga0070664_1000247784 154
348 3300005564 Ga0070664_100123308 Ga0070664_1001233084 154
349 3300005564 Ga0070664_100233251 Ga0070664_1002332513 154
350 3300005564 Ga0070664_100305401 Ga0070664_1003054011 154
351 3300005564 Ga0070664_100373281 Ga0070664_1003732812 154
352 3300005564 Ga0070664_100406338 Ga0070664_1004063382 154
353 3300005577 Ga0068857_100005327 Ga0068857_1000053278 154
354 3300005577 Ga0068857_100173867 Ga0068857_1001738672 154
355 3300005577 Ga0068857_100304980 Ga0068857_1003049802 154
356 3300005577 Ga0068857_100978161 Ga0068857_1009781612 154
357 3300005578 Ga0068854_100235375 Ga0068854_1002353752 154
358 3300005616 Ga0068852_100078666 Ga0068852_1000786663 154
359 3300005617 Ga0068859_100002151 Ga0068859_1000021513 154
360 3300005617 Ga0068859_100029807 Ga0068859_1000298073 154
361 3300005617 Ga0068859_100322591 Ga0068859_1003225912 154
362 3300005617 Ga0068859_100420998 Ga0068859_1004209983 154
363 3300005617 Ga0068859_100536439 Ga0068859_1005364392 154
364 3300005618 Ga0068864_100010455 Ga0068864_1000104555 154
365 3300005618 Ga0068864_100081403 Ga0068864_1000814033 154
366 3300005618 Ga0068864_100087096 Ga0068864_1000870964 154
367 3300005618 Ga0068864_100149363 Ga0068864_1001493633 154
368 3300005618 Ga0068864_100268635 Ga0068864_1002686353 154
369 3300005618 Ga0068864_100402697 Ga0068864_1004026972 154
370 3300005618 Ga0068864_100423722 Ga0068864_1004237222 154
371 3300005718 Ga0068866_10010792 Ga0068866_100107924 154
372 3300005718 Ga0068866_10531282 Ga0068866_105312822 154
373 3300005719 Ga0068861_100031020 Ga0068861_1000310204 154
374 3300005719 Ga0068861_100269066 Ga0068861_1002690663 154
375 3300005840 Ga0068870_10058717 Ga0068870_100587173 154
376 3300005840 Ga0068870_10315691 Ga0068870_103156912 154
377 3300005841 Ga0068863_100011577 Ga0068863_1000115774 154
378 3300005841 Ga0068863_100088562 Ga0068863_1000885621 154
379 3300005841 Ga0068863_100364833 Ga0068863_1003648332 154
380 3300005841 Ga0068863_100625128 Ga0068863_1006251282 154
381 3300005842 Ga0068858_100484813 Ga0068858_1004848132 154
382 3300005843 Ga0068860_100032354 Ga0068860_1000323543 154
383 3300005843 Ga0068860_100052706 Ga0068860_1000527063 154
384 3300005843 Ga0068860_101935624 Ga0068860_1019356241 154
385 3300005844 Ga0068862_100006000 Ga0068862_1000060009 154
386 3300005844 Ga0068862_100029319 Ga0068862_1000293194 154
387 3300005844 Ga0068862_100038808 Ga0068862_1000388083 154
388 3300006237 Ga0097621_100003606 Ga0097621_1000036064 154
389 3300006237 Ga0097621_100014184 Ga0097621_1000141844 154
390 3300006358 Ga0068871_100005384 Ga0068871_1000053845 154
391 3300006358 Ga0068871_100061825 Ga0068871_1000618253 154
392 3300006844 Ga0075428_100306308 Ga0075428_1003063083 154
393 3300006846 Ga0075430_100105924 Ga0075430_1001059243 154
394 3300006847 Ga0075431_100291554 Ga0075431_1002915542 154
395 3300006847 Ga0075431_100333110 Ga0075431_1003331102 154
396 3300006852 Ga0075433_10035919 Ga0075433_100359194 154
397 3300006852 Ga0075433_10177093 Ga0075433_101770933 154
398 3300006852 Ga0075433_10519326 Ga0075433_105193262 154
399 3300006871 Ga0075434_100236574 Ga0075434_1002365743 154
400 3300006880 Ga0075429_100059209 Ga0075429_1000592092 154
401 3300006880 Ga0075429_100083675 Ga0075429_1000836753 154
402 3300006880 Ga0075429_100429593 Ga0075429_1004295932 154
403 3300006881 Ga0068865_100010220 Ga0068865_1000102203 154
404 3300006931 Ga0097620_100002151 Ga0097620_1000021513 154
405 3300006931 Ga0097620_100029806 Ga0097620_1000298063 154
406 3300006931 Ga0097620_100322584 Ga0097620_1003225843 154
407 3300006931 Ga0097620_100420976 Ga0097620_1004209763 154
408 3300006931 Ga0097620_100536449 Ga0097620_1005364492 154
409 3300007076 Ga0075435_100244166 Ga0075435_1002441663 154
410 3300009094 Ga0111539_10141191 Ga0111539_101411913 154
411 3300009094 Ga0111539_10679041 Ga0111539_106790412 154
412 3300009094 Ga0111539_10741642 Ga0111539_107416421 154
413 3300009098 Ga0105245_10248383 Ga0105245_102483832 154
414 3300009098 Ga0105245_10701495 Ga0105245_107014952 154
415 3300009147 Ga0114129_10024517 Ga0114129_100245172 154
416 3300009147 Ga0114129_10152054 Ga0114129_101520543 154
417 3300009147 Ga0114129_10474194 Ga0114129_104741942 154
418 3300009147 Ga0114129_10609926 Ga0114129_106099262 154
419 3300009147 Ga0114129_10957890 Ga0114129_109578901 154
420 3300009147 Ga0114129_12544476 Ga0114129_125444761 154
421 3300009148 Ga0105243_10005889 Ga0105243_100058894 154
422 3300009148 Ga0105243_10069183 Ga0105243_100691833 154
423 3300009148 Ga0105243_10242109 Ga0105243_102421092 154
424 3300009148 Ga0105243_10568885 Ga0105243_105688851 154
425 3300009174 Ga0105241_10052311 Ga0105241_100523113 154
426 3300009174 Ga0105241_10227861 Ga0105241_102278612 154
427 3300009174 Ga0105241_10353005 Ga0105241_103530052 154
428 3300009174 Ga0105241_10360157 Ga0105241_103601572 154
429 3300009176 Ga0105242_10015278 Ga0105242_100152784 154
430 3300009176 Ga0105242_10221164 Ga0105242_102211643 154
431 3300009176 Ga0105242_10873093 Ga0105242_108730932 154
432 3300009176 Ga0105242_10993510 Ga0105242_109935102 154
433 3300009177 Ga0105248_10007032 Ga0105248_100070329 154
434 3300009177 Ga0105248_10014725 Ga0105248_100147253 154
435 3300009177 Ga0105248_10154679 Ga0105248_101546793 154
436 3300009177 Ga0105248_10498531 Ga0105248_104985312 154
437 3300009177 Ga0105248_12147909 Ga0105248_121479092 154
438 3300009553 Ga0105249_10078970 Ga0105249_100789703 154
439 3300009553 Ga0105249_10508924 Ga0105249_105089242 154
440 3300010375 Ga0105239_10300965 Ga0105239_103009651 154
441 3300010375 Ga0105239_10576318 Ga0105239_105763181 154
442 3300011119 Ga0105246_10024495 Ga0105246_100244953 154
443 3300011119 Ga0105246_10028532 Ga0105246_100285322 154
444 3300011119 Ga0105246_10059353 Ga0105246_100593532 154
445 3300011119 Ga0105246_11887991 Ga0105246_118879911 154
446 3300013100 Ga0157373_10022091 Ga0157373_100220914 154
447 3300013100 Ga0157373_10095880 Ga0157373_100958803 154
448 3300013100 Ga0157373_10147016 Ga0157373_101470161 154
449 3300013296 Ga0157374_10005588 Ga0157374_1000558814 154
450 3300013296 Ga0157374_10098699 Ga0157374_100986993 154
451 3300013296 Ga0157374_10425585 Ga0157374_104255851 154
452 3300013297 Ga0157378_10005669 Ga0157378_100056693 154
453 3300013297 Ga0157378_10023917 Ga0157378_100239174 154
454 3300013297 Ga0157378_10193836 Ga0157378_101938362 154
455 3300013297 Ga0157378_10409948 Ga0157378_104099482 154
456 3300013297 Ga0157378_10494911 Ga0157378_104949112 154
457 3300013306 Ga0163162_10004149 Ga0163162_100041493 154
458 3300013306 Ga0163162_10044402 Ga0163162_100444023 154
459 3300013306 Ga0163162_10557618 Ga0163162_105576182 154
460 3300013307 Ga0157372_10277294 Ga0157372_102772943 154
461 3300013307 Ga0157372_11164136 Ga0157372_111641362 154
462 3300013308 Ga0157375_10005343 Ga0157375_100053435 154
463 3300013308 Ga0157375_10022236 Ga0157375_100222364 154
464 3300013308 Ga0157375_10025748 Ga0157375_100257483 154
465 3300013308 Ga0157375_10055951 Ga0157375_100559514 154
466 3300013308 Ga0157375_10149100 Ga0157375_101491002 154
467 3300013308 Ga0157375_10176870 Ga0157375_101768703 154
468 3300014325 Ga0163163_10002626 Ga0163163_1000262619 154
469 3300014325 Ga0163163_10005344 Ga0163163_100053445 154
470 3300014325 Ga0163163_10011752 Ga0163163_1001175211 154
471 3300014325 Ga0163163_10129244 Ga0163163_101292442 154
472 3300014325 Ga0163163_10219325 Ga0163163_102193254 154
473 3300014326 Ga0157380_10006069 Ga0157380_100060693 154
474 3300014326 Ga0157380_10007967 Ga0157380_100079678 154
475 3300014326 Ga0157380_10013466 Ga0157380_100134661 154
476 3300014745 Ga0157377_10041274 Ga0157377_100412743 154
477 3300014968 Ga0157379_10220231 Ga0157379_102202312 154
478 3300014969 Ga0157376_10014116 Ga0157376_100141164 154
479 3300014969 Ga0157376_10029542 Ga0157376_100295422 154
480 3300014969 Ga0157376_10094773 Ga0157376_100947733 154
481 3300017792 Ga0163161_10141652 Ga0163161_101416522 154
482 3300025893 Ga0207682_10043244 Ga0207682_100432443 154
483 3300025899 Ga0207642_10491016 Ga0207642_104910161 154
484 3300025901 Ga0207688_10092374 Ga0207688_100923742 154
485 3300025904 Ga0207647_10449507 Ga0207647_104495071 154
486 3300025907 Ga0207645_10043706 Ga0207645_100437064 154
487 3300025908 Ga0207643_10014127 Ga0207643_100141272 154
488 3300025908 Ga0207643_10105788 Ga0207643_101057883 154
489 3300025908 Ga0207643_10371142 Ga0207643_103711422 154
490 3300025910 Ga0207684_10032408 Ga0207684_100324083 154
491 3300025911 Ga0207654_10041546 Ga0207654_100415463 154
492 3300025911 Ga0207654_10341705 Ga0207654_103417052 154
493 3300025911 Ga0207654_10440984 Ga0207654_104409841 154
494 3300025911 Ga0207654_10477300 Ga0207654_104773002 154
495 3300025912 Ga0207707_10000858 Ga0207707_100008589 154
496 3300025912 Ga0207707_10019275 Ga0207707_100192753 154
497 3300025917 Ga0207660_10000695 Ga0207660_100006955 154
498 3300025917 Ga0207660_10328690 Ga0207660_103286902 154
499 3300025918 Ga0207662_10032453 Ga0207662_100324533 154
500 3300025919 Ga0207657_10173961 Ga0207657_101739613 154
501 3300025920 Ga0207649_10803474 Ga0207649_108034741 154
502 3300025921 Ga0207652_10001260 Ga0207652_1000126020 154
503 3300025921 Ga0207652_10042576 Ga0207652_100425763 154
504 3300025921 Ga0207652_10553422 Ga0207652_105534222 154
505 3300025925 Ga0207650_10235238 Ga0207650_102352383 154
506 3300025925 Ga0207650_10288221 Ga0207650_102882212 154
507 3300025926 Ga0207659_10170590 Ga0207659_101705902 154
508 3300025926 Ga0207659_10211626 Ga0207659_102116261 154
509 3300025931 Ga0207644_10052917 Ga0207644_100529171 154
510 3300025932 Ga0207690_10011695 Ga0207690_100116953 154
511 3300025933 Ga0207706_10271719 Ga0207706_102717192 154
512 3300025934 Ga0207686_10338538 Ga0207686_103385382 154
513 3300025935 Ga0207709_10088977 Ga0207709_100889773 154
514 3300025936 Ga0207670_10362544 Ga0207670_103625441 154
515 3300025936 Ga0207670_11151790 Ga0207670_111517901 154
516 3300025938 Ga0207704_10042332 Ga0207704_100423323 154
517 3300025940 Ga0207691_10010052 Ga0207691_100100524 154
518 3300025941 Ga0207711_10001994 Ga0207711_1000199422 154
519 3300025941 Ga0207711_10019963 Ga0207711_100199634 154
520 3300025941 Ga0207711_11100952 Ga0207711_111009521 154
521 3300025942 Ga0207689_10175608 Ga0207689_101756082 154
522 3300025942 Ga0207689_10238547 Ga0207689_102385472 154
523 3300025942 Ga0207689_10537214 Ga0207689_105372142 154
524 3300025945 Ga0207679_10163447 Ga0207679_101634472 154
525 3300025945 Ga0207679_10179413 Ga0207679_101794132 154
526 3300025945 Ga0207679_10362697 Ga0207679_103626972 154
527 3300025960 Ga0207651_10111773 Ga0207651_101117732 154
528 3300025960 Ga0207651_10721153 Ga0207651_107211532 154
529 3300026023 Ga0207677_10004364 Ga0207677_100043642 154
530 3300026023 Ga0207677_10634566 Ga0207677_106345661 154
531 3300026041 Ga0207639_10168554 Ga0207639_101685541 154
532 3300026067 Ga0207678_10130683 Ga0207678_101306833 154
533 3300026075 Ga0207708_10000094 Ga0207708_1000009448 154
534 3300026075 Ga0207708_10061665 Ga0207708_100616653 154
535 3300026075 Ga0207708_10400632 Ga0207708_104006322 154
536 3300026088 Ga0207641_10062045 Ga0207641_100620453 154
537 3300026088 Ga0207641_11271486 Ga0207641_112714861 154
538 3300026088 Ga0207641_11862939 Ga0207641_118629391 154
539 3300026089 Ga0207648_10023593 Ga0207648_100235934 154
540 3300026095 Ga0207676_10011259 Ga0207676_100112595 154
541 3300026095 Ga0207676_10013489 Ga0207676_100134898 154
542 3300026095 Ga0207676_10183493 Ga0207676_101834931 154
543 3300026095 Ga0207676_10439944 Ga0207676_104399442 154
544 3300026095 Ga0207676_10452790 Ga0207676_104527902 154
545 3300026095 Ga0207676_10640926 Ga0207676_106409262 154
546 3300026116 Ga0207674_10000857 Ga0207674_1000085729 154
547 3300026116 Ga0207674_10529491 Ga0207674_105294913 154
548 3300026116 Ga0207674_10737008 Ga0207674_107370082 154
549 3300026118 Ga0207675_100017960 Ga0207675_1000179604 154
550 3300026118 Ga0207675_100085601 Ga0207675_1000856013 154
551 3300026118 Ga0207675_101737116 Ga0207675_1017371161 154
552 3300026121 Ga0207683_10148882 Ga0207683_101488822 154
553 3300026142 Ga0207698_10205346 Ga0207698_102053463 154
554 3300028379 Ga0268266_10270583 Ga0268266_102705832 154
555 3300028380 Ga0268265_10503457 Ga0268265_105034572 154
556 3300030733 Ga0314311_1228007 Ga0314311_12280071 154
557 3300031548 Ga0307408_100653726 Ga0307408_1006537262 154
558 3300031731 Ga0307405_10047268 Ga0307405_100472683 154
559 3300031824 Ga0307413_10650505 Ga0307413_106505052 154
560 3300031901 Ga0307406_11028609 Ga0307406_110286091 154
561 3300031903 Ga0307407_10442125 Ga0307407_104421252 154
562 3300031911 Ga0307412_10079658 Ga0307412_100796584 154
563 3300031995 Ga0307409_100272253 Ga0307409_1002722532 154
564 3300032002 Ga0307416_100407132 Ga0307416_1004071322 154
565 3300032002 Ga0307416_100569335 Ga0307416_1005693352 154
566 3300032004 Ga0307414_10530686 Ga0307414_105306862 154
567 3300032005 Ga0307411_10380751 Ga0307411_103807511 154
568 3300035121 Ga0373960_0035115 Ga0373960_0035115_925_1389 154
569 3300035691 Ga0373931_0376854 Ga0373931_0376854_371_835 154
570 3300036401 Ga0373937_0055844 Ga0373937_0055844_176_655 154
571 3300037466 Ga0395898_0516485 Ga0395898_0516485_446_928 154
572 3300041486 Ga0451807_2430403 Ga0451807_2430403_34_513 154
573 3300046615 Ga0495656_0115965 Ga0495656_0115965_615_1154 154
574 3300048910 Ga0496107_0332207 Ga0496107_0332207_280_744 154
575 3300049161 Ga0501305_005081 Ga0501305_005081_1072_1551 154
576 3300049521 Ga0501298_002220 Ga0501298_002220_965_1447 154
577 3300049576 Ga0501040_0212147 Ga0501040_0212147_86_562 154
578 3300049587 Ga0501071_0172168 Ga0501071_0172168_311_787 154
579 3300049591 Ga0501075_0536233 Ga0501075_0536233_296_772 154
580 3300049656 Ga0501209_116216 Ga0501209_116216_40_507 154
581 3300049660 Ga0501216_007195 Ga0501216_007195_268_750 154
582 3300049673 Ga0501240_107390 Ga0501240_107390_35_502 154
583 3300049675 Ga0501243_009923 Ga0501243_009923_40_507 154
584 3300049683 Ga0501253_052537 Ga0501253_052537_211_678 154
585 3300049686 Ga0501257_017485 Ga0501257_017485_1081_1548 154
586 3300049705 Ga0501225_0026333 Ga0501225_0026333_238_705 154
587 3300049707 Ga0501234_008249 Ga0501234_008249_917_1384 154
588 3300049743 Ga0501081_0180712 Ga0501081_0180712_150_626 154
589 3300049824 Ga0501045_0184379 Ga0501045_0184379_293_769 154
590 3300050507 nmdc:mga05p37_284688_c1 nmdc:mga05p37_284688_c1_1038_1517 154
591 3300050507 nmdc:mga05p37_453210_c1 nmdc:mga05p37_453210_c1_764_1243 154
592 3300050507 nmdc:mga05p37_723858_c1 nmdc:mga05p37_723858_c1_508_984 154
593 3300050508 nmdc:mga09592_250783_c1 nmdc:mga09592_250783_c1_432_923 154
594 3300050508 nmdc:mga09592_715682_c1 nmdc:mga09592_715682_c1_175_654 154
595 3300050509 nmdc:mga0qj67_35876_c1 nmdc:mga0qj67_35876_c1_1014_1505 154
596 3300050511 nmdc:mga08y16_82121_c1 nmdc:mga08y16_82121_c1_2677_3153 154
597 3300050512 nmdc:mga0n895_440199_c1 nmdc:mga0n895_440199_c1_146_616 154
598 3300050513 nmdc:mga0rr50_1654873_c1 nmdc:mga0rr50_1654873_c1_41_523 154
599 3300050514 nmdc:mga08x19_5744_c1 nmdc:mga08x19_5744_c1_1248_1727 154
600 3300050515 nmdc:mga0a205_21803_c1 nmdc:mga0a205_21803_c1_2854_3324 154
601 3300050515 nmdc:mga0a205_258205_c1 nmdc:mga0a205_258205_c1_743_1225 154
602 3300054114 Ga0501084_0123491 Ga0501084_0123491_885_1361 154
603 3300054114 Ga0501084_0196081 Ga0501084_0196081_900_1376 154
604 3300006852 Ga0075433_10610336 Ga0075433_106103361 157
605 3300007076 Ga0075435_100128737 Ga0075435_1001287374 157
606 3300009147 Ga0114129_10482074 Ga0114129_104820743 157
607 3300050513 nmdc:mga0rr50_198197_c1 nmdc:mga0rr50_198197_c1_298_792 157
608 3300050514 nmdc:mga08x19_964297_c1 nmdc:mga08x19_964297_c1_60_554 157
609 3300050515 nmdc:mga0a205_354473_c1 nmdc:mga0a205_354473_c1_45_539 157
610 2124908026 MRS1a_Contig_3010 MRS1a_00000470 159
611 3300005288 Ga0065714_10002186 Ga0065714_10002186125 159
612 3300005290 Ga0065712_10000113 Ga0065712_10000113125 159
613 3300005293 Ga0065715_10106753 Ga0065715_101067531 159
614 3300005467 Ga0070706_100000019 Ga0070706_10000001947 159
615 3300006914 Ga0075436_101100413 Ga0075436_1011004131 159
616 3300025910 Ga0207684_10000982 Ga0207684_100009829 159
617 3300037466 Ga0395898_0866625 Ga0395898_0866625_75_575 159
618 3300038443 Ga0395901_0160296 Ga0395901_0160296_840_1340 159
619 3300050507 nmdc:mga05p37_1293158_c1 nmdc:mga05p37_1293158_c1_75_575 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

29

156

0.88

PF08534

Redoxin

Redoxin

29

172

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b5y-assembly1.cif.gz_A solution structure of a thioredoxin-like protein in the oxidized form 0.9094 3 149
3ios-assembly1.cif.gz_A structure of mtb dsbf in its mixed oxidized and reduced forms 0.8816 31 149
5cyy-assembly2.cif.gz_C structure of the c-terminal domains of dipz from mycobacterium tuberculosis 0.8794 4 157
2b5y-assembly1.cif.gz_A solution structure of a thioredoxin-like protein in the oxidized form 0.875 3 149
7djk-assembly1.cif.gz_A structure of four truncated and mutated forms of quenching protein 0.8735 7 150
ID Description Score Start End Superfamily
2b5yA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9094 3 149 3.40.30.10
af_O06392_67_205_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8921 28 149 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8816 31 149 3.40.30.10
2b5yA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.875 3 149 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8591 28 151 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V9URZ5-F1-model_v4 Redoxin domain-containing protein 0.9918 3 149 GO:0016209
GO:0016491
AF-A0A6L4ZIU7-F1-model_v4 Thiol-disulfide isomerase / thioredoxin 0.9911 3 149 GO:0016209
GO:0016491
GO:0016853
AF-A0A2V8QV26-F1-model_v4 Thiol-disulfide oxidoreductase 0.9796 3 149 GO:0016209
GO:0016491
AF-A0A4R8LPX3-F1-model_v4 AhpC/TSA family protein 0.9709 1 149 GO:0016209
GO:0016491
AF-G2LDE0-F1-model_v4 Thiol-disulfide isomerase / thioredoxin 0.9596 3 149 GO:0016209
GO:0016491
GO:0016853

Feature Viewer

pLDDT pTM Quality
91.98 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map