F469791
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 619 | 321 | 592 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300004625|Ga0055543_1010658|Ga0055543_10106582 |
| Length | 231 |
| Sequence | VVTKAKPPKAKPRPKASSFLAGVDVLIIAGLGNPGPTYAKNRHNIGFMAVDEIARRWGFSAARSRFQAHASEGQIDTPQGPVRALILKPQGYYNESGRAVGEAVKFFKLDPAVDVVVFYDEIDLAPGRFRMKAGGGAAGNNGVRSITSQIGPHFRRARLGTGHPGDKALVQGHVLSDFHKADMKWVEPLLQACADAAPLMAMGEDEKYQAEVMRLAPAEKMDPRKLARGES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 9 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 10 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 11 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 12 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 13 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 14 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 15 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 16 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 17 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 18 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 19 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 20 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 21 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 22 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 23 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 24 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 25 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 26 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 27 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 28 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 29 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 105 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 168 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 195 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 278 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 283 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 284 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 285 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 287 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 288 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 289 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 290 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 291 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 293 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 294 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 295 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 296 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 298 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 299 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 300 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 301 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 302 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 304 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 306 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 308 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 309 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 310 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 312 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 314 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 315 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 317 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 319 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.64 |
| Metatranscriptomes | 0 |
| Isolates | 4.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.55 |
| Nodule | 0.16 |
| Rhizoplane | 3.07 |
| Rhizosphere | 67.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10034807 | 3300003215 | Bacteria | 1640 |
| 2 | rootL2_10025033 | 3300003322 | Bacteria | 2340 |
| 3 | rootL2_10025042 | 3300003322 | Bacteria | 2508 |
| 4 | Ga0055526_1024695 | 3300003771 | Bacteria | 1956 |
| 5 | Ga0055537_1004521 | 3300003773 | Bacteria | 3963 |
| 6 | Ga0055536_1003050 | 3300003781 | Bacteria | 9147 |
| 7 | Ga0055536_1005222 | 3300003781 | Bacteria | 6407 |
| 8 | Ga0055530_10003497 | 3300003791 | Bacteria | 8887 |
| 9 | Ga0055530_10004335 | 3300003791 | Bacteria | 7380 |
| 10 | Ga0055530_10008601 | 3300003791 | Bacteria | 4056 |
| 11 | Ga0055530_10010190 | 3300003791 | Bacteria | 3505 |
| 12 | Ga0055531_10001668 | 3300003794 | Bacteria | 15997 |
| 13 | Ga0055531_10007738 | 3300003794 | Bacteria | 5796 |
| 14 | Ga0055531_10038847 | 3300003794 | Bacteria | 1422 |
| 15 | Ga0055543_1010658 | 3300004625 | Bacteria | 1916 |
| 16 | Ga0065165_1001299 | 3300005262 | Bacteria | 28025 |
| 17 | Ga0065165_1007831 | 3300005262 | Bacteria | 5141 |
| 18 | Ga0070658_10072508 | 3300005327 | Bacteria | 2822 |
| 19 | Ga0070658_10148497 | 3300005327 | Bacteria | 1961 |
| 20 | Ga0070658_10242699 | 3300005327 | Bacteria | 1527 |
| 21 | Ga0070658_10438400 | 3300005327 | Bacteria | 1125 |
| 22 | Ga0070683_100781758 | 3300005329 | Bacteria | 915 |
| 23 | Ga0070670_100000035 | 3300005331 | Bacteria | 157570 |
| 24 | Ga0070670_100111338 | 3300005331 | Bacteria | 2359 |
| 25 | Ga0068869_100503124 | 3300005334 | Bacteria | 1012 |
| 26 | Ga0070666_10057189 | 3300005335 | Bacteria | 2635 |
| 27 | Ga0070680_100081752 | 3300005336 | Bacteria | 2665 |
| 28 | Ga0070660_100121721 | 3300005339 | Bacteria | 2083 |
| 29 | Ga0070660_100246720 | 3300005339 | Bacteria | 1455 |
| 30 | Ga0070660_100414739 | 3300005339 | Bacteria | 1114 |
| 31 | Ga0070691_10005691 | 3300005341 | Bacteria | 5684 |
| 32 | Ga0070661_100104125 | 3300005344 | Bacteria | 2114 |
| 33 | Ga0070668_100001655 | 3300005347 | Bacteria | 16171 |
| 34 | Ga0070668_100003652 | 3300005347 | Bacteria | 11349 |
| 35 | Ga0070668_100005042 | 3300005347 | Bacteria | 9783 |
| 36 | Ga0070668_100008290 | 3300005347 | Bacteria | 7713 |
| 37 | Ga0070668_100062568 | 3300005347 | Bacteria | 2884 |
| 38 | Ga0070669_100014476 | 3300005353 | Bacteria | 5613 |
| 39 | Ga0070671_100008156 | 3300005355 | Bacteria | 8385 |
| 40 | Ga0070671_100044283 | 3300005355 | Bacteria | 3698 |
| 41 | Ga0070671_100140031 | 3300005355 | Bacteria | 2041 |
| 42 | Ga0070673_100114753 | 3300005364 | Bacteria | 2239 |
| 43 | Ga0070659_100002173 | 3300005366 | Bacteria | 13970 |
| 44 | Ga0070659_100009683 | 3300005366 | Bacteria | 7081 |
| 45 | Ga0070667_100000711 | 3300005367 | Bacteria | 32094 |
| 46 | Ga0070667_100012351 | 3300005367 | Bacteria | 7064 |
| 47 | Ga0070667_100035524 | 3300005367 | Bacteria | 4176 |
| 48 | Ga0070667_100817038 | 3300005367 | Bacteria | 866 |
| 49 | Ga0070713_100729594 | 3300005436 | Bacteria | 947 |
| 50 | Ga0070663_100286146 | 3300005455 | Bacteria | 1315 |
| 51 | Ga0070663_100570848 | 3300005455 | Bacteria | 948 |
| 52 | Ga0070662_100381076 | 3300005457 | Bacteria | 1161 |
| 53 | Ga0070681_10061903 | 3300005458 | Bacteria | 3716 |
| 54 | Ga0070679_100014981 | 3300005530 | Bacteria | 7449 |
| 55 | Ga0070679_100273069 | 3300005530 | Bacteria | 1644 |
| 56 | Ga0068853_100038269 | 3300005539 | Bacteria | 4085 |
| 57 | Ga0068853_100406572 | 3300005539 | Bacteria | 1275 |
| 58 | Ga0070665_100000433 | 3300005548 | Bacteria | 60988 |
| 59 | Ga0070665_100002042 | 3300005548 | Bacteria | 22721 |
| 60 | Ga0070665_100002102 | 3300005548 | Bacteria | 22306 |
| 61 | Ga0070665_100066800 | 3300005548 | Bacteria | 3607 |
| 62 | Ga0070665_100230031 | 3300005548 | Bacteria | 1854 |
| 63 | Ga0068855_100045250 | 3300005563 | Bacteria | 5205 |
| 64 | Ga0068855_100118233 | 3300005563 | Bacteria | 3036 |
| 65 | Ga0068855_100166242 | 3300005563 | Bacteria | 2500 |
| 66 | Ga0070664_100150398 | 3300005564 | Bacteria | 2055 |
| 67 | Ga0070664_100256593 | 3300005564 | Bacteria | 1572 |
| 68 | Ga0068857_100331549 | 3300005577 | Bacteria | 1406 |
| 69 | Ga0068854_100463315 | 3300005578 | Bacteria | 1061 |
| 70 | Ga0068856_100060825 | 3300005614 | Bacteria | 3731 |
| 71 | Ga0068856_100183347 | 3300005614 | Bacteria | 2107 |
| 72 | Ga0068856_100202083 | 3300005614 | Bacteria | 2002 |
| 73 | Ga0068856_100248032 | 3300005614 | Bacteria | 1796 |
| 74 | Ga0070702_100282566 | 3300005615 | Bacteria | 1140 |
| 75 | Ga0068852_100096346 | 3300005616 | Bacteria | 2659 |
| 76 | Ga0068852_100655154 | 3300005616 | Bacteria | 1058 |
| 77 | Ga0068859_100563028 | 3300005617 | Bacteria | 1234 |
| 78 | Ga0068859_100579944 | 3300005617 | Bacteria | 1215 |
| 79 | Ga0068859_100936731 | 3300005617 | Bacteria | 950 |
| 80 | Ga0068864_100000102 | 3300005618 | Bacteria | 82743 |
| 81 | Ga0068864_100000165 | 3300005618 | Bacteria | 60874 |
| 82 | Ga0068864_100007387 | 3300005618 | Bacteria | 9045 |
| 83 | Ga0068864_100061222 | 3300005618 | Bacteria | 3260 |
| 84 | Ga0068864_100356324 | 3300005618 | Bacteria | 1382 |
| 85 | Ga0068864_100448911 | 3300005618 | Bacteria | 1233 |
| 86 | Ga0068861_100233239 | 3300005719 | Bacteria | 1562 |
| 87 | Ga0068863_100000128 | 3300005841 | Bacteria | 79841 |
| 88 | Ga0068863_100000958 | 3300005841 | Bacteria | 28976 |
| 89 | Ga0068863_100003725 | 3300005841 | Bacteria | 15079 |
| 90 | Ga0068863_100075883 | 3300005841 | Bacteria | 3180 |
| 91 | Ga0068863_100291190 | 3300005841 | Bacteria | 1583 |
| 92 | Ga0068858_100000117 | 3300005842 | Bacteria | 83778 |
| 93 | Ga0068858_100008401 | 3300005842 | Bacteria | 9931 |
| 94 | Ga0068858_100049265 | 3300005842 | Bacteria | 3901 |
| 95 | Ga0068858_100130572 | 3300005842 | Bacteria | 2355 |
| 96 | Ga0068858_100193698 | 3300005842 | Bacteria | 1921 |
| 97 | Ga0068858_100351911 | 3300005842 | Bacteria | 1411 |
| 98 | Ga0068860_100000100 | 3300005843 | Bacteria | 144580 |
| 99 | Ga0068860_100000157 | 3300005843 | Bacteria | 110717 |
| 100 | Ga0068860_100057712 | 3300005843 | Bacteria | 3690 |
| 101 | Ga0068862_100000368 | 3300005844 | Bacteria | 48907 |
| 102 | Ga0068862_100003705 | 3300005844 | Bacteria | 13061 |
| 103 | Ga0068862_100008375 | 3300005844 | Bacteria | 8558 |
| 104 | Ga0068862_100026735 | 3300005844 | Bacteria | 4852 |
| 105 | Ga0068862_100041760 | 3300005844 | Bacteria | 3904 |
| 106 | Ga0081455_10069249 | 3300005937 | Bacteria | 2934 |
| 107 | Ga0081455_10197529 | 3300005937 | Bacteria | 1509 |
| 108 | Ga0070717_10048558 | 3300006028 | Bacteria | 3481 |
| 109 | Ga0075368_10011124 | 3300006042 | Bacteria | 3269 |
| 110 | Ga0075363_100473288 | 3300006048 | Bacteria | 742 |
| 111 | Ga0075364_10003750 | 3300006051 | Bacteria | 8680 |
| 112 | Ga0075362_10017023 | 3300006177 | Bacteria | 2988 |
| 113 | Ga0075367_10033916 | 3300006178 | Bacteria | 2945 |
| 114 | Ga0075369_10008852 | 3300006186 | Bacteria | 3889 |
| 115 | Ga0075366_10016922 | 3300006195 | Bacteria | 4190 |
| 116 | Ga0075370_10025887 | 3300006353 | Bacteria | 3247 |
| 117 | Ga0075370_10037819 | 3300006353 | Bacteria | 2714 |
| 118 | Ga0075370_10241546 | 3300006353 | Bacteria | 1069 |
| 119 | Ga0068865_100021928 | 3300006881 | Bacteria | 4159 |
| 120 | Ga0068865_100450493 | 3300006881 | Bacteria | 1064 |
| 121 | Ga0097620_100562930 | 3300006931 | Bacteria | 1234 |
| 122 | Ga0097620_100579944 | 3300006931 | Bacteria | 1215 |
| 123 | Ga0097620_100936931 | 3300006931 | Bacteria | 950 |
| 124 | Ga0079104_1021617 | 3300006946 | Bacteria | 1748 |
| 125 | Ga0105250_10018847 | 3300009092 | Bacteria | 2792 |
| 126 | Ga0105240_10002229 | 3300009093 | Bacteria | 31523 |
| 127 | Ga0105240_10010678 | 3300009093 | Bacteria | 12886 |
| 128 | Ga0105240_10089734 | 3300009093 | Bacteria | 3759 |
| 129 | Ga0105240_10097510 | 3300009093 | Bacteria | 3582 |
| 130 | Ga0105240_10219630 | 3300009093 | Bacteria | 2215 |
| 131 | Ga0105240_10251893 | 3300009093 | Bacteria | 2042 |
| 132 | Ga0105240_10553010 | 3300009093 | Bacteria | 1273 |
| 133 | Ga0105240_10941530 | 3300009093 | Bacteria | 927 |
| 134 | Ga0105248_10000280 | 3300009177 | Bacteria | 60247 |
| 135 | Ga0105248_10005436 | 3300009177 | Bacteria | 14002 |
| 136 | Ga0105248_10049590 | 3300009177 | Bacteria | 4709 |
| 137 | Ga0105248_10059152 | 3300009177 | Bacteria | 4304 |
| 138 | Ga0105248_10064503 | 3300009177 | Bacteria | 4112 |
| 139 | Ga0105248_10765278 | 3300009177 | Bacteria | 1090 |
| 140 | Ga0105237_10272735 | 3300009545 | Bacteria | 1694 |
| 141 | Ga0105238_10022800 | 3300009551 | Bacteria | 6381 |
| 142 | Ga0105238_10113045 | 3300009551 | Bacteria | 2695 |
| 143 | Ga0105238_10126384 | 3300009551 | Bacteria | 2535 |
| 144 | Ga0105238_10207720 | 3300009551 | Bacteria | 1934 |
| 145 | Ga0105238_10334368 | 3300009551 | Bacteria | 1502 |
| 146 | Ga0105238_10675125 | 3300009551 | Bacteria | 1044 |
| 147 | Ga0105249_10000525 | 3300009553 | Bacteria | 35250 |
| 148 | Ga0105249_10224004 | 3300009553 | Bacteria | 1852 |
| 149 | Ga0105239_10725713 | 3300010375 | Bacteria | 1137 |
| 150 | Ga0157373_10001320 | 3300013100 | Bacteria | 18973 |
| 151 | Ga0157373_10012399 | 3300013100 | Bacteria | 6268 |
| 152 | Ga0157373_10124774 | 3300013100 | Bacteria | 1810 |
| 153 | Ga0157370_10190336 | 3300013104 | Bacteria | 1905 |
| 154 | Ga0157369_10350357 | 3300013105 | Bacteria | 1533 |
| 155 | Ga0157369_11026376 | 3300013105 | Bacteria | 844 |
| 156 | Ga0163162_10082033 | 3300013306 | Bacteria | 3296 |
| 157 | Ga0163162_10704543 | 3300013306 | Bacteria | 1131 |
| 158 | Ga0157372_11118425 | 3300013307 | Bacteria | 911 |
| 159 | Ga0157375_10066003 | 3300013308 | Bacteria | 3610 |
| 160 | Ga0157375_11171804 | 3300013308 | Bacteria | 901 |
| 161 | Ga0163163_10003142 | 3300014325 | Bacteria | 14001 |
| 162 | Ga0163163_10223875 | 3300014325 | Bacteria | 1930 |
| 163 | Ga0163163_10920367 | 3300014325 | Bacteria | 938 |
| 164 | Ga0163163_11081688 | 3300014325 | Bacteria | 865 |
| 165 | Ga0157380_10282640 | 3300014326 | Bacteria | 1519 |
| 166 | Ga0157379_10003132 | 3300014968 | Bacteria | 13995 |
| 167 | Ga0157379_10108966 | 3300014968 | Bacteria | 2487 |
| 168 | Ga0157379_10173970 | 3300014968 | Bacteria | 1944 |
| 169 | Ga0157376_10465622 | 3300014969 | Bacteria | 1236 |
| 170 | Ga0182007_10014986 | 3300015262 | Bacteria | 2906 |
| 171 | Ga0213872_10047077 | 3300021361 | Bacteria | 1961 |
| 172 | Ga0213874_10001579 | 3300021377 | Bacteria | 4765 |
| 173 | Ga0213876_10000276 | 3300021384 | Bacteria | 47195 |
| 174 | Ga0213876_10306173 | 3300021384 | Bacteria | 845 |
| 175 | Ga0213875_10055927 | 3300021388 | Bacteria | 1848 |
| 176 | Ga0213875_10256736 | 3300021388 | Bacteria | 825 |
| 177 | Ga0209026_1007030 | 3300025250 | Bacteria | 2621 |
| 178 | Ga0209026_1028809 | 3300025250 | Bacteria | 829 |
| 179 | Ga0209148_1008212 | 3300025254 | Bacteria | 2110 |
| 180 | Ga0209148_1009749 | 3300025254 | Bacteria | 1853 |
| 181 | Ga0209565_1000402 | 3300025263 | Bacteria | 36267 |
| 182 | Ga0209673_1000956 | 3300025273 | Bacteria | 36077 |
| 183 | Ga0209673_1015564 | 3300025273 | Bacteria | 2882 |
| 184 | Ga0209675_1010683 | 3300025291 | Bacteria | 3112 |
| 185 | Ga0209676_1000467 | 3300025292 | Bacteria | 67659 |
| 186 | Ga0209676_1000560 | 3300025292 | Bacteria | 56233 |
| 187 | Ga0209564_1009991 | 3300025295 | Bacteria | 4433 |
| 188 | Ga0209564_1032821 | 3300025295 | Bacteria | 1555 |
| 189 | Ga0209564_1045539 | 3300025295 | Bacteria | 1127 |
| 190 | Ga0209758_1000331 | 3300025297 | Bacteria | 88922 |
| 191 | Ga0209758_1002021 | 3300025297 | Bacteria | 21830 |
| 192 | Ga0209758_1002093 | 3300025297 | Bacteria | 21212 |
| 193 | Ga0209050_1000130 | 3300025298 | Bacteria | 186070 |
| 194 | Ga0209050_1000461 | 3300025298 | Bacteria | 72912 |
| 195 | Ga0209050_1001568 | 3300025298 | Bacteria | 23778 |
| 196 | Ga0209256_1001940 | 3300025299 | Bacteria | 18855 |
| 197 | Ga0209256_1008763 | 3300025299 | Bacteria | 4606 |
| 198 | Ga0209256_1016311 | 3300025299 | Bacteria | 2540 |
| 199 | Ga0209256_1040058 | 3300025299 | Bacteria | 1200 |
| 200 | Ga0209051_1024035 | 3300025303 | Bacteria | 2519 |
| 201 | Ga0209257_1000059 | 3300025304 | Bacteria | 378097 |
| 202 | Ga0209257_1000186 | 3300025304 | Bacteria | 154365 |
| 203 | Ga0209257_1000406 | 3300025304 | Bacteria | 83846 |
| 204 | Ga0209257_1001256 | 3300025304 | Bacteria | 31336 |
| 205 | Ga0209257_1006979 | 3300025304 | Bacteria | 7030 |
| 206 | Ga0207680_10022747 | 3300025903 | Bacteria | 3413 |
| 207 | Ga0207680_10077277 | 3300025903 | Bacteria | 2082 |
| 208 | Ga0207680_10524106 | 3300025903 | Bacteria | 845 |
| 209 | Ga0207705_10000859 | 3300025909 | Bacteria | 24922 |
| 210 | Ga0207705_10141061 | 3300025909 | Bacteria | 1800 |
| 211 | Ga0207707_10025232 | 3300025912 | Bacteria | 5199 |
| 212 | Ga0207707_10026000 | 3300025912 | Bacteria | 5119 |
| 213 | Ga0207707_10044838 | 3300025912 | Bacteria | 3854 |
| 214 | Ga0207695_10001222 | 3300025913 | Bacteria | 44042 |
| 215 | Ga0207695_10004245 | 3300025913 | Bacteria | 19683 |
| 216 | Ga0207695_10017891 | 3300025913 | Bacteria | 8212 |
| 217 | Ga0207695_10031617 | 3300025913 | Bacteria | 5802 |
| 218 | Ga0207695_10127102 | 3300025913 | Bacteria | 2510 |
| 219 | Ga0207671_10385287 | 3300025914 | Bacteria | 1114 |
| 220 | Ga0207671_10601324 | 3300025914 | Bacteria | 876 |
| 221 | Ga0207660_10012963 | 3300025917 | Bacteria | 5461 |
| 222 | Ga0207660_10069444 | 3300025917 | Bacteria | 2558 |
| 223 | Ga0207662_10300347 | 3300025918 | Bacteria | 1067 |
| 224 | Ga0207657_10005498 | 3300025919 | Bacteria | 13230 |
| 225 | Ga0207657_10101743 | 3300025919 | Bacteria | 2384 |
| 226 | Ga0207657_10582931 | 3300025919 | Bacteria | 873 |
| 227 | Ga0207657_10609865 | 3300025919 | Bacteria | 851 |
| 228 | Ga0207649_10259001 | 3300025920 | Bacteria | 1256 |
| 229 | Ga0207652_10009199 | 3300025921 | Bacteria | 7952 |
| 230 | Ga0207652_10036965 | 3300025921 | Bacteria | 4131 |
| 231 | Ga0207652_10411271 | 3300025921 | Bacteria | 1220 |
| 232 | Ga0207681_10190318 | 3300025923 | Bacteria | 1569 |
| 233 | Ga0207694_10007116 | 3300025924 | Bacteria | 8500 |
| 234 | Ga0207694_10085746 | 3300025924 | Bacteria | 2479 |
| 235 | Ga0207694_10096466 | 3300025924 | Bacteria | 2338 |
| 236 | Ga0207694_10367296 | 3300025924 | Bacteria | 1193 |
| 237 | Ga0207650_10000327 | 3300025925 | Bacteria | 46298 |
| 238 | Ga0207650_10643808 | 3300025925 | Bacteria | 893 |
| 239 | Ga0207644_10019082 | 3300025931 | Bacteria | 4648 |
| 240 | Ga0207644_10098234 | 3300025931 | Bacteria | 2194 |
| 241 | Ga0207644_10347652 | 3300025931 | Bacteria | 1203 |
| 242 | Ga0207690_10000159 | 3300025932 | Bacteria | 52852 |
| 243 | Ga0207690_10015653 | 3300025932 | Bacteria | 4601 |
| 244 | Ga0207706_10065814 | 3300025933 | Bacteria | 3190 |
| 245 | Ga0207704_10002381 | 3300025938 | Bacteria | 8448 |
| 246 | Ga0207704_10272173 | 3300025938 | Bacteria | 1283 |
| 247 | Ga0207711_10003708 | 3300025941 | Bacteria | 13166 |
| 248 | Ga0207711_10007949 | 3300025941 | Bacteria | 8872 |
| 249 | Ga0207711_10011616 | 3300025941 | Bacteria | 7317 |
| 250 | Ga0207711_10081654 | 3300025941 | Bacteria | 2825 |
| 251 | Ga0207711_10098929 | 3300025941 | Bacteria | 2578 |
| 252 | Ga0207711_10258633 | 3300025941 | Bacteria | 1599 |
| 253 | Ga0207689_10376150 | 3300025942 | Bacteria | 1182 |
| 254 | Ga0207661_10306521 | 3300025944 | Bacteria | 1425 |
| 255 | Ga0207679_10128111 | 3300025945 | Bacteria | 2032 |
| 256 | Ga0207667_10020112 | 3300025949 | Bacteria | 7433 |
| 257 | Ga0207667_10026359 | 3300025949 | Bacteria | 6352 |
| 258 | Ga0207667_10189088 | 3300025949 | Bacteria | 2113 |
| 259 | Ga0207712_10192593 | 3300025961 | Bacteria | 1610 |
| 260 | Ga0207668_10000025 | 3300025972 | Bacteria | 131733 |
| 261 | Ga0207668_10001450 | 3300025972 | Bacteria | 13923 |
| 262 | Ga0207668_10102183 | 3300025972 | Bacteria | 2132 |
| 263 | Ga0207658_10000300 | 3300025986 | Bacteria | 51413 |
| 264 | Ga0207658_10003134 | 3300025986 | Bacteria | 11830 |
| 265 | Ga0207658_10013264 | 3300025986 | Bacteria | 5628 |
| 266 | Ga0207658_10086967 | 3300025986 | Bacteria | 2412 |
| 267 | Ga0207677_10502724 | 3300026023 | Bacteria | 1048 |
| 268 | Ga0207703_10002585 | 3300026035 | Bacteria | 15635 |
| 269 | Ga0207703_10006338 | 3300026035 | Bacteria | 9455 |
| 270 | Ga0207639_10014523 | 3300026041 | Bacteria | 5542 |
| 271 | Ga0207639_10152840 | 3300026041 | Bacteria | 1935 |
| 272 | Ga0207678_10261526 | 3300026067 | Bacteria | 1483 |
| 273 | Ga0207702_10446397 | 3300026078 | Bacteria | 1254 |
| 274 | Ga0207641_10000005 | 3300026088 | Bacteria | 470841 |
| 275 | Ga0207641_10000777 | 3300026088 | Bacteria | 34097 |
| 276 | Ga0207641_10000994 | 3300026088 | Bacteria | 29003 |
| 277 | Ga0207641_10068771 | 3300026088 | Bacteria | 3037 |
| 278 | Ga0207641_10223451 | 3300026088 | Bacteria | 1747 |
| 279 | Ga0207641_10294648 | 3300026088 | Bacteria | 1530 |
| 280 | Ga0207641_10456053 | 3300026088 | Bacteria | 1236 |
| 281 | Ga0207676_10000066 | 3300026095 | Bacteria | 105425 |
| 282 | Ga0207676_10000145 | 3300026095 | Bacteria | 61785 |
| 283 | Ga0207676_10004781 | 3300026095 | Bacteria | 9608 |
| 284 | Ga0207676_10044856 | 3300026095 | Bacteria | 3413 |
| 285 | Ga0207676_10093677 | 3300026095 | Bacteria | 2473 |
| 286 | Ga0207674_10146840 | 3300026116 | Bacteria | 2317 |
| 287 | Ga0207674_10203578 | 3300026116 | Bacteria | 1929 |
| 288 | Ga0207675_100170229 | 3300026118 | Bacteria | 2082 |
| 289 | Ga0207675_100227004 | 3300026118 | Bacteria | 1800 |
| 290 | Ga0207675_100497806 | 3300026118 | Bacteria | 1213 |
| 291 | Ga0207675_100733425 | 3300026118 | Bacteria | 998 |
| 292 | Ga0209981_1000259 | 3300027378 | Bacteria | 6787 |
| 293 | Ga0209995_1037821 | 3300027471 | Bacteria | 813 |
| 294 | Ga0209983_1011978 | 3300027665 | Bacteria | 1777 |
| 295 | Ga0209813_10068370 | 3300027866 | Bacteria | 1150 |
| 296 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 297 | Ga0268266_10000814 | 3300028379 | Bacteria | 41101 |
| 298 | Ga0268266_10000815 | 3300028379 | Bacteria | 40979 |
| 299 | Ga0268266_10372963 | 3300028379 | Bacteria | 1344 |
| 300 | Ga0268265_10000532 | 3300028380 | Bacteria | 38863 |
| 301 | Ga0268265_10007428 | 3300028380 | Bacteria | 7399 |
| 302 | Ga0268265_10013139 | 3300028380 | Bacteria | 5625 |
| 303 | Ga0268265_10014390 | 3300028380 | Bacteria | 5389 |
| 304 | Ga0268265_10171432 | 3300028380 | Bacteria | 1855 |
| 305 | Ga0268265_10243183 | 3300028380 | Bacteria | 1589 |
| 306 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 307 | Ga0268264_10000211 | 3300028381 | Bacteria | 117108 |
| 308 | Ga0268264_10085306 | 3300028381 | Bacteria | 2710 |
| 309 | Ga0268264_10417545 | 3300028381 | Bacteria | 1293 |
| 310 | Ga0265337_1023161 | 3300028556 | Bacteria | 1913 |
| 311 | Ga0265326_10016968 | 3300028558 | Bacteria | 2103 |
| 312 | Ga0265334_10072210 | 3300028573 | Bacteria | 1284 |
| 313 | Ga0307517_10002267 | 3300028786 | Bacteria | 31005 |
| 314 | Ga0307517_10072546 | 3300028786 | Bacteria | 3067 |
| 315 | Ga0307515_10015777 | 3300028794 | Bacteria | 13898 |
| 316 | Ga0307515_10016786 | 3300028794 | Bacteria | 13388 |
| 317 | Ga0265338_10005275 | 3300028800 | Bacteria | 16925 |
| 318 | Ga0265338_10009016 | 3300028800 | Bacteria | 12001 |
| 319 | Ga0265338_10052890 | 3300028800 | Bacteria | 3639 |
| 320 | Ga0265338_10170717 | 3300028800 | Bacteria | 1668 |
| 321 | Ga0265338_10380583 | 3300028800 | Bacteria | 1009 |
| 322 | Ga0307511_10044683 | 3300030521 | Bacteria | 3675 |
| 323 | Ga0307512_10295428 | 3300030522 | Bacteria | 760 |
| 324 | Ga0265340_10038859 | 3300031247 | Bacteria | 2352 |
| 325 | Ga0265331_10197635 | 3300031250 | Bacteria | 906 |
| 326 | Ga0265327_10001631 | 3300031251 | Bacteria | 27036 |
| 327 | Ga0265327_10002802 | 3300031251 | Bacteria | 17599 |
| 328 | Ga0265327_10017632 | 3300031251 | Bacteria | 4467 |
| 329 | Ga0307513_10000053 | 3300031456 | Bacteria | 149356 |
| 330 | Ga0307513_10000790 | 3300031456 | Bacteria | 45976 |
| 331 | Ga0307513_10004139 | 3300031456 | Bacteria | 19425 |
| 332 | Ga0307513_10008435 | 3300031456 | Bacteria | 13193 |
| 333 | Ga0265314_10107420 | 3300031711 | Bacteria | 1781 |
| 334 | Ga0265314_10132382 | 3300031711 | Bacteria | 1554 |
| 335 | Ga0307516_10000019 | 3300031730 | Bacteria | 196679 |
| 336 | Ga0307410_10037010 | 3300031852 | Bacteria | 3184 |
| 337 | Ga0307406_10685984 | 3300031901 | Bacteria | 854 |
| 338 | Ga0307407_10110006 | 3300031903 | Bacteria | 1728 |
| 339 | Ga0307412_10206480 | 3300031911 | Bacteria | 1496 |
| 340 | Ga0307412_10632104 | 3300031911 | Bacteria | 911 |
| 341 | Ga0307416_100546811 | 3300032002 | Bacteria | 1231 |
| 342 | Ga0307414_10103708 | 3300032004 | Bacteria | 2146 |
| 343 | Ga0307510_10047498 | 3300033180 | Bacteria | 4598 |
| 344 | Ga0307510_10174377 | 3300033180 | Bacteria | 1724 |
| 345 | Ga0373936_0034195 | 3300035113 | Bacteria | 2018 |
| 346 | Ga0373935_0118334 | 3300035692 | Bacteria | 1767 |
| 347 | Ga0373927_0003786 | 3300035695 | Bacteria | 10732 |
| 348 | Ga0373933_0332946 | 3300035724 | Bacteria | 985 |
| 349 | Ga0373933_0485269 | 3300035724 | Bacteria | 809 |
| 350 | Ga0373925_0004623 | 3300037068 | Bacteria | 10393 |
| 351 | Ga0395899_0000016 | 3300037312 | Bacteria | 468322 |
| 352 | Ga0395899_0000373 | 3300037312 | Bacteria | 53717 |
| 353 | Ga0395899_0217152 | 3300037312 | Bacteria | 1326 |
| 354 | Ga0395899_0240661 | 3300037312 | Bacteria | 1246 |
| 355 | Ga0395900_0000052 | 3300037418 | Bacteria | 223910 |
| 356 | Ga0395900_0031072 | 3300037418 | Bacteria | 5486 |
| 357 | Ga0395900_0210642 | 3300037418 | Bacteria | 1962 |
| 358 | Ga0395900_0287498 | 3300037418 | Bacteria | 1634 |
| 359 | Ga0395900_0558856 | 3300037418 | Bacteria | 1088 |
| 360 | Ga0395898_0003873 | 3300037466 | Bacteria | 16525 |
| 361 | Ga0395898_0006482 | 3300037466 | Bacteria | 12499 |
| 362 | Ga0395898_0272676 | 3300037466 | Bacteria | 1614 |
| 363 | Ga0395905_0092295 | 3300037471 | Bacteria | 2839 |
| 364 | Ga0395905_0101606 | 3300037471 | Bacteria | 2699 |
| 365 | Ga0395905_0133213 | 3300037471 | Bacteria | 2337 |
| 366 | Ga0395905_0299461 | 3300037471 | Bacteria | 1495 |
| 367 | Ga0395905_0536042 | 3300037471 | Bacteria | 1071 |
| 368 | Ga0436364_0089346 | 3300037853 | Bacteria | 1551 |
| 369 | Ga0436364_0548564 | 3300037853 | Bacteria | 2193 |
| 370 | Ga0436364_1092164 | 3300037853 | Bacteria | 2491 |
| 371 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 372 | Ga0395901_0168174 | 3300038443 | Bacteria | 2301 |
| 373 | Ga0436365_0608786 | 3300039437 | Bacteria | 20013 |
| 374 | Ga0436365_0738680 | 3300039437 | Bacteria | 1236 |
| 375 | Ga0436365_1407991 | 3300039437 | Bacteria | 749 |
| 376 | Ga0436365_1899948 | 3300039437 | Bacteria | 1505 |
| 377 | Ga0436360_1186917 | 3300039438 | Bacteria | 2618 |
| 378 | Ga0436360_1366790 | 3300039438 | Bacteria | 1384 |
| 379 | Ga0436361_0293275 | 3300039447 | Bacteria | 4781 |
| 380 | Ga0436361_0587620 | 3300039447 | Bacteria | 1562 |
| 381 | Ga0436361_0709707 | 3300039447 | Bacteria | 2552 |
| 382 | Ga0436361_0851335 | 3300039447 | Bacteria | 858 |
| 383 | Ga0436361_1100879 | 3300039447 | Bacteria | 23663 |
| 384 | Ga0436363_0545590 | 3300039450 | Bacteria | 1750 |
| 385 | Ga0436363_1321778 | 3300039450 | Bacteria | 5821 |
| 386 | Ga0439446_0013609 | 3300042156 | Bacteria | 2235 |
| 387 | Ga0466969_0172954 | 3300044656 | Bacteria | 990 |
| 388 | Ga0466966_0150141 | 3300044684 | Bacteria | 1422 |
| 389 | Ga0466957_0082183 | 3300044842 | Bacteria | 2008 |
| 390 | Ga0466957_0559211 | 3300044842 | Bacteria | 798 |
| 391 | Ga0495617_074868 | 3300046452 | Bacteria | 1111 |
| 392 | Ga0495627_003153 | 3300046453 | Bacteria | 7442 |
| 393 | Ga0495590_0000589 | 3300046457 | Bacteria | 17176 |
| 394 | Ga0495629_0254460 | 3300046459 | Bacteria | 1208 |
| 395 | Ga0495638_0001119 | 3300046460 | Bacteria | 26080 |
| 396 | Ga0495638_0007475 | 3300046460 | Bacteria | 7830 |
| 397 | Ga0495638_0049281 | 3300046460 | Bacteria | 2633 |
| 398 | Ga0495638_0061418 | 3300046460 | Bacteria | 2322 |
| 399 | Ga0495638_0162967 | 3300046460 | Bacteria | 1285 |
| 400 | Ga0495650_0000403 | 3300046471 | Bacteria | 71792 |
| 401 | Ga0495585_0071232 | 3300046492 | Bacteria | 1895 |
| 402 | Ga0495607_0033413 | 3300046501 | Bacteria | 3130 |
| 403 | Ga0495583_0000005 | 3300046506 | Bacteria | 636894 |
| 404 | Ga0495583_0021172 | 3300046506 | Bacteria | 3350 |
| 405 | Ga0495583_0066187 | 3300046506 | Bacteria | 1599 |
| 406 | Ga0495606_0003858 | 3300046507 | Bacteria | 15477 |
| 407 | Ga0495610_0002475 | 3300046512 | Bacteria | 15486 |
| 408 | Ga0495610_0004772 | 3300046512 | Bacteria | 9888 |
| 409 | Ga0495610_0034131 | 3300046512 | Bacteria | 2623 |
| 410 | Ga0495610_0056599 | 3300046512 | Bacteria | 1885 |
| 411 | Ga0495616_0000172 | 3300046513 | Bacteria | 54960 |
| 412 | Ga0495620_0031248 | 3300046515 | Bacteria | 2442 |
| 413 | Ga0495620_0037176 | 3300046515 | Bacteria | 2171 |
| 414 | Ga0495628_0123949 | 3300046516 | Bacteria | 1980 |
| 415 | Ga0495631_0004830 | 3300046518 | Bacteria | 7104 |
| 416 | Ga0495632_0069706 | 3300046519 | Bacteria | 1692 |
| 417 | Ga0495637_0026229 | 3300046520 | Bacteria | 2618 |
| 418 | Ga0495643_0023869 | 3300046522 | Bacteria | 3472 |
| 419 | Ga0495644_0022884 | 3300046523 | Bacteria | 2381 |
| 420 | Ga0495648_0000372 | 3300046524 | Bacteria | 49423 |
| 421 | Ga0495648_0014034 | 3300046524 | Bacteria | 5890 |
| 422 | Ga0495663_0030026 | 3300046525 | Bacteria | 1608 |
| 423 | Ga0495642_0045769 | 3300046528 | Bacteria | 1788 |
| 424 | Ga0495642_0248004 | 3300046528 | Bacteria | 778 |
| 425 | Ga0495654_0000708 | 3300046530 | Bacteria | 26141 |
| 426 | Ga0495654_0018186 | 3300046530 | Bacteria | 3687 |
| 427 | Ga0495609_0105599 | 3300046538 | Bacteria | 1218 |
| 428 | Ga0495609_0281384 | 3300046538 | Bacteria | 680 |
| 429 | Ga0495597_0005539 | 3300046542 | Bacteria | 6674 |
| 430 | Ga0495597_0013122 | 3300046542 | Bacteria | 3977 |
| 431 | Ga0495645_0011325 | 3300046543 | Bacteria | 6272 |
| 432 | Ga0495622_0001326 | 3300046557 | Bacteria | 12674 |
| 433 | Ga0495668_0000100 | 3300046616 | Bacteria | 137684 |
| 434 | Ga0495668_0000342 | 3300046616 | Bacteria | 61973 |
| 435 | Ga0495668_0054552 | 3300046616 | Bacteria | 2208 |
| 436 | Ga0495668_0112168 | 3300046616 | Bacteria | 1491 |
| 437 | Ga0495668_0145182 | 3300046616 | Bacteria | 1299 |
| 438 | Ga0495611_0004244 | 3300046648 | Bacteria | 6240 |
| 439 | Ga0495625_0015370 | 3300046660 | Bacteria | 6065 |
| 440 | Ga0495625_0017433 | 3300046660 | Bacteria | 5623 |
| 441 | Ga0495625_0020568 | 3300046660 | Bacteria | 5092 |
| 442 | Ga0495625_0059935 | 3300046660 | Bacteria | 2698 |
| 443 | Ga0495625_0132268 | 3300046660 | Bacteria | 1689 |
| 444 | Ga0495625_0196563 | 3300046660 | Bacteria | 1333 |
| 445 | Ga0495669_0000012 | 3300046684 | Bacteria | 157373 |
| 446 | Ga0495669_0006893 | 3300046684 | Bacteria | 4759 |
| 447 | Ga0495613_0013180 | 3300046689 | Bacteria | 6142 |
| 448 | Ga0495670_0211907 | 3300046691 | Bacteria | 1028 |
| 449 | Ga0495670_0215478 | 3300046691 | Bacteria | 1019 |
| 450 | Ga0495660_0018592 | 3300046810 | Bacteria | 3995 |
| 451 | Ga0495660_0038634 | 3300046810 | Bacteria | 2653 |
| 452 | Ga0495672_0001737 | 3300047320 | Bacteria | 21063 |
| 453 | Ga0495679_054644 | 3300047446 | Bacteria | 1188 |
| 454 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 455 | Ga0495673_0002003 | 3300047469 | Bacteria | 14993 |
| 456 | Ga0495673_0002412 | 3300047469 | Bacteria | 13176 |
| 457 | Ga0495681_0032687 | 3300047470 | Bacteria | 2616 |
| 458 | Ga0495686_0001965 | 3300047472 | Bacteria | 20419 |
| 459 | Ga0495686_0006019 | 3300047472 | Bacteria | 9422 |
| 460 | Ga0495686_0009474 | 3300047472 | Bacteria | 7010 |
| 461 | Ga0496100_0047082 | 3300048903 | Bacteria | 2777 |
| 462 | Ga0496100_0414381 | 3300048903 | Bacteria | 1028 |
| 463 | Ga0496101_0037941 | 3300048904 | Bacteria | 3420 |
| 464 | Ga0496101_0068891 | 3300048904 | Bacteria | 2588 |
| 465 | Ga0496102_0334162 | 3300048905 | Bacteria | 1427 |
| 466 | Ga0496103_0244583 | 3300048906 | Bacteria | 1154 |
| 467 | Ga0496106_0052300 | 3300048909 | Bacteria | 3081 |
| 468 | Ga0496107_0000063 | 3300048910 | Bacteria | 52938 |
| 469 | Ga0496107_0132990 | 3300048910 | Bacteria | 1837 |
| 470 | Ga0496108_0033802 | 3300048911 | Bacteria | 4247 |
| 471 | Ga0496109_0037712 | 3300048912 | Bacteria | 4367 |
| 472 | Ga0496111_0285676 | 3300048914 | Bacteria | 1224 |
| 473 | Ga0496112_0030512 | 3300048915 | Bacteria | 5218 |
| 474 | Ga0496112_0307857 | 3300048915 | Bacteria | 1529 |
| 475 | Ga0496115_0011071 | 3300048918 | Bacteria | 6758 |
| 476 | Ga0496115_0123236 | 3300048918 | Bacteria | 2134 |
| 477 | Ga0496115_0124346 | 3300048918 | Bacteria | 2124 |
| 478 | Ga0496115_0225548 | 3300048918 | Bacteria | 1546 |
| 479 | Ga0496115_0480633 | 3300048918 | Bacteria | 1000 |
| 480 | Ga0496116_0122364 | 3300048919 | Bacteria | 1503 |
| 481 | Ga0496118_0014017 | 3300048921 | Bacteria | 7529 |
| 482 | Ga0496121_0000059 | 3300048924 | Bacteria | 278177 |
| 483 | Ga0496121_0105913 | 3300048924 | Bacteria | 2157 |
| 484 | Ga0496121_0216575 | 3300048924 | Bacteria | 1352 |
| 485 | Ga0496123_0179087 | 3300048926 | Bacteria | 1109 |
| 486 | Ga0496124_0021850 | 3300048927 | Bacteria | 5886 |
| 487 | Ga0496125_0185716 | 3300048928 | Bacteria | 1379 |
| 488 | Ga0496126_0001304 | 3300048929 | Bacteria | 39731 |
| 489 | Ga0496126_0311787 | 3300048929 | Bacteria | 1295 |
| 490 | Ga0495678_001968 | 3300049459 | Bacteria | 14796 |
| 491 | Ga0501032_0308861 | 3300049569 | Bacteria | 1022 |
| 492 | Ga0501033_0004787 | 3300049570 | Bacteria | 10806 |
| 493 | Ga0501033_0111129 | 3300049570 | Bacteria | 1994 |
| 494 | Ga0501034_0038199 | 3300049571 | Bacteria | 4862 |
| 495 | Ga0501034_0484303 | 3300049571 | Bacteria | 1152 |
| 496 | Ga0501037_0073555 | 3300049573 | Bacteria | 2485 |
| 497 | Ga0501042_0199535 | 3300049578 | Bacteria | 1443 |
| 498 | Ga0501043_0206723 | 3300049579 | Bacteria | 1522 |
| 499 | Ga0501047_0000219 | 3300049581 | Bacteria | 68712 |
| 500 | Ga0501047_0002933 | 3300049581 | Bacteria | 16195 |
| 501 | Ga0501047_0065237 | 3300049581 | Bacteria | 3510 |
| 502 | Ga0501047_0091858 | 3300049581 | Bacteria | 2914 |
| 503 | Ga0501047_0112401 | 3300049581 | Bacteria | 2606 |
| 504 | Ga0501047_0240499 | 3300049581 | Bacteria | 1661 |
| 505 | Ga0501048_0092541 | 3300049582 | Bacteria | 2132 |
| 506 | Ga0501070_0257167 | 3300049586 | Bacteria | 1428 |
| 507 | Ga0501072_0447495 | 3300049588 | Bacteria | 1023 |
| 508 | Ga0501073_0019355 | 3300049589 | Bacteria | 4916 |
| 509 | Ga0501238_000591 | 3300049671 | Bacteria | 4159 |
| 510 | Ga0501238_012001 | 3300049671 | Bacteria | 1168 |
| 511 | Ga0501257_002053 | 3300049686 | Bacteria | 4196 |
| 512 | Ga0501080_0009262 | 3300049742 | Bacteria | 8978 |
| 513 | Ga0501083_0005287 | 3300049744 | Bacteria | 9126 |
| 514 | Ga0501083_0169037 | 3300049744 | Bacteria | 1429 |
| 515 | Ga0501035_0398765 | 3300049822 | Bacteria | 1145 |
| 516 | Ga0501035_0634393 | 3300049822 | Bacteria | 868 |
| 517 | Ga0501044_0005225 | 3300049823 | Bacteria | 14446 |
| 518 | Ga0501044_0010782 | 3300049823 | Bacteria | 9917 |
| 519 | Ga0501044_0263518 | 3300049823 | Bacteria | 1661 |
| 520 | Ga0501044_0310355 | 3300049823 | Bacteria | 1504 |
| 521 | Ga0501044_0569754 | 3300049823 | Bacteria | 1028 |
| 522 | nmdc:mga03683_43059_c1 | 3300050489 | Bacteria | 1861 |
| 523 | nmdc:mga03n38_420517_c1 | 3300050490 | Bacteria | 739 |
| 524 | nmdc:mga00v17_12959_c1 | 3300050491 | Bacteria | 4616 |
| 525 | nmdc:mga0k408_200610_c1 | 3300050493 | Bacteria | 1191 |
| 526 | nmdc:mga0k408_34126_c2 | 3300050493 | Bacteria | 1347 |
| 527 | nmdc:mga07m45_158383_c1 | 3300050496 | Bacteria | 1314 |
| 528 | nmdc:mga07m45_20741_c1 | 3300050496 | Bacteria | 3572 |
| 529 | nmdc:mga07m45_30764_c1 | 3300050496 | Bacteria | 2974 |
| 530 | nmdc:mga07m45_40373_c1 | 3300050496 | Bacteria | 2611 |
| 531 | nmdc:mga0sz30_5859_c1 | 3300050516 | Bacteria | 4530 |
| 532 | Ga0500635_0000048 | 3300053080 | Bacteria | 80957 |
| 533 | Ga0500578_0000913 | 3300053086 | Bacteria | 33199 |
| 534 | Ga0500643_000316 | 3300053087 | Bacteria | 39239 |
| 535 | Ga0500643_018122 | 3300053087 | Bacteria | 2343 |
| 536 | Ga0500643_021576 | 3300053087 | Bacteria | 2085 |
| 537 | Ga0500644_0000287 | 3300053088 | Bacteria | 27540 |
| 538 | Ga0500644_0026944 | 3300053088 | Bacteria | 1783 |
| 539 | Ga0500646_0110663 | 3300053090 | Bacteria | 873 |
| 540 | Ga0500647_0002309 | 3300053091 | Bacteria | 7048 |
| 541 | Ga0500647_0098144 | 3300053091 | Bacteria | 1400 |
| 542 | Ga0500583_0186355 | 3300053092 | Bacteria | 1033 |
| 543 | Ga0500651_0183325 | 3300053093 | Bacteria | 1242 |
| 544 | Ga0500641_0000386 | 3300053096 | Bacteria | 16347 |
| 545 | Ga0500555_002066 | 3300053103 | Bacteria | 5903 |
| 546 | Ga0500556_0000826 | 3300053104 | Bacteria | 17919 |
| 547 | Ga0500556_0022771 | 3300053104 | Bacteria | 2038 |
| 548 | Ga0500557_131380 | 3300053105 | Bacteria | 829 |
| 549 | Ga0500562_000146 | 3300053108 | Bacteria | 20862 |
| 550 | Ga0500562_001187 | 3300053108 | Bacteria | 6427 |
| 551 | Ga0500562_006655 | 3300053108 | Bacteria | 2912 |
| 552 | Ga0500562_006695 | 3300053108 | Bacteria | 2904 |
| 553 | Ga0500569_007140 | 3300053109 | Bacteria | 2493 |
| 554 | Ga0500572_015001 | 3300053111 | Bacteria | 1946 |
| 555 | Ga0500572_036286 | 3300053111 | Bacteria | 1407 |
| 556 | Ga0500594_0000897 | 3300053118 | Bacteria | 6391 |
| 557 | Ga0500595_015940 | 3300053119 | Bacteria | 2808 |
| 558 | Ga0500595_049004 | 3300053119 | Bacteria | 1317 |
| 559 | Ga0500607_025551 | 3300053121 | Bacteria | 3286 |
| 560 | Ga0500608_000187 | 3300053122 | Bacteria | 24884 |
| 561 | Ga0500614_002651 | 3300053123 | Bacteria | 3961 |
| 562 | Ga0500614_003048 | 3300053123 | Bacteria | 3643 |
| 563 | Ga0500618_000319 | 3300053125 | Bacteria | 35375 |
| 564 | Ga0500642_0100767 | 3300053130 | Bacteria | 1343 |
| 565 | Ga0500642_0128924 | 3300053130 | Bacteria | 1185 |
| 566 | Ga0500658_0010151 | 3300053134 | Bacteria | 3471 |
| 567 | Ga0500559_0000153 | 3300053136 | Bacteria | 54641 |
| 568 | Ga0500559_0007015 | 3300053136 | Bacteria | 5035 |
| 569 | Ga0500564_000284 | 3300053138 | Bacteria | 14061 |
| 570 | Ga0500577_0009083 | 3300053142 | Bacteria | 2869 |
| 571 | Ga0500588_0210200 | 3300053146 | Bacteria | 723 |
| 572 | Ga0500590_045331 | 3300053148 | Bacteria | 2251 |
| 573 | Ga0500603_007476 | 3300053150 | Bacteria | 2400 |
| 574 | Ga0500616_0020362 | 3300053153 | Bacteria | 3727 |
| 575 | Ga0500616_0028135 | 3300053153 | Bacteria | 3100 |
| 576 | Ga0500619_222950 | 3300053154 | Bacteria | 627 |
| 577 | Ga0500622_0004117 | 3300053156 | Bacteria | 9309 |
| 578 | Ga0500622_0006823 | 3300053156 | Bacteria | 6565 |
| 579 | Ga0500622_0025972 | 3300053156 | Bacteria | 3092 |
| 580 | Ga0500622_0053777 | 3300053156 | Bacteria | 2067 |
| 581 | Ga0500638_043219 | 3300053162 | Bacteria | 2188 |
| 582 | Ga0500636_0011253 | 3300053177 | Bacteria | 5234 |
| 583 | Ga0500637_0165841 | 3300053178 | Bacteria | 1271 |
| 584 | Ga0500645_002282 | 3300053730 | Bacteria | 8703 |
| 585 | Ga0500645_003039 | 3300053730 | Bacteria | 7058 |
| 586 | Ga0500645_003565 | 3300053730 | Bacteria | 6262 |
| 587 | Ga0500645_004474 | 3300053730 | Bacteria | 5354 |
| 588 | Ga0500609_001858 | 3300053731 | Bacteria | 3062 |
| 589 | Ga0500596_015025 | 3300053735 | Bacteria | 1163 |
| 590 | Ga0501084_0380134 | 3300054114 | Bacteria | 1193 |
| 591 | Ga0501082_0013144 | 3300060353 | Bacteria | 7118 |
| 592 | Ga0501082_0065968 | 3300060353 | Bacteria | 3117 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046538 | Ga0495609_0281384 | Ga0495609_0281384_114_668 | 182 |
| 2 | 3300053154 | Ga0500619_222950 | Ga0500619_222950_62_616 | 182 |
| 3 | 3300031911 | Ga0307412_10632104 | Ga0307412_106321042 | 183 |
| 4 | 3300046460 | Ga0495638_0061418 | Ga0495638_0061418_1761_2312 | 183 |
| 5 | 3300005578 | Ga0068854_100463315 | Ga0068854_1004633152 | 197 |
| 6 | 3300009551 | Ga0105238_10126384 | Ga0105238_101263841 | 197 |
| 7 | 3300025924 | Ga0207694_10367296 | Ga0207694_103672961 | 197 |
| 8 | 3300005336 | Ga0070680_100081752 | Ga0070680_1000817523 | 199 |
| 9 | 3300005341 | Ga0070691_10005691 | Ga0070691_100056912 | 199 |
| 10 | 3300005347 | Ga0070668_100062568 | Ga0070668_1000625683 | 199 |
| 11 | 3300005458 | Ga0070681_10061903 | Ga0070681_100619033 | 199 |
| 12 | 3300005530 | Ga0070679_100014981 | Ga0070679_1000149814 | 199 |
| 13 | 3300009093 | Ga0105240_10251893 | Ga0105240_102518932 | 199 |
| 14 | 3300013104 | Ga0157370_10190336 | Ga0157370_101903363 | 199 |
| 15 | 3300025912 | Ga0207707_10044838 | Ga0207707_100448383 | 199 |
| 16 | 3300025913 | Ga0207695_10004245 | Ga0207695_1000424520 | 199 |
| 17 | 3300025917 | Ga0207660_10069444 | Ga0207660_100694442 | 199 |
| 18 | 3300025921 | Ga0207652_10036965 | Ga0207652_100369653 | 199 |
| 19 | 3300025949 | Ga0207667_10020112 | Ga0207667_100201126 | 199 |
| 20 | 3300025972 | Ga0207668_10102183 | Ga0207668_101021832 | 199 |
| 21 | 3300049570 | Ga0501033_0004787 | Ga0501033_0004787_5953_6552 | 199 |
| 22 | 3300049571 | Ga0501034_0038199 | Ga0501034_0038199_1335_1934 | 199 |
| 23 | 3300049573 | Ga0501037_0073555 | Ga0501037_0073555_754_1353 | 199 |
| 24 | 3300049823 | Ga0501044_0010782 | Ga0501044_0010782_2157_2756 | 199 |
| 25 | iso_pu_bacteria | 2643221598 | 2643998410 | 199 |
| 26 | iso_pu_bacteria | 2643221614 | 2644086724 | 199 |
| 27 | iso_pu_bacteria | 2643221661 | 2644341678 | 199 |
| 28 | iso_pu_bacteria | 2643221666 | 2644367965 | 199 |
| 29 | iso_pu_bacteria | 2849560528 | 2849561623 | 199 |
| 30 | iso_pu_bacteria | 2849573788 | 2849574486 | 199 |
| 31 | iso_pu_bacteria | 2851153111 | 2851153872 | 199 |
| 32 | 3300005617 | Ga0068859_100936731 | Ga0068859_1009367312 | 200 |
| 33 | 3300005937 | Ga0081455_10197529 | Ga0081455_101975291 | 200 |
| 34 | 3300006931 | Ga0097620_100936931 | Ga0097620_1009369312 | 200 |
| 35 | 3300009177 | Ga0105248_10765278 | Ga0105248_107652782 | 200 |
| 36 | 3300028381 | Ga0268264_10417545 | Ga0268264_104175452 | 200 |
| 37 | 3300048918 | Ga0496115_0123236 | Ga0496115_0123236_1278_1892 | 200 |
| 38 | 3300049589 | Ga0501073_0019355 | Ga0501073_0019355_3425_4030 | 200 |
| 39 | 3300049744 | Ga0501083_0169037 | Ga0501083_0169037_347_952 | 200 |
| 40 | 3300053096 | Ga0500641_0000386 | Ga0500641_0000386_6234_6842 | 200 |
| 41 | 3300054114 | Ga0501084_0380134 | Ga0501084_0380134_331_936 | 200 |
| 42 | 3300060353 | Ga0501082_0065968 | Ga0501082_0065968_1511_2116 | 200 |
| 43 | iso_pu_bacteria | 2791355048 | 2792461664 | 200 |
| 44 | iso_pu_bacteria | 2843744320 | 2843746123 | 200 |
| 45 | iso_pu_bacteria | 2898329390 | 2898330483 | 200 |
| 46 | 3300005344 | Ga0070661_100104125 | Ga0070661_1001041253 | 201 |
| 47 | 3300005539 | Ga0068853_100038269 | Ga0068853_1000382692 | 201 |
| 48 | 3300005564 | Ga0070664_100150398 | Ga0070664_1001503981 | 201 |
| 49 | 3300005844 | Ga0068862_100008375 | Ga0068862_1000083753 | 201 |
| 50 | 3300005937 | Ga0081455_10069249 | Ga0081455_100692493 | 201 |
| 51 | 3300013100 | Ga0157373_10001320 | Ga0157373_1000132024 | 201 |
| 52 | 3300013100 | Ga0157373_10012399 | Ga0157373_100123998 | 201 |
| 53 | 3300025919 | Ga0207657_10609865 | Ga0207657_106098652 | 201 |
| 54 | 3300025945 | Ga0207679_10128111 | Ga0207679_101281113 | 201 |
| 55 | 3300026041 | Ga0207639_10014523 | Ga0207639_100145237 | 201 |
| 56 | 3300028380 | Ga0268265_10007428 | Ga0268265_100074288 | 201 |
| 57 | 3300039438 | Ga0436360_1186917 | Ga0436360_1186917_169_777 | 201 |
| 58 | 3300039438 | Ga0436360_1366790 | Ga0436360_1366790_267_878 | 201 |
| 59 | 3300046616 | Ga0495668_0145182 | Ga0495668_0145182_364_972 | 201 |
| 60 | 3300046689 | Ga0495613_0013180 | Ga0495613_0013180_1950_2555 | 201 |
| 61 | 3300049578 | Ga0501042_0199535 | Ga0501042_0199535_291_899 | 201 |
| 62 | 3300049581 | Ga0501047_0000219 | Ga0501047_0000219_19803_20420 | 201 |
| 63 | 3300049588 | Ga0501072_0447495 | Ga0501072_0447495_42_659 | 201 |
| 64 | 3300049742 | Ga0501080_0009262 | Ga0501080_0009262_4358_4975 | 201 |
| 65 | 3300049744 | Ga0501083_0005287 | Ga0501083_0005287_4028_4645 | 201 |
| 66 | 3300053091 | Ga0500647_0002309 | Ga0500647_0002309_248_874 | 201 |
| 67 | 3300053111 | Ga0500572_015001 | Ga0500572_015001_1002_1607 | 201 |
| 68 | 3300053148 | Ga0500590_045331 | Ga0500590_045331_148_753 | 201 |
| 69 | 3300060353 | Ga0501082_0013144 | Ga0501082_0013144_2824_3441 | 201 |
| 70 | iso_pu_bacteria | 2857504554 | 2857508027 | 201 |
| 71 | iso_pu_bacteria | 2884960567 | 2884963120 | 201 |
| 72 | 3300031456 | Ga0307513_10000053 | Ga0307513_1000005353 | 202 |
| 73 | 3300035695 | Ga0373927_0003786 | Ga0373927_0003786_2720_3328 | 202 |
| 74 | 3300037068 | Ga0373925_0004623 | Ga0373925_0004623_2381_2989 | 202 |
| 75 | 3300047472 | Ga0495686_0009474 | Ga0495686_0009474_4259_4867 | 202 |
| 76 | 3300048929 | Ga0496126_0001304 | Ga0496126_0001304_4513_5121 | 202 |
| 77 | 3300053087 | Ga0500643_000316 | Ga0500643_000316_31438_32049 | 202 |
| 78 | 3300053105 | Ga0500557_131380 | Ga0500557_131380_127_738 | 202 |
| 79 | 3300053153 | Ga0500616_0028135 | Ga0500616_0028135_2000_2611 | 202 |
| 80 | 3300053730 | Ga0500645_002282 | Ga0500645_002282_3005_3616 | 202 |
| 81 | iso_pu_bacteria | 2510917020 | 2511121757 | 202 |
| 82 | iso_pu_bacteria | 2582581279 | 2585149000 | 202 |
| 83 | iso_pu_bacteria | 2585428106 | 2587915372 | 202 |
| 84 | iso_pu_bacteria | 2643221545 | 2643749200 | 202 |
| 85 | iso_pu_bacteria | 2643221583 | 2643922896 | 202 |
| 86 | iso_pu_bacteria | 2643221584 | 2643927101 | 202 |
| 87 | iso_pu_bacteria | 2643221640 | 2644223927 | 202 |
| 88 | iso_pu_bacteria | 2643221642 | 2644232913 | 202 |
| 89 | iso_pu_bacteria | 2643221691 | 2644509025 | 202 |
| 90 | iso_pu_bacteria | 2818991435 | 2819536304 | 202 |
| 91 | iso_pu_bacteria | 2818991454 | 2819644559 | 202 |
| 92 | iso_pu_bacteria | 2928531327 | 2928534815 | 202 |
| 93 | 3300005614 | Ga0068856_100060825 | Ga0068856_1000608253 | 203 |
| 94 | 3300006178 | Ga0075367_10033916 | Ga0075367_100339163 | 203 |
| 95 | 3300006195 | Ga0075366_10016922 | Ga0075366_100169224 | 203 |
| 96 | 3300006353 | Ga0075370_10025887 | Ga0075370_100258872 | 203 |
| 97 | 3300015262 | Ga0182007_10014986 | Ga0182007_100149863 | 203 |
| 98 | 3300027665 | Ga0209983_1011978 | Ga0209983_10119783 | 203 |
| 99 | 3300028556 | Ga0265337_1023161 | Ga0265337_10231612 | 203 |
| 100 | 3300031901 | Ga0307406_10685984 | Ga0307406_106859841 | 203 |
| 101 | 3300032002 | Ga0307416_100546811 | Ga0307416_1005468112 | 203 |
| 102 | 3300032004 | Ga0307414_10103708 | Ga0307414_101037082 | 203 |
| 103 | 3300039437 | Ga0436365_1899948 | Ga0436365_1899948_606_1229 | 203 |
| 104 | 3300050493 | nmdc:mga0k408_34126_c2 | nmdc:mga0k408_34126_c2_238_852 | 203 |
| 105 | 3300050496 | nmdc:mga07m45_20741_c1 | nmdc:mga07m45_20741_c1_2190_2804 | 203 |
| 106 | 3300053087 | Ga0500643_021576 | Ga0500643_021576_380_994 | 203 |
| 107 | 3300053104 | Ga0500556_0022771 | Ga0500556_0022771_394_1008 | 203 |
| 108 | 3300053108 | Ga0500562_006655 | Ga0500562_006655_525_1139 | 203 |
| 109 | 3300053156 | Ga0500622_0006823 | Ga0500622_0006823_5312_5926 | 203 |
| 110 | 3300053730 | Ga0500645_003565 | Ga0500645_003565_19_633 | 203 |
| 111 | 3300006042 | Ga0075368_10011124 | Ga0075368_100111244 | 204 |
| 112 | 3300006051 | Ga0075364_10003750 | Ga0075364_100037507 | 204 |
| 113 | 3300009551 | Ga0105238_10675125 | Ga0105238_106751251 | 204 |
| 114 | 3300025299 | Ga0209256_1008763 | Ga0209256_10087633 | 204 |
| 115 | 3300027866 | Ga0209813_10068370 | Ga0209813_100683702 | 204 |
| 116 | 3300031730 | Ga0307516_10000019 | Ga0307516_10000019162 | 204 |
| 117 | 3300033180 | Ga0307510_10047498 | Ga0307510_100474983 | 204 |
| 118 | 3300037312 | Ga0395899_0000016 | Ga0395899_0000016_445323_445946 | 204 |
| 119 | 3300037312 | Ga0395899_0240661 | Ga0395899_0240661_124_750 | 204 |
| 120 | 3300037418 | Ga0395900_0287498 | Ga0395900_0287498_734_1360 | 204 |
| 121 | 3300046524 | Ga0495648_0000372 | Ga0495648_0000372_4614_5228 | 204 |
| 122 | 3300046684 | Ga0495669_0000012 | Ga0495669_0000012_67839_68453 | 204 |
| 123 | 3300047469 | Ga0495673_0002003 | Ga0495673_0002003_12531_13145 | 204 |
| 124 | 3300048910 | Ga0496107_0132990 | Ga0496107_0132990_811_1437 | 204 |
| 125 | 3300049571 | Ga0501034_0484303 | Ga0501034_0484303_283_909 | 204 |
| 126 | 3300049822 | Ga0501035_0398765 | Ga0501035_0398765_315_941 | 204 |
| 127 | 3300050491 | nmdc:mga00v17_12959_c1 | nmdc:mga00v17_12959_c1_2256_2873 | 204 |
| 128 | 3300050496 | nmdc:mga07m45_40373_c1 | nmdc:mga07m45_40373_c1_1777_2394 | 204 |
| 129 | 3300053088 | Ga0500644_0000287 | Ga0500644_0000287_18411_19025 | 204 |
| 130 | 3300053138 | Ga0500564_000284 | Ga0500564_000284_8329_8943 | 204 |
| 131 | iso_pu_bacteria | 2582581280 | 2585151638 | 204 |
| 132 | iso_pu_bacteria | 2582581293 | 2585195488 | 204 |
| 133 | iso_pu_bacteria | 2643221552 | 2643781318 | 204 |
| 134 | 3300003781 | Ga0055536_1003050 | Ga0055536_10030504 | 205 |
| 135 | 3300003781 | Ga0055536_1005222 | Ga0055536_10052224 | 205 |
| 136 | 3300003791 | Ga0055530_10003497 | Ga0055530_100034974 | 205 |
| 137 | 3300003791 | Ga0055530_10004335 | Ga0055530_100043354 | 205 |
| 138 | 3300003791 | Ga0055530_10008601 | Ga0055530_100086013 | 205 |
| 139 | 3300003791 | Ga0055530_10010190 | Ga0055530_100101902 | 205 |
| 140 | 3300003794 | Ga0055531_10001668 | Ga0055531_1000166815 | 205 |
| 141 | 3300003794 | Ga0055531_10038847 | Ga0055531_100388472 | 205 |
| 142 | 3300004625 | Ga0055543_1010658 | Ga0055543_10106582 | 205 |
| 143 | 3300005262 | Ga0065165_1007831 | Ga0065165_10078315 | 205 |
| 144 | 3300005327 | Ga0070658_10072508 | Ga0070658_100725082 | 205 |
| 145 | 3300005327 | Ga0070658_10148497 | Ga0070658_101484973 | 205 |
| 146 | 3300005327 | Ga0070658_10242699 | Ga0070658_102426991 | 205 |
| 147 | 3300005327 | Ga0070658_10438400 | Ga0070658_104384002 | 205 |
| 148 | 3300005329 | Ga0070683_100781758 | Ga0070683_1007817581 | 205 |
| 149 | 3300005331 | Ga0070670_100000035 | Ga0070670_100000035110 | 205 |
| 150 | 3300005331 | Ga0070670_100111338 | Ga0070670_1001113381 | 205 |
| 151 | 3300005334 | Ga0068869_100503124 | Ga0068869_1005031241 | 205 |
| 152 | 3300005335 | Ga0070666_10057189 | Ga0070666_100571892 | 205 |
| 153 | 3300005339 | Ga0070660_100121721 | Ga0070660_1001217212 | 205 |
| 154 | 3300005339 | Ga0070660_100246720 | Ga0070660_1002467202 | 205 |
| 155 | 3300005339 | Ga0070660_100414739 | Ga0070660_1004147392 | 205 |
| 156 | 3300005347 | Ga0070668_100001655 | Ga0070668_1000016556 | 205 |
| 157 | 3300005347 | Ga0070668_100003652 | Ga0070668_10000365210 | 205 |
| 158 | 3300005347 | Ga0070668_100005042 | Ga0070668_1000050428 | 205 |
| 159 | 3300005347 | Ga0070668_100008290 | Ga0070668_1000082906 | 205 |
| 160 | 3300005353 | Ga0070669_100014476 | Ga0070669_1000144766 | 205 |
| 161 | 3300005355 | Ga0070671_100008156 | Ga0070671_1000081562 | 205 |
| 162 | 3300005355 | Ga0070671_100044283 | Ga0070671_1000442832 | 205 |
| 163 | 3300005355 | Ga0070671_100140031 | Ga0070671_1001400313 | 205 |
| 164 | 3300005364 | Ga0070673_100114753 | Ga0070673_1001147533 | 205 |
| 165 | 3300005366 | Ga0070659_100002173 | Ga0070659_1000021734 | 205 |
| 166 | 3300005366 | Ga0070659_100009683 | Ga0070659_1000096837 | 205 |
| 167 | 3300005367 | Ga0070667_100000711 | Ga0070667_10000071110 | 205 |
| 168 | 3300005367 | Ga0070667_100012351 | Ga0070667_1000123515 | 205 |
| 169 | 3300005367 | Ga0070667_100035524 | Ga0070667_1000355241 | 205 |
| 170 | 3300005367 | Ga0070667_100817038 | Ga0070667_1008170382 | 205 |
| 171 | 3300005436 | Ga0070713_100729594 | Ga0070713_1007295941 | 205 |
| 172 | 3300005455 | Ga0070663_100286146 | Ga0070663_1002861463 | 205 |
| 173 | 3300005457 | Ga0070662_100381076 | Ga0070662_1003810762 | 205 |
| 174 | 3300005530 | Ga0070679_100273069 | Ga0070679_1002730692 | 205 |
| 175 | 3300005539 | Ga0068853_100406572 | Ga0068853_1004065722 | 205 |
| 176 | 3300005548 | Ga0070665_100000433 | Ga0070665_10000043331 | 205 |
| 177 | 3300005548 | Ga0070665_100002042 | Ga0070665_10000204218 | 205 |
| 178 | 3300005548 | Ga0070665_100002102 | Ga0070665_10000210211 | 205 |
| 179 | 3300005548 | Ga0070665_100066800 | Ga0070665_1000668005 | 205 |
| 180 | 3300005548 | Ga0070665_100230031 | Ga0070665_1002300312 | 205 |
| 181 | 3300005563 | Ga0068855_100045250 | Ga0068855_1000452504 | 205 |
| 182 | 3300005563 | Ga0068855_100118233 | Ga0068855_1001182332 | 205 |
| 183 | 3300005563 | Ga0068855_100166242 | Ga0068855_1001662423 | 205 |
| 184 | 3300005564 | Ga0070664_100256593 | Ga0070664_1002565932 | 205 |
| 185 | 3300005577 | Ga0068857_100331549 | Ga0068857_1003315492 | 205 |
| 186 | 3300005614 | Ga0068856_100183347 | Ga0068856_1001833473 | 205 |
| 187 | 3300005614 | Ga0068856_100202083 | Ga0068856_1002020833 | 205 |
| 188 | 3300005614 | Ga0068856_100248032 | Ga0068856_1002480321 | 205 |
| 189 | 3300005615 | Ga0070702_100282566 | Ga0070702_1002825662 | 205 |
| 190 | 3300005616 | Ga0068852_100096346 | Ga0068852_1000963462 | 205 |
| 191 | 3300005616 | Ga0068852_100655154 | Ga0068852_1006551542 | 205 |
| 192 | 3300005617 | Ga0068859_100563028 | Ga0068859_1005630281 | 205 |
| 193 | 3300005617 | Ga0068859_100579944 | Ga0068859_1005799442 | 205 |
| 194 | 3300005618 | Ga0068864_100000102 | Ga0068864_10000010256 | 205 |
| 195 | 3300005618 | Ga0068864_100000165 | Ga0068864_10000016520 | 205 |
| 196 | 3300005618 | Ga0068864_100007387 | Ga0068864_10000738710 | 205 |
| 197 | 3300005618 | Ga0068864_100061222 | Ga0068864_1000612223 | 205 |
| 198 | 3300005618 | Ga0068864_100356324 | Ga0068864_1003563242 | 205 |
| 199 | 3300005618 | Ga0068864_100448911 | Ga0068864_1004489112 | 205 |
| 200 | 3300005719 | Ga0068861_100233239 | Ga0068861_1002332392 | 205 |
| 201 | 3300005841 | Ga0068863_100000128 | Ga0068863_10000012815 | 205 |
| 202 | 3300005841 | Ga0068863_100000958 | Ga0068863_10000095825 | 205 |
| 203 | 3300005841 | Ga0068863_100003725 | Ga0068863_1000037255 | 205 |
| 204 | 3300005841 | Ga0068863_100075883 | Ga0068863_1000758831 | 205 |
| 205 | 3300005841 | Ga0068863_100291190 | Ga0068863_1002911902 | 205 |
| 206 | 3300005842 | Ga0068858_100000117 | Ga0068858_10000011714 | 205 |
| 207 | 3300005842 | Ga0068858_100008401 | Ga0068858_1000084013 | 205 |
| 208 | 3300005842 | Ga0068858_100049265 | Ga0068858_1000492654 | 205 |
| 209 | 3300005842 | Ga0068858_100130572 | Ga0068858_1001305723 | 205 |
| 210 | 3300005842 | Ga0068858_100193698 | Ga0068858_1001936981 | 205 |
| 211 | 3300005842 | Ga0068858_100351911 | Ga0068858_1003519111 | 205 |
| 212 | 3300005843 | Ga0068860_100000100 | Ga0068860_10000010099 | 205 |
| 213 | 3300005843 | Ga0068860_100000157 | Ga0068860_10000015796 | 205 |
| 214 | 3300005843 | Ga0068860_100057712 | Ga0068860_1000577122 | 205 |
| 215 | 3300005844 | Ga0068862_100000368 | Ga0068862_1000003683 | 205 |
| 216 | 3300005844 | Ga0068862_100003705 | Ga0068862_10000370514 | 205 |
| 217 | 3300005844 | Ga0068862_100026735 | Ga0068862_1000267352 | 205 |
| 218 | 3300005844 | Ga0068862_100041760 | Ga0068862_1000417602 | 205 |
| 219 | 3300006028 | Ga0070717_10048558 | Ga0070717_100485583 | 205 |
| 220 | 3300006177 | Ga0075362_10017023 | Ga0075362_100170233 | 205 |
| 221 | 3300006353 | Ga0075370_10037819 | Ga0075370_100378193 | 205 |
| 222 | 3300006881 | Ga0068865_100021928 | Ga0068865_1000219283 | 205 |
| 223 | 3300006881 | Ga0068865_100450493 | Ga0068865_1004504932 | 205 |
| 224 | 3300006931 | Ga0097620_100562930 | Ga0097620_1005629301 | 205 |
| 225 | 3300006931 | Ga0097620_100579944 | Ga0097620_1005799442 | 205 |
| 226 | 3300006946 | Ga0079104_1021617 | Ga0079104_10216173 | 205 |
| 227 | 3300009092 | Ga0105250_10018847 | Ga0105250_100188472 | 205 |
| 228 | 3300009093 | Ga0105240_10002229 | Ga0105240_100022295 | 205 |
| 229 | 3300009093 | Ga0105240_10010678 | Ga0105240_100106784 | 205 |
| 230 | 3300009093 | Ga0105240_10089734 | Ga0105240_100897344 | 205 |
| 231 | 3300009093 | Ga0105240_10097510 | Ga0105240_100975103 | 205 |
| 232 | 3300009093 | Ga0105240_10219630 | Ga0105240_102196303 | 205 |
| 233 | 3300009093 | Ga0105240_10553010 | Ga0105240_105530102 | 205 |
| 234 | 3300009093 | Ga0105240_10941530 | Ga0105240_109415301 | 205 |
| 235 | 3300009177 | Ga0105248_10000280 | Ga0105248_100002804 | 205 |
| 236 | 3300009177 | Ga0105248_10005436 | Ga0105248_100054366 | 205 |
| 237 | 3300009177 | Ga0105248_10049590 | Ga0105248_100495902 | 205 |
| 238 | 3300009177 | Ga0105248_10059152 | Ga0105248_100591524 | 205 |
| 239 | 3300009177 | Ga0105248_10064503 | Ga0105248_100645033 | 205 |
| 240 | 3300009545 | Ga0105237_10272735 | Ga0105237_102727351 | 205 |
| 241 | 3300009551 | Ga0105238_10022800 | Ga0105238_100228002 | 205 |
| 242 | 3300009551 | Ga0105238_10113045 | Ga0105238_101130453 | 205 |
| 243 | 3300009551 | Ga0105238_10207720 | Ga0105238_102077201 | 205 |
| 244 | 3300009551 | Ga0105238_10334368 | Ga0105238_103343682 | 205 |
| 245 | 3300009553 | Ga0105249_10000525 | Ga0105249_100005252 | 205 |
| 246 | 3300009553 | Ga0105249_10224004 | Ga0105249_102240042 | 205 |
| 247 | 3300010375 | Ga0105239_10725713 | Ga0105239_107257132 | 205 |
| 248 | 3300013100 | Ga0157373_10124774 | Ga0157373_101247742 | 205 |
| 249 | 3300013105 | Ga0157369_10350357 | Ga0157369_103503571 | 205 |
| 250 | 3300013105 | Ga0157369_11026376 | Ga0157369_110263761 | 205 |
| 251 | 3300013306 | Ga0163162_10082033 | Ga0163162_100820333 | 205 |
| 252 | 3300013306 | Ga0163162_10704543 | Ga0163162_107045432 | 205 |
| 253 | 3300013307 | Ga0157372_11118425 | Ga0157372_111184252 | 205 |
| 254 | 3300013308 | Ga0157375_10066003 | Ga0157375_100660033 | 205 |
| 255 | 3300013308 | Ga0157375_11171804 | Ga0157375_111718042 | 205 |
| 256 | 3300014325 | Ga0163163_10003142 | Ga0163163_1000314219 | 205 |
| 257 | 3300014325 | Ga0163163_10223875 | Ga0163163_102238752 | 205 |
| 258 | 3300014325 | Ga0163163_10920367 | Ga0163163_109203671 | 205 |
| 259 | 3300014325 | Ga0163163_11081688 | Ga0163163_110816882 | 205 |
| 260 | 3300014326 | Ga0157380_10282640 | Ga0157380_102826401 | 205 |
| 261 | 3300014968 | Ga0157379_10003132 | Ga0157379_100031326 | 205 |
| 262 | 3300014968 | Ga0157379_10108966 | Ga0157379_101089663 | 205 |
| 263 | 3300014968 | Ga0157379_10173970 | Ga0157379_101739702 | 205 |
| 264 | 3300014969 | Ga0157376_10465622 | Ga0157376_104656221 | 205 |
| 265 | 3300021361 | Ga0213872_10047077 | Ga0213872_100470771 | 205 |
| 266 | 3300021377 | Ga0213874_10001579 | Ga0213874_100015792 | 205 |
| 267 | 3300021384 | Ga0213876_10000276 | Ga0213876_1000027643 | 205 |
| 268 | 3300021384 | Ga0213876_10306173 | Ga0213876_103061732 | 205 |
| 269 | 3300021388 | Ga0213875_10055927 | Ga0213875_100559272 | 205 |
| 270 | 3300021388 | Ga0213875_10256736 | Ga0213875_102567361 | 205 |
| 271 | 3300025250 | Ga0209026_1007030 | Ga0209026_10070303 | 205 |
| 272 | 3300025250 | Ga0209026_1028809 | Ga0209026_10288091 | 205 |
| 273 | 3300025254 | Ga0209148_1008212 | Ga0209148_10082123 | 205 |
| 274 | 3300025254 | Ga0209148_1009749 | Ga0209148_10097491 | 205 |
| 275 | 3300025292 | Ga0209676_1000467 | Ga0209676_100046721 | 205 |
| 276 | 3300025292 | Ga0209676_1000560 | Ga0209676_100056021 | 205 |
| 277 | 3300025297 | Ga0209758_1000331 | Ga0209758_100033194 | 205 |
| 278 | 3300025298 | Ga0209050_1000130 | Ga0209050_100013068 | 205 |
| 279 | 3300025298 | Ga0209050_1000461 | Ga0209050_100046150 | 205 |
| 280 | 3300025298 | Ga0209050_1001568 | Ga0209050_10015685 | 205 |
| 281 | 3300025303 | Ga0209051_1024035 | Ga0209051_10240353 | 205 |
| 282 | 3300025304 | Ga0209257_1000059 | Ga0209257_1000059263 | 205 |
| 283 | 3300025304 | Ga0209257_1000406 | Ga0209257_100040683 | 205 |
| 284 | 3300025304 | Ga0209257_1001256 | Ga0209257_100125612 | 205 |
| 285 | 3300025304 | Ga0209257_1006979 | Ga0209257_10069793 | 205 |
| 286 | 3300025903 | Ga0207680_10022747 | Ga0207680_100227472 | 205 |
| 287 | 3300025903 | Ga0207680_10077277 | Ga0207680_100772773 | 205 |
| 288 | 3300025903 | Ga0207680_10524106 | Ga0207680_105241061 | 205 |
| 289 | 3300025909 | Ga0207705_10000859 | Ga0207705_100008595 | 205 |
| 290 | 3300025909 | Ga0207705_10141061 | Ga0207705_101410612 | 205 |
| 291 | 3300025912 | Ga0207707_10025232 | Ga0207707_100252323 | 205 |
| 292 | 3300025912 | Ga0207707_10026000 | Ga0207707_100260001 | 205 |
| 293 | 3300025913 | Ga0207695_10001222 | Ga0207695_1000122246 | 205 |
| 294 | 3300025913 | Ga0207695_10017891 | Ga0207695_100178916 | 205 |
| 295 | 3300025913 | Ga0207695_10031617 | Ga0207695_100316173 | 205 |
| 296 | 3300025913 | Ga0207695_10127102 | Ga0207695_101271023 | 205 |
| 297 | 3300025914 | Ga0207671_10385287 | Ga0207671_103852871 | 205 |
| 298 | 3300025914 | Ga0207671_10601324 | Ga0207671_106013242 | 205 |
| 299 | 3300025917 | Ga0207660_10012963 | Ga0207660_100129634 | 205 |
| 300 | 3300025918 | Ga0207662_10300347 | Ga0207662_103003472 | 205 |
| 301 | 3300025919 | Ga0207657_10005498 | Ga0207657_100054985 | 205 |
| 302 | 3300025919 | Ga0207657_10101743 | Ga0207657_101017433 | 205 |
| 303 | 3300025919 | Ga0207657_10582931 | Ga0207657_105829311 | 205 |
| 304 | 3300025920 | Ga0207649_10259001 | Ga0207649_102590012 | 205 |
| 305 | 3300025921 | Ga0207652_10009199 | Ga0207652_100091994 | 205 |
| 306 | 3300025921 | Ga0207652_10411271 | Ga0207652_104112711 | 205 |
| 307 | 3300025923 | Ga0207681_10190318 | Ga0207681_101903182 | 205 |
| 308 | 3300025924 | Ga0207694_10007116 | Ga0207694_100071166 | 205 |
| 309 | 3300025924 | Ga0207694_10085746 | Ga0207694_100857462 | 205 |
| 310 | 3300025924 | Ga0207694_10096466 | Ga0207694_100964661 | 205 |
| 311 | 3300025925 | Ga0207650_10000327 | Ga0207650_100003279 | 205 |
| 312 | 3300025925 | Ga0207650_10643808 | Ga0207650_106438082 | 205 |
| 313 | 3300025931 | Ga0207644_10019082 | Ga0207644_100190822 | 205 |
| 314 | 3300025931 | Ga0207644_10098234 | Ga0207644_100982342 | 205 |
| 315 | 3300025931 | Ga0207644_10347652 | Ga0207644_103476522 | 205 |
| 316 | 3300025932 | Ga0207690_10000159 | Ga0207690_1000015947 | 205 |
| 317 | 3300025932 | Ga0207690_10015653 | Ga0207690_100156534 | 205 |
| 318 | 3300025933 | Ga0207706_10065814 | Ga0207706_100658143 | 205 |
| 319 | 3300025938 | Ga0207704_10002381 | Ga0207704_100023816 | 205 |
| 320 | 3300025938 | Ga0207704_10272173 | Ga0207704_102721732 | 205 |
| 321 | 3300025941 | Ga0207711_10003708 | Ga0207711_100037084 | 205 |
| 322 | 3300025941 | Ga0207711_10007949 | Ga0207711_1000794910 | 205 |
| 323 | 3300025941 | Ga0207711_10011616 | Ga0207711_100116164 | 205 |
| 324 | 3300025941 | Ga0207711_10081654 | Ga0207711_100816542 | 205 |
| 325 | 3300025941 | Ga0207711_10098929 | Ga0207711_100989292 | 205 |
| 326 | 3300025941 | Ga0207711_10258633 | Ga0207711_102586331 | 205 |
| 327 | 3300025942 | Ga0207689_10376150 | Ga0207689_103761502 | 205 |
| 328 | 3300025944 | Ga0207661_10306521 | Ga0207661_103065212 | 205 |
| 329 | 3300025949 | Ga0207667_10026359 | Ga0207667_100263596 | 205 |
| 330 | 3300025949 | Ga0207667_10189088 | Ga0207667_101890883 | 205 |
| 331 | 3300025961 | Ga0207712_10192593 | Ga0207712_101925932 | 205 |
| 332 | 3300025972 | Ga0207668_10000025 | Ga0207668_1000002549 | 205 |
| 333 | 3300025972 | Ga0207668_10001450 | Ga0207668_100014507 | 205 |
| 334 | 3300025986 | Ga0207658_10000300 | Ga0207658_1000030057 | 205 |
| 335 | 3300025986 | Ga0207658_10003134 | Ga0207658_1000313410 | 205 |
| 336 | 3300025986 | Ga0207658_10013264 | Ga0207658_100132642 | 205 |
| 337 | 3300025986 | Ga0207658_10086967 | Ga0207658_100869672 | 205 |
| 338 | 3300026023 | Ga0207677_10502724 | Ga0207677_105027242 | 205 |
| 339 | 3300026035 | Ga0207703_10002585 | Ga0207703_100025853 | 205 |
| 340 | 3300026035 | Ga0207703_10006338 | Ga0207703_100063387 | 205 |
| 341 | 3300026041 | Ga0207639_10152840 | Ga0207639_101528402 | 205 |
| 342 | 3300026067 | Ga0207678_10261526 | Ga0207678_102615263 | 205 |
| 343 | 3300026078 | Ga0207702_10446397 | Ga0207702_104463972 | 205 |
| 344 | 3300026088 | Ga0207641_10000005 | Ga0207641_10000005397 | 205 |
| 345 | 3300026088 | Ga0207641_10000777 | Ga0207641_1000077721 | 205 |
| 346 | 3300026088 | Ga0207641_10000994 | Ga0207641_1000099427 | 205 |
| 347 | 3300026088 | Ga0207641_10068771 | Ga0207641_100687713 | 205 |
| 348 | 3300026088 | Ga0207641_10223451 | Ga0207641_102234513 | 205 |
| 349 | 3300026088 | Ga0207641_10294648 | Ga0207641_102946482 | 205 |
| 350 | 3300026088 | Ga0207641_10456053 | Ga0207641_104560531 | 205 |
| 351 | 3300026095 | Ga0207676_10000066 | Ga0207676_1000006684 | 205 |
| 352 | 3300026095 | Ga0207676_10000145 | Ga0207676_1000014514 | 205 |
| 353 | 3300026095 | Ga0207676_10004781 | Ga0207676_100047811 | 205 |
| 354 | 3300026095 | Ga0207676_10044856 | Ga0207676_100448562 | 205 |
| 355 | 3300026095 | Ga0207676_10093677 | Ga0207676_100936772 | 205 |
| 356 | 3300026116 | Ga0207674_10146840 | Ga0207674_101468402 | 205 |
| 357 | 3300026116 | Ga0207674_10203578 | Ga0207674_102035782 | 205 |
| 358 | 3300026118 | Ga0207675_100170229 | Ga0207675_1001702292 | 205 |
| 359 | 3300026118 | Ga0207675_100227004 | Ga0207675_1002270041 | 205 |
| 360 | 3300026118 | Ga0207675_100497806 | Ga0207675_1004978062 | 205 |
| 361 | 3300026118 | Ga0207675_100733425 | Ga0207675_1007334252 | 205 |
| 362 | 3300027378 | Ga0209981_1000259 | Ga0209981_10002594 | 205 |
| 363 | 3300027471 | Ga0209995_1037821 | Ga0209995_10378212 | 205 |
| 364 | 3300028379 | Ga0268266_10000003 | Ga0268266_10000003576 | 205 |
| 365 | 3300028379 | Ga0268266_10000814 | Ga0268266_1000081414 | 205 |
| 366 | 3300028379 | Ga0268266_10000815 | Ga0268266_100008157 | 205 |
| 367 | 3300028379 | Ga0268266_10372963 | Ga0268266_103729632 | 205 |
| 368 | 3300028380 | Ga0268265_10000532 | Ga0268265_100005326 | 205 |
| 369 | 3300028380 | Ga0268265_10013139 | Ga0268265_100131392 | 205 |
| 370 | 3300028380 | Ga0268265_10014390 | Ga0268265_100143906 | 205 |
| 371 | 3300028380 | Ga0268265_10171432 | Ga0268265_101714322 | 205 |
| 372 | 3300028380 | Ga0268265_10243183 | Ga0268265_102431832 | 205 |
| 373 | 3300028381 | Ga0268264_10000002 | Ga0268264_10000002739 | 205 |
| 374 | 3300028381 | Ga0268264_10000211 | Ga0268264_1000021157 | 205 |
| 375 | 3300028381 | Ga0268264_10085306 | Ga0268264_100853062 | 205 |
| 376 | 3300028558 | Ga0265326_10016968 | Ga0265326_100169682 | 205 |
| 377 | 3300028573 | Ga0265334_10072210 | Ga0265334_100722102 | 205 |
| 378 | 3300028786 | Ga0307517_10002267 | Ga0307517_100022673 | 205 |
| 379 | 3300028786 | Ga0307517_10072546 | Ga0307517_100725462 | 205 |
| 380 | 3300028800 | Ga0265338_10005275 | Ga0265338_100052759 | 205 |
| 381 | 3300028800 | Ga0265338_10009016 | Ga0265338_100090168 | 205 |
| 382 | 3300028800 | Ga0265338_10052890 | Ga0265338_100528902 | 205 |
| 383 | 3300028800 | Ga0265338_10170717 | Ga0265338_101707172 | 205 |
| 384 | 3300028800 | Ga0265338_10380583 | Ga0265338_103805832 | 205 |
| 385 | 3300030521 | Ga0307511_10044683 | Ga0307511_100446834 | 205 |
| 386 | 3300031247 | Ga0265340_10038859 | Ga0265340_100388592 | 205 |
| 387 | 3300031250 | Ga0265331_10197635 | Ga0265331_101976352 | 205 |
| 388 | 3300031251 | Ga0265327_10001631 | Ga0265327_1000163126 | 205 |
| 389 | 3300031251 | Ga0265327_10002802 | Ga0265327_100028026 | 205 |
| 390 | 3300031456 | Ga0307513_10000790 | Ga0307513_1000079031 | 205 |
| 391 | 3300031456 | Ga0307513_10004139 | Ga0307513_1000413915 | 205 |
| 392 | 3300031456 | Ga0307513_10008435 | Ga0307513_100084358 | 205 |
| 393 | 3300031711 | Ga0265314_10107420 | Ga0265314_101074202 | 205 |
| 394 | 3300031711 | Ga0265314_10132382 | Ga0265314_101323822 | 205 |
| 395 | 3300031852 | Ga0307410_10037010 | Ga0307410_100370103 | 205 |
| 396 | 3300031903 | Ga0307407_10110006 | Ga0307407_101100062 | 205 |
| 397 | 3300033180 | Ga0307510_10174377 | Ga0307510_101743773 | 205 |
| 398 | 3300035113 | Ga0373936_0034195 | Ga0373936_0034195_1216_1836 | 205 |
| 399 | 3300035692 | Ga0373935_0118334 | Ga0373935_0118334_271_891 | 205 |
| 400 | 3300035724 | Ga0373933_0485269 | Ga0373933_0485269_50_676 | 205 |
| 401 | 3300037312 | Ga0395899_0000373 | Ga0395899_0000373_21226_21846 | 205 |
| 402 | 3300037312 | Ga0395899_0217152 | Ga0395899_0217152_180_803 | 205 |
| 403 | 3300037418 | Ga0395900_0000052 | Ga0395900_0000052_90614_91234 | 205 |
| 404 | 3300037418 | Ga0395900_0031072 | Ga0395900_0031072_3518_4141 | 205 |
| 405 | 3300037418 | Ga0395900_0210642 | Ga0395900_0210642_429_1049 | 205 |
| 406 | 3300037418 | Ga0395900_0558856 | Ga0395900_0558856_426_1052 | 205 |
| 407 | 3300037466 | Ga0395898_0003873 | Ga0395898_0003873_4657_5277 | 205 |
| 408 | 3300037466 | Ga0395898_0006482 | Ga0395898_0006482_359_982 | 205 |
| 409 | 3300037466 | Ga0395898_0272676 | Ga0395898_0272676_881_1507 | 205 |
| 410 | 3300037471 | Ga0395905_0092295 | Ga0395905_0092295_2002_2625 | 205 |
| 411 | 3300037471 | Ga0395905_0101606 | Ga0395905_0101606_1600_2223 | 205 |
| 412 | 3300037471 | Ga0395905_0133213 | Ga0395905_0133213_1240_1860 | 205 |
| 413 | 3300037471 | Ga0395905_0299461 | Ga0395905_0299461_212_835 | 205 |
| 414 | 3300037471 | Ga0395905_0536042 | Ga0395905_0536042_28_651 | 205 |
| 415 | 3300037853 | Ga0436364_0089346 | Ga0436364_0089346_102_728 | 205 |
| 416 | 3300037853 | Ga0436364_0548564 | Ga0436364_0548564_422_1042 | 205 |
| 417 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_696775_697395 | 205 |
| 418 | 3300038443 | Ga0395901_0168174 | Ga0395901_0168174_490_1113 | 205 |
| 419 | 3300039437 | Ga0436365_0608786 | Ga0436365_0608786_11342_11968 | 205 |
| 420 | 3300039437 | Ga0436365_0738680 | Ga0436365_0738680_459_1079 | 205 |
| 421 | 3300039437 | Ga0436365_1407991 | Ga0436365_1407991_97_717 | 205 |
| 422 | 3300039447 | Ga0436361_0293275 | Ga0436361_0293275_580_1206 | 205 |
| 423 | 3300039447 | Ga0436361_0587620 | Ga0436361_0587620_57_683 | 205 |
| 424 | 3300039447 | Ga0436361_0709707 | Ga0436361_0709707_1218_1844 | 205 |
| 425 | 3300039447 | Ga0436361_0851335 | Ga0436361_0851335_28_654 | 205 |
| 426 | 3300039447 | Ga0436361_1100879 | Ga0436361_1100879_12151_12774 | 205 |
| 427 | 3300039450 | Ga0436363_1321778 | Ga0436363_1321778_1603_2229 | 205 |
| 428 | 3300044656 | Ga0466969_0172954 | Ga0466969_0172954_158_778 | 205 |
| 429 | 3300044684 | Ga0466966_0150141 | Ga0466966_0150141_755_1387 | 205 |
| 430 | 3300044842 | Ga0466957_0082183 | Ga0466957_0082183_757_1374 | 205 |
| 431 | 3300044842 | Ga0466957_0559211 | Ga0466957_0559211_52_672 | 205 |
| 432 | 3300046459 | Ga0495629_0254460 | Ga0495629_0254460_162_785 | 205 |
| 433 | 3300046506 | Ga0495583_0021172 | Ga0495583_0021172_1199_1816 | 205 |
| 434 | 3300046506 | Ga0495583_0066187 | Ga0495583_0066187_865_1488 | 205 |
| 435 | 3300046512 | Ga0495610_0056599 | Ga0495610_0056599_378_1070 | 205 |
| 436 | 3300046515 | Ga0495620_0031248 | Ga0495620_0031248_324_947 | 205 |
| 437 | 3300046516 | Ga0495628_0123949 | Ga0495628_0123949_818_1438 | 205 |
| 438 | 3300046522 | Ga0495643_0023869 | Ga0495643_0023869_1155_1778 | 205 |
| 439 | 3300046523 | Ga0495644_0022884 | Ga0495644_0022884_943_1560 | 205 |
| 440 | 3300046528 | Ga0495642_0045769 | Ga0495642_0045769_422_1039 | 205 |
| 441 | 3300046528 | Ga0495642_0248004 | Ga0495642_0248004_23_640 | 205 |
| 442 | 3300046542 | Ga0495597_0005539 | Ga0495597_0005539_331_954 | 205 |
| 443 | 3300046543 | Ga0495645_0011325 | Ga0495645_0011325_314_934 | 205 |
| 444 | 3300046557 | Ga0495622_0001326 | Ga0495622_0001326_9702_10325 | 205 |
| 445 | 3300046616 | Ga0495668_0000342 | Ga0495668_0000342_58443_59060 | 205 |
| 446 | 3300046616 | Ga0495668_0112168 | Ga0495668_0112168_456_1073 | 205 |
| 447 | 3300046648 | Ga0495611_0004244 | Ga0495611_0004244_793_1410 | 205 |
| 448 | 3300046660 | Ga0495625_0132268 | Ga0495625_0132268_927_1544 | 205 |
| 449 | 3300046684 | Ga0495669_0006893 | Ga0495669_0006893_856_1476 | 205 |
| 450 | 3300046691 | Ga0495670_0211907 | Ga0495670_0211907_114_737 | 205 |
| 451 | 3300046810 | Ga0495660_0038634 | Ga0495660_0038634_297_920 | 205 |
| 452 | 3300047472 | Ga0495686_0006019 | Ga0495686_0006019_7891_8514 | 205 |
| 453 | 3300048903 | Ga0496100_0047082 | Ga0496100_0047082_481_1098 | 205 |
| 454 | 3300048903 | Ga0496100_0414381 | Ga0496100_0414381_15_635 | 205 |
| 455 | 3300048904 | Ga0496101_0037941 | Ga0496101_0037941_1490_2107 | 205 |
| 456 | 3300048905 | Ga0496102_0334162 | Ga0496102_0334162_252_875 | 205 |
| 457 | 3300048906 | Ga0496103_0244583 | Ga0496103_0244583_34_657 | 205 |
| 458 | 3300048911 | Ga0496108_0033802 | Ga0496108_0033802_2765_3382 | 205 |
| 459 | 3300048912 | Ga0496109_0037712 | Ga0496109_0037712_2507_3124 | 205 |
| 460 | 3300048914 | Ga0496111_0285676 | Ga0496111_0285676_352_972 | 205 |
| 461 | 3300048915 | Ga0496112_0030512 | Ga0496112_0030512_779_1414 | 205 |
| 462 | 3300048915 | Ga0496112_0307857 | Ga0496112_0307857_358_975 | 205 |
| 463 | 3300048918 | Ga0496115_0011071 | Ga0496115_0011071_2692_3312 | 205 |
| 464 | 3300048918 | Ga0496115_0124346 | Ga0496115_0124346_1023_1664 | 205 |
| 465 | 3300048918 | Ga0496115_0480633 | Ga0496115_0480633_325_942 | 205 |
| 466 | 3300048919 | Ga0496116_0122364 | Ga0496116_0122364_637_1260 | 205 |
| 467 | 3300048921 | Ga0496118_0014017 | Ga0496118_0014017_4739_5362 | 205 |
| 468 | 3300048924 | Ga0496121_0000059 | Ga0496121_0000059_131690_132313 | 205 |
| 469 | 3300048924 | Ga0496121_0105913 | Ga0496121_0105913_360_977 | 205 |
| 470 | 3300048924 | Ga0496121_0216575 | Ga0496121_0216575_10_627 | 205 |
| 471 | 3300048926 | Ga0496123_0179087 | Ga0496123_0179087_284_901 | 205 |
| 472 | 3300049569 | Ga0501032_0308861 | Ga0501032_0308861_299_919 | 205 |
| 473 | 3300049570 | Ga0501033_0111129 | Ga0501033_0111129_912_1529 | 205 |
| 474 | 3300049579 | Ga0501043_0206723 | Ga0501043_0206723_789_1406 | 205 |
| 475 | 3300049581 | Ga0501047_0002933 | Ga0501047_0002933_14301_14918 | 205 |
| 476 | 3300049581 | Ga0501047_0065237 | Ga0501047_0065237_88_705 | 205 |
| 477 | 3300049581 | Ga0501047_0091858 | Ga0501047_0091858_2003_2620 | 205 |
| 478 | 3300049581 | Ga0501047_0112401 | Ga0501047_0112401_101_724 | 205 |
| 479 | 3300049581 | Ga0501047_0240499 | Ga0501047_0240499_587_1207 | 205 |
| 480 | 3300049582 | Ga0501048_0092541 | Ga0501048_0092541_426_1046 | 205 |
| 481 | 3300049586 | Ga0501070_0257167 | Ga0501070_0257167_47_667 | 205 |
| 482 | 3300049686 | Ga0501257_002053 | Ga0501257_002053_1017_1634 | 205 |
| 483 | 3300049822 | Ga0501035_0634393 | Ga0501035_0634393_174_791 | 205 |
| 484 | 3300049823 | Ga0501044_0005225 | Ga0501044_0005225_224_841 | 205 |
| 485 | 3300049823 | Ga0501044_0263518 | Ga0501044_0263518_191_811 | 205 |
| 486 | 3300049823 | Ga0501044_0310355 | Ga0501044_0310355_694_1314 | 205 |
| 487 | 3300049823 | Ga0501044_0569754 | Ga0501044_0569754_306_923 | 205 |
| 488 | 3300050489 | nmdc:mga03683_43059_c1 | nmdc:mga03683_43059_c1_352_969 | 205 |
| 489 | 3300050493 | nmdc:mga0k408_200610_c1 | nmdc:mga0k408_200610_c1_180_803 | 205 |
| 490 | 3300050496 | nmdc:mga07m45_30764_c1 | nmdc:mga07m45_30764_c1_1096_1713 | 205 |
| 491 | 3300053080 | Ga0500635_0000048 | Ga0500635_0000048_23055_23678 | 205 |
| 492 | 3300053087 | Ga0500643_018122 | Ga0500643_018122_1441_2061 | 205 |
| 493 | 3300053090 | Ga0500646_0110663 | Ga0500646_0110663_44_667 | 205 |
| 494 | 3300053091 | Ga0500647_0098144 | Ga0500647_0098144_641_1264 | 205 |
| 495 | 3300053092 | Ga0500583_0186355 | Ga0500583_0186355_12_629 | 205 |
| 496 | 3300053093 | Ga0500651_0183325 | Ga0500651_0183325_238_861 | 205 |
| 497 | 3300053103 | Ga0500555_002066 | Ga0500555_002066_257_880 | 205 |
| 498 | 3300053108 | Ga0500562_000146 | Ga0500562_000146_19587_20207 | 205 |
| 499 | 3300053108 | Ga0500562_001187 | Ga0500562_001187_1011_1640 | 205 |
| 500 | 3300053109 | Ga0500569_007140 | Ga0500569_007140_1705_2328 | 205 |
| 501 | 3300053111 | Ga0500572_036286 | Ga0500572_036286_112_735 | 205 |
| 502 | 3300053119 | Ga0500595_015940 | Ga0500595_015940_1354_1977 | 205 |
| 503 | 3300053119 | Ga0500595_049004 | Ga0500595_049004_489_1106 | 205 |
| 504 | 3300053121 | Ga0500607_025551 | Ga0500607_025551_2348_2971 | 205 |
| 505 | 3300053122 | Ga0500608_000187 | Ga0500608_000187_4774_5391 | 205 |
| 506 | 3300053123 | Ga0500614_002651 | Ga0500614_002651_183_806 | 205 |
| 507 | 3300053130 | Ga0500642_0100767 | Ga0500642_0100767_23_646 | 205 |
| 508 | 3300053130 | Ga0500642_0128924 | Ga0500642_0128924_485_1108 | 205 |
| 509 | 3300053146 | Ga0500588_0210200 | Ga0500588_0210200_28_645 | 205 |
| 510 | 3300053150 | Ga0500603_007476 | Ga0500603_007476_1675_2298 | 205 |
| 511 | 3300053162 | Ga0500638_043219 | Ga0500638_043219_1492_2115 | 205 |
| 512 | 3300053177 | Ga0500636_0011253 | Ga0500636_0011253_637_1260 | 205 |
| 513 | 3300053178 | Ga0500637_0165841 | Ga0500637_0165841_460_1083 | 205 |
| 514 | 3300053730 | Ga0500645_003039 | Ga0500645_003039_256_894 | 205 |
| 515 | 3300053735 | Ga0500596_015025 | Ga0500596_015025_194_817 | 205 |
| 516 | 3300003215 | JGI25153J46596_10034807 | JGI25153J46596_100348072 | 206 |
| 517 | 3300003322 | rootL2_10025033 | rootL2_100250331 | 206 |
| 518 | 3300003322 | rootL2_10025042 | rootL2_100250424 | 206 |
| 519 | 3300003771 | Ga0055526_1024695 | Ga0055526_10246952 | 206 |
| 520 | 3300003773 | Ga0055537_1004521 | Ga0055537_10045212 | 206 |
| 521 | 3300003794 | Ga0055531_10007738 | Ga0055531_100077386 | 206 |
| 522 | 3300005262 | Ga0065165_1001299 | Ga0065165_100129911 | 206 |
| 523 | 3300005455 | Ga0070663_100570848 | Ga0070663_1005708482 | 206 |
| 524 | 3300006048 | Ga0075363_100473288 | Ga0075363_1004732881 | 206 |
| 525 | 3300006186 | Ga0075369_10008852 | Ga0075369_100088524 | 206 |
| 526 | 3300006353 | Ga0075370_10241546 | Ga0075370_102415462 | 206 |
| 527 | 3300025263 | Ga0209565_1000402 | Ga0209565_100040228 | 206 |
| 528 | 3300025273 | Ga0209673_1000956 | Ga0209673_100095645 | 206 |
| 529 | 3300025273 | Ga0209673_1015564 | Ga0209673_10155642 | 206 |
| 530 | 3300025291 | Ga0209675_1010683 | Ga0209675_10106833 | 206 |
| 531 | 3300025295 | Ga0209564_1009991 | Ga0209564_10099914 | 206 |
| 532 | 3300025295 | Ga0209564_1032821 | Ga0209564_10328212 | 206 |
| 533 | 3300025295 | Ga0209564_1045539 | Ga0209564_10455392 | 206 |
| 534 | 3300025297 | Ga0209758_1002021 | Ga0209758_100202123 | 206 |
| 535 | 3300025297 | Ga0209758_1002093 | Ga0209758_100209323 | 206 |
| 536 | 3300025299 | Ga0209256_1001940 | Ga0209256_100194016 | 206 |
| 537 | 3300025299 | Ga0209256_1016311 | Ga0209256_10163112 | 206 |
| 538 | 3300025299 | Ga0209256_1040058 | Ga0209256_10400582 | 206 |
| 539 | 3300025304 | Ga0209257_1000186 | Ga0209257_1000186135 | 206 |
| 540 | 3300028794 | Ga0307515_10015777 | Ga0307515_1001577711 | 206 |
| 541 | 3300028794 | Ga0307515_10016786 | Ga0307515_1001678613 | 206 |
| 542 | 3300030522 | Ga0307512_10295428 | Ga0307512_102954281 | 206 |
| 543 | 3300031251 | Ga0265327_10017632 | Ga0265327_100176324 | 206 |
| 544 | 3300031911 | Ga0307412_10206480 | Ga0307412_102064802 | 206 |
| 545 | 3300035724 | Ga0373933_0332946 | Ga0373933_0332946_236_874 | 206 |
| 546 | 3300037853 | Ga0436364_1092164 | Ga0436364_1092164_915_1538 | 206 |
| 547 | 3300039450 | Ga0436363_0545590 | Ga0436363_0545590_121_741 | 206 |
| 548 | 3300042156 | Ga0439446_0013609 | Ga0439446_0013609_365_991 | 206 |
| 549 | 3300046452 | Ga0495617_074868 | Ga0495617_074868_460_1080 | 206 |
| 550 | 3300046453 | Ga0495627_003153 | Ga0495627_003153_974_1594 | 206 |
| 551 | 3300046457 | Ga0495590_0000589 | Ga0495590_0000589_12178_12798 | 206 |
| 552 | 3300046460 | Ga0495638_0001119 | Ga0495638_0001119_980_1600 | 206 |
| 553 | 3300046460 | Ga0495638_0007475 | Ga0495638_0007475_2790_3410 | 206 |
| 554 | 3300046460 | Ga0495638_0049281 | Ga0495638_0049281_1901_2521 | 206 |
| 555 | 3300046460 | Ga0495638_0162967 | Ga0495638_0162967_14_634 | 206 |
| 556 | 3300046471 | Ga0495650_0000403 | Ga0495650_0000403_50862_51482 | 206 |
| 557 | 3300046492 | Ga0495585_0071232 | Ga0495585_0071232_733_1359 | 206 |
| 558 | 3300046501 | Ga0495607_0033413 | Ga0495607_0033413_106_732 | 206 |
| 559 | 3300046506 | Ga0495583_0000005 | Ga0495583_0000005_126120_126740 | 206 |
| 560 | 3300046507 | Ga0495606_0003858 | Ga0495606_0003858_2178_2798 | 206 |
| 561 | 3300046512 | Ga0495610_0002475 | Ga0495610_0002475_4621_5241 | 206 |
| 562 | 3300046512 | Ga0495610_0004772 | Ga0495610_0004772_5956_6576 | 206 |
| 563 | 3300046512 | Ga0495610_0034131 | Ga0495610_0034131_1814_2434 | 206 |
| 564 | 3300046513 | Ga0495616_0000172 | Ga0495616_0000172_28457_29083 | 206 |
| 565 | 3300046515 | Ga0495620_0037176 | Ga0495620_0037176_1294_1914 | 206 |
| 566 | 3300046518 | Ga0495631_0004830 | Ga0495631_0004830_1652_2272 | 206 |
| 567 | 3300046519 | Ga0495632_0069706 | Ga0495632_0069706_459_1085 | 206 |
| 568 | 3300046520 | Ga0495637_0026229 | Ga0495637_0026229_1055_1675 | 206 |
| 569 | 3300046524 | Ga0495648_0014034 | Ga0495648_0014034_685_1305 | 206 |
| 570 | 3300046525 | Ga0495663_0030026 | Ga0495663_0030026_764_1384 | 206 |
| 571 | 3300046530 | Ga0495654_0000708 | Ga0495654_0000708_20299_20919 | 206 |
| 572 | 3300046530 | Ga0495654_0018186 | Ga0495654_0018186_2274_2894 | 206 |
| 573 | 3300046538 | Ga0495609_0105599 | Ga0495609_0105599_304_924 | 206 |
| 574 | 3300046542 | Ga0495597_0013122 | Ga0495597_0013122_2878_3498 | 206 |
| 575 | 3300046616 | Ga0495668_0000100 | Ga0495668_0000100_132300_132920 | 206 |
| 576 | 3300046616 | Ga0495668_0054552 | Ga0495668_0054552_948_1574 | 206 |
| 577 | 3300046660 | Ga0495625_0015370 | Ga0495625_0015370_664_1284 | 206 |
| 578 | 3300046660 | Ga0495625_0017433 | Ga0495625_0017433_359_979 | 206 |
| 579 | 3300046660 | Ga0495625_0020568 | Ga0495625_0020568_2033_2653 | 206 |
| 580 | 3300046660 | Ga0495625_0059935 | Ga0495625_0059935_1782_2402 | 206 |
| 581 | 3300046660 | Ga0495625_0196563 | Ga0495625_0196563_678_1298 | 206 |
| 582 | 3300046691 | Ga0495670_0215478 | Ga0495670_0215478_156_776 | 206 |
| 583 | 3300046810 | Ga0495660_0018592 | Ga0495660_0018592_1715_2341 | 206 |
| 584 | 3300047320 | Ga0495672_0001737 | Ga0495672_0001737_19675_20295 | 206 |
| 585 | 3300047446 | Ga0495679_054644 | Ga0495679_054644_206_826 | 206 |
| 586 | 3300047469 | Ga0495673_0000025 | Ga0495673_0000025_221379_221999 | 206 |
| 587 | 3300047469 | Ga0495673_0002412 | Ga0495673_0002412_9926_10546 | 206 |
| 588 | 3300047470 | Ga0495681_0032687 | Ga0495681_0032687_93_713 | 206 |
| 589 | 3300047472 | Ga0495686_0001965 | Ga0495686_0001965_9800_10420 | 206 |
| 590 | 3300048904 | Ga0496101_0068891 | Ga0496101_0068891_1193_1813 | 206 |
| 591 | 3300048909 | Ga0496106_0052300 | Ga0496106_0052300_728_1348 | 206 |
| 592 | 3300048910 | Ga0496107_0000063 | Ga0496107_0000063_19351_19971 | 206 |
| 593 | 3300048918 | Ga0496115_0225548 | Ga0496115_0225548_903_1523 | 206 |
| 594 | 3300048927 | Ga0496124_0021850 | Ga0496124_0021850_481_1101 | 206 |
| 595 | 3300048928 | Ga0496125_0185716 | Ga0496125_0185716_572_1192 | 206 |
| 596 | 3300048929 | Ga0496126_0311787 | Ga0496126_0311787_608_1228 | 206 |
| 597 | 3300049459 | Ga0495678_001968 | Ga0495678_001968_4094_4714 | 206 |
| 598 | 3300049671 | Ga0501238_000591 | Ga0501238_000591_1753_2373 | 206 |
| 599 | 3300049671 | Ga0501238_012001 | Ga0501238_012001_479_1099 | 206 |
| 600 | 3300050490 | nmdc:mga03n38_420517_c1 | nmdc:mga03n38_420517_c1_70_696 | 206 |
| 601 | 3300050496 | nmdc:mga07m45_158383_c1 | nmdc:mga07m45_158383_c1_207_833 | 206 |
| 602 | 3300050516 | nmdc:mga0sz30_5859_c1 | nmdc:mga0sz30_5859_c1_1769_2389 | 206 |
| 603 | 3300053086 | Ga0500578_0000913 | Ga0500578_0000913_5129_5749 | 206 |
| 604 | 3300053088 | Ga0500644_0026944 | Ga0500644_0026944_738_1358 | 206 |
| 605 | 3300053104 | Ga0500556_0000826 | Ga0500556_0000826_16459_17079 | 206 |
| 606 | 3300053108 | Ga0500562_006695 | Ga0500562_006695_1436_2056 | 206 |
| 607 | 3300053118 | Ga0500594_0000897 | Ga0500594_0000897_5054_5674 | 206 |
| 608 | 3300053123 | Ga0500614_003048 | Ga0500614_003048_2079_2699 | 206 |
| 609 | 3300053125 | Ga0500618_000319 | Ga0500618_000319_15826_16446 | 206 |
| 610 | 3300053134 | Ga0500658_0010151 | Ga0500658_0010151_2044_2664 | 206 |
| 611 | 3300053136 | Ga0500559_0000153 | Ga0500559_0000153_19949_20569 | 206 |
| 612 | 3300053136 | Ga0500559_0007015 | Ga0500559_0007015_672_1292 | 206 |
| 613 | 3300053142 | Ga0500577_0009083 | Ga0500577_0009083_299_919 | 206 |
| 614 | 3300053153 | Ga0500616_0020362 | Ga0500616_0020362_2138_2758 | 206 |
| 615 | 3300053156 | Ga0500622_0004117 | Ga0500622_0004117_3438_4064 | 206 |
| 616 | 3300053156 | Ga0500622_0025972 | Ga0500622_0025972_1651_2271 | 206 |
| 617 | 3300053156 | Ga0500622_0053777 | Ga0500622_0053777_56_676 | 206 |
| 618 | 3300053730 | Ga0500645_004474 | Ga0500645_004474_314_934 | 206 |
| 619 | 3300053731 | Ga0500609_001858 | Ga0500609_001858_669_1289 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8axp-assembly1.cif.gz_B | neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. | 0.9296 | 2 | 187 |
| 7csn-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from acinetobacter baumannii at 1.00 a resolution | 0.9175 | 1 | 193 |
| 1ryb-assembly1.cif.gz_A | crystal structure of the chloroplast group ii intron splicing factor crs2 | 0.9159 | 2 | 178 |
| 3v2i-assembly1.cif.gz_A | structure of a peptidyl-trna hydrolase (pth) from burkholderia thailandensis | 0.9079 | 1 | 186 |
| 4olj-assembly1.cif.gz_A | crystal structure of arg119gln mutant of peptidyl-trna hydrolase from acinetobacter baumannii at 1.49 a resolution | 0.9043 | 1 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54V95_265_452_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9118 | 62 | 187 | 3.40.50.1470 |
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.8954 | 1 | 191 | 3.40.50.1470 |
| af_Q10LI6_46_183_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.8939 | 2 | 135 | 3.40.50.1470 |
| af_Q86Y79_27_209_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.8933 | 2 | 181 | 3.40.50.1470 |
| 3neaA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.8855 | 1 | 189 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434SHI8-F1-model_v4 | Peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.9786 | 1 | 180 |
GO:0004045
|
| AF-A0A0Q4FF18-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9756 | 1 | 189 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A7C1P4V1-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9633 | 1 | 155 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A059E7J4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9607 | 2 | 201 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A4Q5XZD1-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9593 | 1 | 199 |
GO:0004045
GO:0005737 GO:0006412 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar