F469791

General Info

Members Datasets Scaffolds Average Seq Length
619 321 592 206

Family's Representative Sequence

Representative Sequence 3300004625|Ga0055543_1010658|Ga0055543_10106582
Length 231
Sequence VVTKAKPPKAKPRPKASSFLAGVDVLIIAGLGNPGPTYAKNRHNIGFMAVDEIARRWGFSAARSRFQAHASEGQIDTPQGPVRALILKPQGYYNESGRAVGEAVKFFKLDPAVDVVVFYDEIDLAPGRFRMKAGGGAAGNNGVRSITSQIGPHFRRARLGTGHPGDKALVQGHVLSDFHKADMKWVEPLLQACADAAPLMAMGEDEKYQAEVMRLAPAEKMDPRKLARGES

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
21 2849560528 Caulobacter zeae 410 Isolate Unclassified
22 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
23 2851153111 Caulobacter radicis 736 Isolate Unclassified
24 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
25 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
271 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
283 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
286 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
287 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
288 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
289 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
292 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
293 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
294 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
295 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
296 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
297 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
298 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
299 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
300 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
301 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
302 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
303 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
306 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
307 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
308 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
309 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
310 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
311 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
312 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
315 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
316 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
317 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
318 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
319 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.64
Metatranscriptomes 0
Isolates 4.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.55
Nodule 0.16
Rhizoplane 3.07
Rhizosphere 67.85
Stem 0
Stem Tuber 0
Unclassified 9.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10034807 3300003215 Bacteria 1640
2 rootL2_10025033 3300003322 Bacteria 2340
3 rootL2_10025042 3300003322 Bacteria 2508
4 Ga0055526_1024695 3300003771 Bacteria 1956
5 Ga0055537_1004521 3300003773 Bacteria 3963
6 Ga0055536_1003050 3300003781 Bacteria 9147
7 Ga0055536_1005222 3300003781 Bacteria 6407
8 Ga0055530_10003497 3300003791 Bacteria 8887
9 Ga0055530_10004335 3300003791 Bacteria 7380
10 Ga0055530_10008601 3300003791 Bacteria 4056
11 Ga0055530_10010190 3300003791 Bacteria 3505
12 Ga0055531_10001668 3300003794 Bacteria 15997
13 Ga0055531_10007738 3300003794 Bacteria 5796
14 Ga0055531_10038847 3300003794 Bacteria 1422
15 Ga0055543_1010658 3300004625 Bacteria 1916
16 Ga0065165_1001299 3300005262 Bacteria 28025
17 Ga0065165_1007831 3300005262 Bacteria 5141
18 Ga0070658_10072508 3300005327 Bacteria 2822
19 Ga0070658_10148497 3300005327 Bacteria 1961
20 Ga0070658_10242699 3300005327 Bacteria 1527
21 Ga0070658_10438400 3300005327 Bacteria 1125
22 Ga0070683_100781758 3300005329 Bacteria 915
23 Ga0070670_100000035 3300005331 Bacteria 157570
24 Ga0070670_100111338 3300005331 Bacteria 2359
25 Ga0068869_100503124 3300005334 Bacteria 1012
26 Ga0070666_10057189 3300005335 Bacteria 2635
27 Ga0070680_100081752 3300005336 Bacteria 2665
28 Ga0070660_100121721 3300005339 Bacteria 2083
29 Ga0070660_100246720 3300005339 Bacteria 1455
30 Ga0070660_100414739 3300005339 Bacteria 1114
31 Ga0070691_10005691 3300005341 Bacteria 5684
32 Ga0070661_100104125 3300005344 Bacteria 2114
33 Ga0070668_100001655 3300005347 Bacteria 16171
34 Ga0070668_100003652 3300005347 Bacteria 11349
35 Ga0070668_100005042 3300005347 Bacteria 9783
36 Ga0070668_100008290 3300005347 Bacteria 7713
37 Ga0070668_100062568 3300005347 Bacteria 2884
38 Ga0070669_100014476 3300005353 Bacteria 5613
39 Ga0070671_100008156 3300005355 Bacteria 8385
40 Ga0070671_100044283 3300005355 Bacteria 3698
41 Ga0070671_100140031 3300005355 Bacteria 2041
42 Ga0070673_100114753 3300005364 Bacteria 2239
43 Ga0070659_100002173 3300005366 Bacteria 13970
44 Ga0070659_100009683 3300005366 Bacteria 7081
45 Ga0070667_100000711 3300005367 Bacteria 32094
46 Ga0070667_100012351 3300005367 Bacteria 7064
47 Ga0070667_100035524 3300005367 Bacteria 4176
48 Ga0070667_100817038 3300005367 Bacteria 866
49 Ga0070713_100729594 3300005436 Bacteria 947
50 Ga0070663_100286146 3300005455 Bacteria 1315
51 Ga0070663_100570848 3300005455 Bacteria 948
52 Ga0070662_100381076 3300005457 Bacteria 1161
53 Ga0070681_10061903 3300005458 Bacteria 3716
54 Ga0070679_100014981 3300005530 Bacteria 7449
55 Ga0070679_100273069 3300005530 Bacteria 1644
56 Ga0068853_100038269 3300005539 Bacteria 4085
57 Ga0068853_100406572 3300005539 Bacteria 1275
58 Ga0070665_100000433 3300005548 Bacteria 60988
59 Ga0070665_100002042 3300005548 Bacteria 22721
60 Ga0070665_100002102 3300005548 Bacteria 22306
61 Ga0070665_100066800 3300005548 Bacteria 3607
62 Ga0070665_100230031 3300005548 Bacteria 1854
63 Ga0068855_100045250 3300005563 Bacteria 5205
64 Ga0068855_100118233 3300005563 Bacteria 3036
65 Ga0068855_100166242 3300005563 Bacteria 2500
66 Ga0070664_100150398 3300005564 Bacteria 2055
67 Ga0070664_100256593 3300005564 Bacteria 1572
68 Ga0068857_100331549 3300005577 Bacteria 1406
69 Ga0068854_100463315 3300005578 Bacteria 1061
70 Ga0068856_100060825 3300005614 Bacteria 3731
71 Ga0068856_100183347 3300005614 Bacteria 2107
72 Ga0068856_100202083 3300005614 Bacteria 2002
73 Ga0068856_100248032 3300005614 Bacteria 1796
74 Ga0070702_100282566 3300005615 Bacteria 1140
75 Ga0068852_100096346 3300005616 Bacteria 2659
76 Ga0068852_100655154 3300005616 Bacteria 1058
77 Ga0068859_100563028 3300005617 Bacteria 1234
78 Ga0068859_100579944 3300005617 Bacteria 1215
79 Ga0068859_100936731 3300005617 Bacteria 950
80 Ga0068864_100000102 3300005618 Bacteria 82743
81 Ga0068864_100000165 3300005618 Bacteria 60874
82 Ga0068864_100007387 3300005618 Bacteria 9045
83 Ga0068864_100061222 3300005618 Bacteria 3260
84 Ga0068864_100356324 3300005618 Bacteria 1382
85 Ga0068864_100448911 3300005618 Bacteria 1233
86 Ga0068861_100233239 3300005719 Bacteria 1562
87 Ga0068863_100000128 3300005841 Bacteria 79841
88 Ga0068863_100000958 3300005841 Bacteria 28976
89 Ga0068863_100003725 3300005841 Bacteria 15079
90 Ga0068863_100075883 3300005841 Bacteria 3180
91 Ga0068863_100291190 3300005841 Bacteria 1583
92 Ga0068858_100000117 3300005842 Bacteria 83778
93 Ga0068858_100008401 3300005842 Bacteria 9931
94 Ga0068858_100049265 3300005842 Bacteria 3901
95 Ga0068858_100130572 3300005842 Bacteria 2355
96 Ga0068858_100193698 3300005842 Bacteria 1921
97 Ga0068858_100351911 3300005842 Bacteria 1411
98 Ga0068860_100000100 3300005843 Bacteria 144580
99 Ga0068860_100000157 3300005843 Bacteria 110717
100 Ga0068860_100057712 3300005843 Bacteria 3690
101 Ga0068862_100000368 3300005844 Bacteria 48907
102 Ga0068862_100003705 3300005844 Bacteria 13061
103 Ga0068862_100008375 3300005844 Bacteria 8558
104 Ga0068862_100026735 3300005844 Bacteria 4852
105 Ga0068862_100041760 3300005844 Bacteria 3904
106 Ga0081455_10069249 3300005937 Bacteria 2934
107 Ga0081455_10197529 3300005937 Bacteria 1509
108 Ga0070717_10048558 3300006028 Bacteria 3481
109 Ga0075368_10011124 3300006042 Bacteria 3269
110 Ga0075363_100473288 3300006048 Bacteria 742
111 Ga0075364_10003750 3300006051 Bacteria 8680
112 Ga0075362_10017023 3300006177 Bacteria 2988
113 Ga0075367_10033916 3300006178 Bacteria 2945
114 Ga0075369_10008852 3300006186 Bacteria 3889
115 Ga0075366_10016922 3300006195 Bacteria 4190
116 Ga0075370_10025887 3300006353 Bacteria 3247
117 Ga0075370_10037819 3300006353 Bacteria 2714
118 Ga0075370_10241546 3300006353 Bacteria 1069
119 Ga0068865_100021928 3300006881 Bacteria 4159
120 Ga0068865_100450493 3300006881 Bacteria 1064
121 Ga0097620_100562930 3300006931 Bacteria 1234
122 Ga0097620_100579944 3300006931 Bacteria 1215
123 Ga0097620_100936931 3300006931 Bacteria 950
124 Ga0079104_1021617 3300006946 Bacteria 1748
125 Ga0105250_10018847 3300009092 Bacteria 2792
126 Ga0105240_10002229 3300009093 Bacteria 31523
127 Ga0105240_10010678 3300009093 Bacteria 12886
128 Ga0105240_10089734 3300009093 Bacteria 3759
129 Ga0105240_10097510 3300009093 Bacteria 3582
130 Ga0105240_10219630 3300009093 Bacteria 2215
131 Ga0105240_10251893 3300009093 Bacteria 2042
132 Ga0105240_10553010 3300009093 Bacteria 1273
133 Ga0105240_10941530 3300009093 Bacteria 927
134 Ga0105248_10000280 3300009177 Bacteria 60247
135 Ga0105248_10005436 3300009177 Bacteria 14002
136 Ga0105248_10049590 3300009177 Bacteria 4709
137 Ga0105248_10059152 3300009177 Bacteria 4304
138 Ga0105248_10064503 3300009177 Bacteria 4112
139 Ga0105248_10765278 3300009177 Bacteria 1090
140 Ga0105237_10272735 3300009545 Bacteria 1694
141 Ga0105238_10022800 3300009551 Bacteria 6381
142 Ga0105238_10113045 3300009551 Bacteria 2695
143 Ga0105238_10126384 3300009551 Bacteria 2535
144 Ga0105238_10207720 3300009551 Bacteria 1934
145 Ga0105238_10334368 3300009551 Bacteria 1502
146 Ga0105238_10675125 3300009551 Bacteria 1044
147 Ga0105249_10000525 3300009553 Bacteria 35250
148 Ga0105249_10224004 3300009553 Bacteria 1852
149 Ga0105239_10725713 3300010375 Bacteria 1137
150 Ga0157373_10001320 3300013100 Bacteria 18973
151 Ga0157373_10012399 3300013100 Bacteria 6268
152 Ga0157373_10124774 3300013100 Bacteria 1810
153 Ga0157370_10190336 3300013104 Bacteria 1905
154 Ga0157369_10350357 3300013105 Bacteria 1533
155 Ga0157369_11026376 3300013105 Bacteria 844
156 Ga0163162_10082033 3300013306 Bacteria 3296
157 Ga0163162_10704543 3300013306 Bacteria 1131
158 Ga0157372_11118425 3300013307 Bacteria 911
159 Ga0157375_10066003 3300013308 Bacteria 3610
160 Ga0157375_11171804 3300013308 Bacteria 901
161 Ga0163163_10003142 3300014325 Bacteria 14001
162 Ga0163163_10223875 3300014325 Bacteria 1930
163 Ga0163163_10920367 3300014325 Bacteria 938
164 Ga0163163_11081688 3300014325 Bacteria 865
165 Ga0157380_10282640 3300014326 Bacteria 1519
166 Ga0157379_10003132 3300014968 Bacteria 13995
167 Ga0157379_10108966 3300014968 Bacteria 2487
168 Ga0157379_10173970 3300014968 Bacteria 1944
169 Ga0157376_10465622 3300014969 Bacteria 1236
170 Ga0182007_10014986 3300015262 Bacteria 2906
171 Ga0213872_10047077 3300021361 Bacteria 1961
172 Ga0213874_10001579 3300021377 Bacteria 4765
173 Ga0213876_10000276 3300021384 Bacteria 47195
174 Ga0213876_10306173 3300021384 Bacteria 845
175 Ga0213875_10055927 3300021388 Bacteria 1848
176 Ga0213875_10256736 3300021388 Bacteria 825
177 Ga0209026_1007030 3300025250 Bacteria 2621
178 Ga0209026_1028809 3300025250 Bacteria 829
179 Ga0209148_1008212 3300025254 Bacteria 2110
180 Ga0209148_1009749 3300025254 Bacteria 1853
181 Ga0209565_1000402 3300025263 Bacteria 36267
182 Ga0209673_1000956 3300025273 Bacteria 36077
183 Ga0209673_1015564 3300025273 Bacteria 2882
184 Ga0209675_1010683 3300025291 Bacteria 3112
185 Ga0209676_1000467 3300025292 Bacteria 67659
186 Ga0209676_1000560 3300025292 Bacteria 56233
187 Ga0209564_1009991 3300025295 Bacteria 4433
188 Ga0209564_1032821 3300025295 Bacteria 1555
189 Ga0209564_1045539 3300025295 Bacteria 1127
190 Ga0209758_1000331 3300025297 Bacteria 88922
191 Ga0209758_1002021 3300025297 Bacteria 21830
192 Ga0209758_1002093 3300025297 Bacteria 21212
193 Ga0209050_1000130 3300025298 Bacteria 186070
194 Ga0209050_1000461 3300025298 Bacteria 72912
195 Ga0209050_1001568 3300025298 Bacteria 23778
196 Ga0209256_1001940 3300025299 Bacteria 18855
197 Ga0209256_1008763 3300025299 Bacteria 4606
198 Ga0209256_1016311 3300025299 Bacteria 2540
199 Ga0209256_1040058 3300025299 Bacteria 1200
200 Ga0209051_1024035 3300025303 Bacteria 2519
201 Ga0209257_1000059 3300025304 Bacteria 378097
202 Ga0209257_1000186 3300025304 Bacteria 154365
203 Ga0209257_1000406 3300025304 Bacteria 83846
204 Ga0209257_1001256 3300025304 Bacteria 31336
205 Ga0209257_1006979 3300025304 Bacteria 7030
206 Ga0207680_10022747 3300025903 Bacteria 3413
207 Ga0207680_10077277 3300025903 Bacteria 2082
208 Ga0207680_10524106 3300025903 Bacteria 845
209 Ga0207705_10000859 3300025909 Bacteria 24922
210 Ga0207705_10141061 3300025909 Bacteria 1800
211 Ga0207707_10025232 3300025912 Bacteria 5199
212 Ga0207707_10026000 3300025912 Bacteria 5119
213 Ga0207707_10044838 3300025912 Bacteria 3854
214 Ga0207695_10001222 3300025913 Bacteria 44042
215 Ga0207695_10004245 3300025913 Bacteria 19683
216 Ga0207695_10017891 3300025913 Bacteria 8212
217 Ga0207695_10031617 3300025913 Bacteria 5802
218 Ga0207695_10127102 3300025913 Bacteria 2510
219 Ga0207671_10385287 3300025914 Bacteria 1114
220 Ga0207671_10601324 3300025914 Bacteria 876
221 Ga0207660_10012963 3300025917 Bacteria 5461
222 Ga0207660_10069444 3300025917 Bacteria 2558
223 Ga0207662_10300347 3300025918 Bacteria 1067
224 Ga0207657_10005498 3300025919 Bacteria 13230
225 Ga0207657_10101743 3300025919 Bacteria 2384
226 Ga0207657_10582931 3300025919 Bacteria 873
227 Ga0207657_10609865 3300025919 Bacteria 851
228 Ga0207649_10259001 3300025920 Bacteria 1256
229 Ga0207652_10009199 3300025921 Bacteria 7952
230 Ga0207652_10036965 3300025921 Bacteria 4131
231 Ga0207652_10411271 3300025921 Bacteria 1220
232 Ga0207681_10190318 3300025923 Bacteria 1569
233 Ga0207694_10007116 3300025924 Bacteria 8500
234 Ga0207694_10085746 3300025924 Bacteria 2479
235 Ga0207694_10096466 3300025924 Bacteria 2338
236 Ga0207694_10367296 3300025924 Bacteria 1193
237 Ga0207650_10000327 3300025925 Bacteria 46298
238 Ga0207650_10643808 3300025925 Bacteria 893
239 Ga0207644_10019082 3300025931 Bacteria 4648
240 Ga0207644_10098234 3300025931 Bacteria 2194
241 Ga0207644_10347652 3300025931 Bacteria 1203
242 Ga0207690_10000159 3300025932 Bacteria 52852
243 Ga0207690_10015653 3300025932 Bacteria 4601
244 Ga0207706_10065814 3300025933 Bacteria 3190
245 Ga0207704_10002381 3300025938 Bacteria 8448
246 Ga0207704_10272173 3300025938 Bacteria 1283
247 Ga0207711_10003708 3300025941 Bacteria 13166
248 Ga0207711_10007949 3300025941 Bacteria 8872
249 Ga0207711_10011616 3300025941 Bacteria 7317
250 Ga0207711_10081654 3300025941 Bacteria 2825
251 Ga0207711_10098929 3300025941 Bacteria 2578
252 Ga0207711_10258633 3300025941 Bacteria 1599
253 Ga0207689_10376150 3300025942 Bacteria 1182
254 Ga0207661_10306521 3300025944 Bacteria 1425
255 Ga0207679_10128111 3300025945 Bacteria 2032
256 Ga0207667_10020112 3300025949 Bacteria 7433
257 Ga0207667_10026359 3300025949 Bacteria 6352
258 Ga0207667_10189088 3300025949 Bacteria 2113
259 Ga0207712_10192593 3300025961 Bacteria 1610
260 Ga0207668_10000025 3300025972 Bacteria 131733
261 Ga0207668_10001450 3300025972 Bacteria 13923
262 Ga0207668_10102183 3300025972 Bacteria 2132
263 Ga0207658_10000300 3300025986 Bacteria 51413
264 Ga0207658_10003134 3300025986 Bacteria 11830
265 Ga0207658_10013264 3300025986 Bacteria 5628
266 Ga0207658_10086967 3300025986 Bacteria 2412
267 Ga0207677_10502724 3300026023 Bacteria 1048
268 Ga0207703_10002585 3300026035 Bacteria 15635
269 Ga0207703_10006338 3300026035 Bacteria 9455
270 Ga0207639_10014523 3300026041 Bacteria 5542
271 Ga0207639_10152840 3300026041 Bacteria 1935
272 Ga0207678_10261526 3300026067 Bacteria 1483
273 Ga0207702_10446397 3300026078 Bacteria 1254
274 Ga0207641_10000005 3300026088 Bacteria 470841
275 Ga0207641_10000777 3300026088 Bacteria 34097
276 Ga0207641_10000994 3300026088 Bacteria 29003
277 Ga0207641_10068771 3300026088 Bacteria 3037
278 Ga0207641_10223451 3300026088 Bacteria 1747
279 Ga0207641_10294648 3300026088 Bacteria 1530
280 Ga0207641_10456053 3300026088 Bacteria 1236
281 Ga0207676_10000066 3300026095 Bacteria 105425
282 Ga0207676_10000145 3300026095 Bacteria 61785
283 Ga0207676_10004781 3300026095 Bacteria 9608
284 Ga0207676_10044856 3300026095 Bacteria 3413
285 Ga0207676_10093677 3300026095 Bacteria 2473
286 Ga0207674_10146840 3300026116 Bacteria 2317
287 Ga0207674_10203578 3300026116 Bacteria 1929
288 Ga0207675_100170229 3300026118 Bacteria 2082
289 Ga0207675_100227004 3300026118 Bacteria 1800
290 Ga0207675_100497806 3300026118 Bacteria 1213
291 Ga0207675_100733425 3300026118 Bacteria 998
292 Ga0209981_1000259 3300027378 Bacteria 6787
293 Ga0209995_1037821 3300027471 Bacteria 813
294 Ga0209983_1011978 3300027665 Bacteria 1777
295 Ga0209813_10068370 3300027866 Bacteria 1150
296 Ga0268266_10000003 3300028379 Bacteria 1701703
297 Ga0268266_10000814 3300028379 Bacteria 41101
298 Ga0268266_10000815 3300028379 Bacteria 40979
299 Ga0268266_10372963 3300028379 Bacteria 1344
300 Ga0268265_10000532 3300028380 Bacteria 38863
301 Ga0268265_10007428 3300028380 Bacteria 7399
302 Ga0268265_10013139 3300028380 Bacteria 5625
303 Ga0268265_10014390 3300028380 Bacteria 5389
304 Ga0268265_10171432 3300028380 Bacteria 1855
305 Ga0268265_10243183 3300028380 Bacteria 1589
306 Ga0268264_10000002 3300028381 Bacteria 1153045
307 Ga0268264_10000211 3300028381 Bacteria 117108
308 Ga0268264_10085306 3300028381 Bacteria 2710
309 Ga0268264_10417545 3300028381 Bacteria 1293
310 Ga0265337_1023161 3300028556 Bacteria 1913
311 Ga0265326_10016968 3300028558 Bacteria 2103
312 Ga0265334_10072210 3300028573 Bacteria 1284
313 Ga0307517_10002267 3300028786 Bacteria 31005
314 Ga0307517_10072546 3300028786 Bacteria 3067
315 Ga0307515_10015777 3300028794 Bacteria 13898
316 Ga0307515_10016786 3300028794 Bacteria 13388
317 Ga0265338_10005275 3300028800 Bacteria 16925
318 Ga0265338_10009016 3300028800 Bacteria 12001
319 Ga0265338_10052890 3300028800 Bacteria 3639
320 Ga0265338_10170717 3300028800 Bacteria 1668
321 Ga0265338_10380583 3300028800 Bacteria 1009
322 Ga0307511_10044683 3300030521 Bacteria 3675
323 Ga0307512_10295428 3300030522 Bacteria 760
324 Ga0265340_10038859 3300031247 Bacteria 2352
325 Ga0265331_10197635 3300031250 Bacteria 906
326 Ga0265327_10001631 3300031251 Bacteria 27036
327 Ga0265327_10002802 3300031251 Bacteria 17599
328 Ga0265327_10017632 3300031251 Bacteria 4467
329 Ga0307513_10000053 3300031456 Bacteria 149356
330 Ga0307513_10000790 3300031456 Bacteria 45976
331 Ga0307513_10004139 3300031456 Bacteria 19425
332 Ga0307513_10008435 3300031456 Bacteria 13193
333 Ga0265314_10107420 3300031711 Bacteria 1781
334 Ga0265314_10132382 3300031711 Bacteria 1554
335 Ga0307516_10000019 3300031730 Bacteria 196679
336 Ga0307410_10037010 3300031852 Bacteria 3184
337 Ga0307406_10685984 3300031901 Bacteria 854
338 Ga0307407_10110006 3300031903 Bacteria 1728
339 Ga0307412_10206480 3300031911 Bacteria 1496
340 Ga0307412_10632104 3300031911 Bacteria 911
341 Ga0307416_100546811 3300032002 Bacteria 1231
342 Ga0307414_10103708 3300032004 Bacteria 2146
343 Ga0307510_10047498 3300033180 Bacteria 4598
344 Ga0307510_10174377 3300033180 Bacteria 1724
345 Ga0373936_0034195 3300035113 Bacteria 2018
346 Ga0373935_0118334 3300035692 Bacteria 1767
347 Ga0373927_0003786 3300035695 Bacteria 10732
348 Ga0373933_0332946 3300035724 Bacteria 985
349 Ga0373933_0485269 3300035724 Bacteria 809
350 Ga0373925_0004623 3300037068 Bacteria 10393
351 Ga0395899_0000016 3300037312 Bacteria 468322
352 Ga0395899_0000373 3300037312 Bacteria 53717
353 Ga0395899_0217152 3300037312 Bacteria 1326
354 Ga0395899_0240661 3300037312 Bacteria 1246
355 Ga0395900_0000052 3300037418 Bacteria 223910
356 Ga0395900_0031072 3300037418 Bacteria 5486
357 Ga0395900_0210642 3300037418 Bacteria 1962
358 Ga0395900_0287498 3300037418 Bacteria 1634
359 Ga0395900_0558856 3300037418 Bacteria 1088
360 Ga0395898_0003873 3300037466 Bacteria 16525
361 Ga0395898_0006482 3300037466 Bacteria 12499
362 Ga0395898_0272676 3300037466 Bacteria 1614
363 Ga0395905_0092295 3300037471 Bacteria 2839
364 Ga0395905_0101606 3300037471 Bacteria 2699
365 Ga0395905_0133213 3300037471 Bacteria 2337
366 Ga0395905_0299461 3300037471 Bacteria 1495
367 Ga0395905_0536042 3300037471 Bacteria 1071
368 Ga0436364_0089346 3300037853 Bacteria 1551
369 Ga0436364_0548564 3300037853 Bacteria 2193
370 Ga0436364_1092164 3300037853 Bacteria 2491
371 Ga0395901_0000001 3300038443 Bacteria 800383
372 Ga0395901_0168174 3300038443 Bacteria 2301
373 Ga0436365_0608786 3300039437 Bacteria 20013
374 Ga0436365_0738680 3300039437 Bacteria 1236
375 Ga0436365_1407991 3300039437 Bacteria 749
376 Ga0436365_1899948 3300039437 Bacteria 1505
377 Ga0436360_1186917 3300039438 Bacteria 2618
378 Ga0436360_1366790 3300039438 Bacteria 1384
379 Ga0436361_0293275 3300039447 Bacteria 4781
380 Ga0436361_0587620 3300039447 Bacteria 1562
381 Ga0436361_0709707 3300039447 Bacteria 2552
382 Ga0436361_0851335 3300039447 Bacteria 858
383 Ga0436361_1100879 3300039447 Bacteria 23663
384 Ga0436363_0545590 3300039450 Bacteria 1750
385 Ga0436363_1321778 3300039450 Bacteria 5821
386 Ga0439446_0013609 3300042156 Bacteria 2235
387 Ga0466969_0172954 3300044656 Bacteria 990
388 Ga0466966_0150141 3300044684 Bacteria 1422
389 Ga0466957_0082183 3300044842 Bacteria 2008
390 Ga0466957_0559211 3300044842 Bacteria 798
391 Ga0495617_074868 3300046452 Bacteria 1111
392 Ga0495627_003153 3300046453 Bacteria 7442
393 Ga0495590_0000589 3300046457 Bacteria 17176
394 Ga0495629_0254460 3300046459 Bacteria 1208
395 Ga0495638_0001119 3300046460 Bacteria 26080
396 Ga0495638_0007475 3300046460 Bacteria 7830
397 Ga0495638_0049281 3300046460 Bacteria 2633
398 Ga0495638_0061418 3300046460 Bacteria 2322
399 Ga0495638_0162967 3300046460 Bacteria 1285
400 Ga0495650_0000403 3300046471 Bacteria 71792
401 Ga0495585_0071232 3300046492 Bacteria 1895
402 Ga0495607_0033413 3300046501 Bacteria 3130
403 Ga0495583_0000005 3300046506 Bacteria 636894
404 Ga0495583_0021172 3300046506 Bacteria 3350
405 Ga0495583_0066187 3300046506 Bacteria 1599
406 Ga0495606_0003858 3300046507 Bacteria 15477
407 Ga0495610_0002475 3300046512 Bacteria 15486
408 Ga0495610_0004772 3300046512 Bacteria 9888
409 Ga0495610_0034131 3300046512 Bacteria 2623
410 Ga0495610_0056599 3300046512 Bacteria 1885
411 Ga0495616_0000172 3300046513 Bacteria 54960
412 Ga0495620_0031248 3300046515 Bacteria 2442
413 Ga0495620_0037176 3300046515 Bacteria 2171
414 Ga0495628_0123949 3300046516 Bacteria 1980
415 Ga0495631_0004830 3300046518 Bacteria 7104
416 Ga0495632_0069706 3300046519 Bacteria 1692
417 Ga0495637_0026229 3300046520 Bacteria 2618
418 Ga0495643_0023869 3300046522 Bacteria 3472
419 Ga0495644_0022884 3300046523 Bacteria 2381
420 Ga0495648_0000372 3300046524 Bacteria 49423
421 Ga0495648_0014034 3300046524 Bacteria 5890
422 Ga0495663_0030026 3300046525 Bacteria 1608
423 Ga0495642_0045769 3300046528 Bacteria 1788
424 Ga0495642_0248004 3300046528 Bacteria 778
425 Ga0495654_0000708 3300046530 Bacteria 26141
426 Ga0495654_0018186 3300046530 Bacteria 3687
427 Ga0495609_0105599 3300046538 Bacteria 1218
428 Ga0495609_0281384 3300046538 Bacteria 680
429 Ga0495597_0005539 3300046542 Bacteria 6674
430 Ga0495597_0013122 3300046542 Bacteria 3977
431 Ga0495645_0011325 3300046543 Bacteria 6272
432 Ga0495622_0001326 3300046557 Bacteria 12674
433 Ga0495668_0000100 3300046616 Bacteria 137684
434 Ga0495668_0000342 3300046616 Bacteria 61973
435 Ga0495668_0054552 3300046616 Bacteria 2208
436 Ga0495668_0112168 3300046616 Bacteria 1491
437 Ga0495668_0145182 3300046616 Bacteria 1299
438 Ga0495611_0004244 3300046648 Bacteria 6240
439 Ga0495625_0015370 3300046660 Bacteria 6065
440 Ga0495625_0017433 3300046660 Bacteria 5623
441 Ga0495625_0020568 3300046660 Bacteria 5092
442 Ga0495625_0059935 3300046660 Bacteria 2698
443 Ga0495625_0132268 3300046660 Bacteria 1689
444 Ga0495625_0196563 3300046660 Bacteria 1333
445 Ga0495669_0000012 3300046684 Bacteria 157373
446 Ga0495669_0006893 3300046684 Bacteria 4759
447 Ga0495613_0013180 3300046689 Bacteria 6142
448 Ga0495670_0211907 3300046691 Bacteria 1028
449 Ga0495670_0215478 3300046691 Bacteria 1019
450 Ga0495660_0018592 3300046810 Bacteria 3995
451 Ga0495660_0038634 3300046810 Bacteria 2653
452 Ga0495672_0001737 3300047320 Bacteria 21063
453 Ga0495679_054644 3300047446 Bacteria 1188
454 Ga0495673_0000025 3300047469 Bacteria 512352
455 Ga0495673_0002003 3300047469 Bacteria 14993
456 Ga0495673_0002412 3300047469 Bacteria 13176
457 Ga0495681_0032687 3300047470 Bacteria 2616
458 Ga0495686_0001965 3300047472 Bacteria 20419
459 Ga0495686_0006019 3300047472 Bacteria 9422
460 Ga0495686_0009474 3300047472 Bacteria 7010
461 Ga0496100_0047082 3300048903 Bacteria 2777
462 Ga0496100_0414381 3300048903 Bacteria 1028
463 Ga0496101_0037941 3300048904 Bacteria 3420
464 Ga0496101_0068891 3300048904 Bacteria 2588
465 Ga0496102_0334162 3300048905 Bacteria 1427
466 Ga0496103_0244583 3300048906 Bacteria 1154
467 Ga0496106_0052300 3300048909 Bacteria 3081
468 Ga0496107_0000063 3300048910 Bacteria 52938
469 Ga0496107_0132990 3300048910 Bacteria 1837
470 Ga0496108_0033802 3300048911 Bacteria 4247
471 Ga0496109_0037712 3300048912 Bacteria 4367
472 Ga0496111_0285676 3300048914 Bacteria 1224
473 Ga0496112_0030512 3300048915 Bacteria 5218
474 Ga0496112_0307857 3300048915 Bacteria 1529
475 Ga0496115_0011071 3300048918 Bacteria 6758
476 Ga0496115_0123236 3300048918 Bacteria 2134
477 Ga0496115_0124346 3300048918 Bacteria 2124
478 Ga0496115_0225548 3300048918 Bacteria 1546
479 Ga0496115_0480633 3300048918 Bacteria 1000
480 Ga0496116_0122364 3300048919 Bacteria 1503
481 Ga0496118_0014017 3300048921 Bacteria 7529
482 Ga0496121_0000059 3300048924 Bacteria 278177
483 Ga0496121_0105913 3300048924 Bacteria 2157
484 Ga0496121_0216575 3300048924 Bacteria 1352
485 Ga0496123_0179087 3300048926 Bacteria 1109
486 Ga0496124_0021850 3300048927 Bacteria 5886
487 Ga0496125_0185716 3300048928 Bacteria 1379
488 Ga0496126_0001304 3300048929 Bacteria 39731
489 Ga0496126_0311787 3300048929 Bacteria 1295
490 Ga0495678_001968 3300049459 Bacteria 14796
491 Ga0501032_0308861 3300049569 Bacteria 1022
492 Ga0501033_0004787 3300049570 Bacteria 10806
493 Ga0501033_0111129 3300049570 Bacteria 1994
494 Ga0501034_0038199 3300049571 Bacteria 4862
495 Ga0501034_0484303 3300049571 Bacteria 1152
496 Ga0501037_0073555 3300049573 Bacteria 2485
497 Ga0501042_0199535 3300049578 Bacteria 1443
498 Ga0501043_0206723 3300049579 Bacteria 1522
499 Ga0501047_0000219 3300049581 Bacteria 68712
500 Ga0501047_0002933 3300049581 Bacteria 16195
501 Ga0501047_0065237 3300049581 Bacteria 3510
502 Ga0501047_0091858 3300049581 Bacteria 2914
503 Ga0501047_0112401 3300049581 Bacteria 2606
504 Ga0501047_0240499 3300049581 Bacteria 1661
505 Ga0501048_0092541 3300049582 Bacteria 2132
506 Ga0501070_0257167 3300049586 Bacteria 1428
507 Ga0501072_0447495 3300049588 Bacteria 1023
508 Ga0501073_0019355 3300049589 Bacteria 4916
509 Ga0501238_000591 3300049671 Bacteria 4159
510 Ga0501238_012001 3300049671 Bacteria 1168
511 Ga0501257_002053 3300049686 Bacteria 4196
512 Ga0501080_0009262 3300049742 Bacteria 8978
513 Ga0501083_0005287 3300049744 Bacteria 9126
514 Ga0501083_0169037 3300049744 Bacteria 1429
515 Ga0501035_0398765 3300049822 Bacteria 1145
516 Ga0501035_0634393 3300049822 Bacteria 868
517 Ga0501044_0005225 3300049823 Bacteria 14446
518 Ga0501044_0010782 3300049823 Bacteria 9917
519 Ga0501044_0263518 3300049823 Bacteria 1661
520 Ga0501044_0310355 3300049823 Bacteria 1504
521 Ga0501044_0569754 3300049823 Bacteria 1028
522 nmdc:mga03683_43059_c1 3300050489 Bacteria 1861
523 nmdc:mga03n38_420517_c1 3300050490 Bacteria 739
524 nmdc:mga00v17_12959_c1 3300050491 Bacteria 4616
525 nmdc:mga0k408_200610_c1 3300050493 Bacteria 1191
526 nmdc:mga0k408_34126_c2 3300050493 Bacteria 1347
527 nmdc:mga07m45_158383_c1 3300050496 Bacteria 1314
528 nmdc:mga07m45_20741_c1 3300050496 Bacteria 3572
529 nmdc:mga07m45_30764_c1 3300050496 Bacteria 2974
530 nmdc:mga07m45_40373_c1 3300050496 Bacteria 2611
531 nmdc:mga0sz30_5859_c1 3300050516 Bacteria 4530
532 Ga0500635_0000048 3300053080 Bacteria 80957
533 Ga0500578_0000913 3300053086 Bacteria 33199
534 Ga0500643_000316 3300053087 Bacteria 39239
535 Ga0500643_018122 3300053087 Bacteria 2343
536 Ga0500643_021576 3300053087 Bacteria 2085
537 Ga0500644_0000287 3300053088 Bacteria 27540
538 Ga0500644_0026944 3300053088 Bacteria 1783
539 Ga0500646_0110663 3300053090 Bacteria 873
540 Ga0500647_0002309 3300053091 Bacteria 7048
541 Ga0500647_0098144 3300053091 Bacteria 1400
542 Ga0500583_0186355 3300053092 Bacteria 1033
543 Ga0500651_0183325 3300053093 Bacteria 1242
544 Ga0500641_0000386 3300053096 Bacteria 16347
545 Ga0500555_002066 3300053103 Bacteria 5903
546 Ga0500556_0000826 3300053104 Bacteria 17919
547 Ga0500556_0022771 3300053104 Bacteria 2038
548 Ga0500557_131380 3300053105 Bacteria 829
549 Ga0500562_000146 3300053108 Bacteria 20862
550 Ga0500562_001187 3300053108 Bacteria 6427
551 Ga0500562_006655 3300053108 Bacteria 2912
552 Ga0500562_006695 3300053108 Bacteria 2904
553 Ga0500569_007140 3300053109 Bacteria 2493
554 Ga0500572_015001 3300053111 Bacteria 1946
555 Ga0500572_036286 3300053111 Bacteria 1407
556 Ga0500594_0000897 3300053118 Bacteria 6391
557 Ga0500595_015940 3300053119 Bacteria 2808
558 Ga0500595_049004 3300053119 Bacteria 1317
559 Ga0500607_025551 3300053121 Bacteria 3286
560 Ga0500608_000187 3300053122 Bacteria 24884
561 Ga0500614_002651 3300053123 Bacteria 3961
562 Ga0500614_003048 3300053123 Bacteria 3643
563 Ga0500618_000319 3300053125 Bacteria 35375
564 Ga0500642_0100767 3300053130 Bacteria 1343
565 Ga0500642_0128924 3300053130 Bacteria 1185
566 Ga0500658_0010151 3300053134 Bacteria 3471
567 Ga0500559_0000153 3300053136 Bacteria 54641
568 Ga0500559_0007015 3300053136 Bacteria 5035
569 Ga0500564_000284 3300053138 Bacteria 14061
570 Ga0500577_0009083 3300053142 Bacteria 2869
571 Ga0500588_0210200 3300053146 Bacteria 723
572 Ga0500590_045331 3300053148 Bacteria 2251
573 Ga0500603_007476 3300053150 Bacteria 2400
574 Ga0500616_0020362 3300053153 Bacteria 3727
575 Ga0500616_0028135 3300053153 Bacteria 3100
576 Ga0500619_222950 3300053154 Bacteria 627
577 Ga0500622_0004117 3300053156 Bacteria 9309
578 Ga0500622_0006823 3300053156 Bacteria 6565
579 Ga0500622_0025972 3300053156 Bacteria 3092
580 Ga0500622_0053777 3300053156 Bacteria 2067
581 Ga0500638_043219 3300053162 Bacteria 2188
582 Ga0500636_0011253 3300053177 Bacteria 5234
583 Ga0500637_0165841 3300053178 Bacteria 1271
584 Ga0500645_002282 3300053730 Bacteria 8703
585 Ga0500645_003039 3300053730 Bacteria 7058
586 Ga0500645_003565 3300053730 Bacteria 6262
587 Ga0500645_004474 3300053730 Bacteria 5354
588 Ga0500609_001858 3300053731 Bacteria 3062
589 Ga0500596_015025 3300053735 Bacteria 1163
590 Ga0501084_0380134 3300054114 Bacteria 1193
591 Ga0501082_0013144 3300060353 Bacteria 7118
592 Ga0501082_0065968 3300060353 Bacteria 3117

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046538 Ga0495609_0281384 Ga0495609_0281384_114_668 182
2 3300053154 Ga0500619_222950 Ga0500619_222950_62_616 182
3 3300031911 Ga0307412_10632104 Ga0307412_106321042 183
4 3300046460 Ga0495638_0061418 Ga0495638_0061418_1761_2312 183
5 3300005578 Ga0068854_100463315 Ga0068854_1004633152 197
6 3300009551 Ga0105238_10126384 Ga0105238_101263841 197
7 3300025924 Ga0207694_10367296 Ga0207694_103672961 197
8 3300005336 Ga0070680_100081752 Ga0070680_1000817523 199
9 3300005341 Ga0070691_10005691 Ga0070691_100056912 199
10 3300005347 Ga0070668_100062568 Ga0070668_1000625683 199
11 3300005458 Ga0070681_10061903 Ga0070681_100619033 199
12 3300005530 Ga0070679_100014981 Ga0070679_1000149814 199
13 3300009093 Ga0105240_10251893 Ga0105240_102518932 199
14 3300013104 Ga0157370_10190336 Ga0157370_101903363 199
15 3300025912 Ga0207707_10044838 Ga0207707_100448383 199
16 3300025913 Ga0207695_10004245 Ga0207695_1000424520 199
17 3300025917 Ga0207660_10069444 Ga0207660_100694442 199
18 3300025921 Ga0207652_10036965 Ga0207652_100369653 199
19 3300025949 Ga0207667_10020112 Ga0207667_100201126 199
20 3300025972 Ga0207668_10102183 Ga0207668_101021832 199
21 3300049570 Ga0501033_0004787 Ga0501033_0004787_5953_6552 199
22 3300049571 Ga0501034_0038199 Ga0501034_0038199_1335_1934 199
23 3300049573 Ga0501037_0073555 Ga0501037_0073555_754_1353 199
24 3300049823 Ga0501044_0010782 Ga0501044_0010782_2157_2756 199
25 iso_pu_bacteria 2643221598 2643998410 199
26 iso_pu_bacteria 2643221614 2644086724 199
27 iso_pu_bacteria 2643221661 2644341678 199
28 iso_pu_bacteria 2643221666 2644367965 199
29 iso_pu_bacteria 2849560528 2849561623 199
30 iso_pu_bacteria 2849573788 2849574486 199
31 iso_pu_bacteria 2851153111 2851153872 199
32 3300005617 Ga0068859_100936731 Ga0068859_1009367312 200
33 3300005937 Ga0081455_10197529 Ga0081455_101975291 200
34 3300006931 Ga0097620_100936931 Ga0097620_1009369312 200
35 3300009177 Ga0105248_10765278 Ga0105248_107652782 200
36 3300028381 Ga0268264_10417545 Ga0268264_104175452 200
37 3300048918 Ga0496115_0123236 Ga0496115_0123236_1278_1892 200
38 3300049589 Ga0501073_0019355 Ga0501073_0019355_3425_4030 200
39 3300049744 Ga0501083_0169037 Ga0501083_0169037_347_952 200
40 3300053096 Ga0500641_0000386 Ga0500641_0000386_6234_6842 200
41 3300054114 Ga0501084_0380134 Ga0501084_0380134_331_936 200
42 3300060353 Ga0501082_0065968 Ga0501082_0065968_1511_2116 200
43 iso_pu_bacteria 2791355048 2792461664 200
44 iso_pu_bacteria 2843744320 2843746123 200
45 iso_pu_bacteria 2898329390 2898330483 200
46 3300005344 Ga0070661_100104125 Ga0070661_1001041253 201
47 3300005539 Ga0068853_100038269 Ga0068853_1000382692 201
48 3300005564 Ga0070664_100150398 Ga0070664_1001503981 201
49 3300005844 Ga0068862_100008375 Ga0068862_1000083753 201
50 3300005937 Ga0081455_10069249 Ga0081455_100692493 201
51 3300013100 Ga0157373_10001320 Ga0157373_1000132024 201
52 3300013100 Ga0157373_10012399 Ga0157373_100123998 201
53 3300025919 Ga0207657_10609865 Ga0207657_106098652 201
54 3300025945 Ga0207679_10128111 Ga0207679_101281113 201
55 3300026041 Ga0207639_10014523 Ga0207639_100145237 201
56 3300028380 Ga0268265_10007428 Ga0268265_100074288 201
57 3300039438 Ga0436360_1186917 Ga0436360_1186917_169_777 201
58 3300039438 Ga0436360_1366790 Ga0436360_1366790_267_878 201
59 3300046616 Ga0495668_0145182 Ga0495668_0145182_364_972 201
60 3300046689 Ga0495613_0013180 Ga0495613_0013180_1950_2555 201
61 3300049578 Ga0501042_0199535 Ga0501042_0199535_291_899 201
62 3300049581 Ga0501047_0000219 Ga0501047_0000219_19803_20420 201
63 3300049588 Ga0501072_0447495 Ga0501072_0447495_42_659 201
64 3300049742 Ga0501080_0009262 Ga0501080_0009262_4358_4975 201
65 3300049744 Ga0501083_0005287 Ga0501083_0005287_4028_4645 201
66 3300053091 Ga0500647_0002309 Ga0500647_0002309_248_874 201
67 3300053111 Ga0500572_015001 Ga0500572_015001_1002_1607 201
68 3300053148 Ga0500590_045331 Ga0500590_045331_148_753 201
69 3300060353 Ga0501082_0013144 Ga0501082_0013144_2824_3441 201
70 iso_pu_bacteria 2857504554 2857508027 201
71 iso_pu_bacteria 2884960567 2884963120 201
72 3300031456 Ga0307513_10000053 Ga0307513_1000005353 202
73 3300035695 Ga0373927_0003786 Ga0373927_0003786_2720_3328 202
74 3300037068 Ga0373925_0004623 Ga0373925_0004623_2381_2989 202
75 3300047472 Ga0495686_0009474 Ga0495686_0009474_4259_4867 202
76 3300048929 Ga0496126_0001304 Ga0496126_0001304_4513_5121 202
77 3300053087 Ga0500643_000316 Ga0500643_000316_31438_32049 202
78 3300053105 Ga0500557_131380 Ga0500557_131380_127_738 202
79 3300053153 Ga0500616_0028135 Ga0500616_0028135_2000_2611 202
80 3300053730 Ga0500645_002282 Ga0500645_002282_3005_3616 202
81 iso_pu_bacteria 2510917020 2511121757 202
82 iso_pu_bacteria 2582581279 2585149000 202
83 iso_pu_bacteria 2585428106 2587915372 202
84 iso_pu_bacteria 2643221545 2643749200 202
85 iso_pu_bacteria 2643221583 2643922896 202
86 iso_pu_bacteria 2643221584 2643927101 202
87 iso_pu_bacteria 2643221640 2644223927 202
88 iso_pu_bacteria 2643221642 2644232913 202
89 iso_pu_bacteria 2643221691 2644509025 202
90 iso_pu_bacteria 2818991435 2819536304 202
91 iso_pu_bacteria 2818991454 2819644559 202
92 iso_pu_bacteria 2928531327 2928534815 202
93 3300005614 Ga0068856_100060825 Ga0068856_1000608253 203
94 3300006178 Ga0075367_10033916 Ga0075367_100339163 203
95 3300006195 Ga0075366_10016922 Ga0075366_100169224 203
96 3300006353 Ga0075370_10025887 Ga0075370_100258872 203
97 3300015262 Ga0182007_10014986 Ga0182007_100149863 203
98 3300027665 Ga0209983_1011978 Ga0209983_10119783 203
99 3300028556 Ga0265337_1023161 Ga0265337_10231612 203
100 3300031901 Ga0307406_10685984 Ga0307406_106859841 203
101 3300032002 Ga0307416_100546811 Ga0307416_1005468112 203
102 3300032004 Ga0307414_10103708 Ga0307414_101037082 203
103 3300039437 Ga0436365_1899948 Ga0436365_1899948_606_1229 203
104 3300050493 nmdc:mga0k408_34126_c2 nmdc:mga0k408_34126_c2_238_852 203
105 3300050496 nmdc:mga07m45_20741_c1 nmdc:mga07m45_20741_c1_2190_2804 203
106 3300053087 Ga0500643_021576 Ga0500643_021576_380_994 203
107 3300053104 Ga0500556_0022771 Ga0500556_0022771_394_1008 203
108 3300053108 Ga0500562_006655 Ga0500562_006655_525_1139 203
109 3300053156 Ga0500622_0006823 Ga0500622_0006823_5312_5926 203
110 3300053730 Ga0500645_003565 Ga0500645_003565_19_633 203
111 3300006042 Ga0075368_10011124 Ga0075368_100111244 204
112 3300006051 Ga0075364_10003750 Ga0075364_100037507 204
113 3300009551 Ga0105238_10675125 Ga0105238_106751251 204
114 3300025299 Ga0209256_1008763 Ga0209256_10087633 204
115 3300027866 Ga0209813_10068370 Ga0209813_100683702 204
116 3300031730 Ga0307516_10000019 Ga0307516_10000019162 204
117 3300033180 Ga0307510_10047498 Ga0307510_100474983 204
118 3300037312 Ga0395899_0000016 Ga0395899_0000016_445323_445946 204
119 3300037312 Ga0395899_0240661 Ga0395899_0240661_124_750 204
120 3300037418 Ga0395900_0287498 Ga0395900_0287498_734_1360 204
121 3300046524 Ga0495648_0000372 Ga0495648_0000372_4614_5228 204
122 3300046684 Ga0495669_0000012 Ga0495669_0000012_67839_68453 204
123 3300047469 Ga0495673_0002003 Ga0495673_0002003_12531_13145 204
124 3300048910 Ga0496107_0132990 Ga0496107_0132990_811_1437 204
125 3300049571 Ga0501034_0484303 Ga0501034_0484303_283_909 204
126 3300049822 Ga0501035_0398765 Ga0501035_0398765_315_941 204
127 3300050491 nmdc:mga00v17_12959_c1 nmdc:mga00v17_12959_c1_2256_2873 204
128 3300050496 nmdc:mga07m45_40373_c1 nmdc:mga07m45_40373_c1_1777_2394 204
129 3300053088 Ga0500644_0000287 Ga0500644_0000287_18411_19025 204
130 3300053138 Ga0500564_000284 Ga0500564_000284_8329_8943 204
131 iso_pu_bacteria 2582581280 2585151638 204
132 iso_pu_bacteria 2582581293 2585195488 204
133 iso_pu_bacteria 2643221552 2643781318 204
134 3300003781 Ga0055536_1003050 Ga0055536_10030504 205
135 3300003781 Ga0055536_1005222 Ga0055536_10052224 205
136 3300003791 Ga0055530_10003497 Ga0055530_100034974 205
137 3300003791 Ga0055530_10004335 Ga0055530_100043354 205
138 3300003791 Ga0055530_10008601 Ga0055530_100086013 205
139 3300003791 Ga0055530_10010190 Ga0055530_100101902 205
140 3300003794 Ga0055531_10001668 Ga0055531_1000166815 205
141 3300003794 Ga0055531_10038847 Ga0055531_100388472 205
142 3300004625 Ga0055543_1010658 Ga0055543_10106582 205
143 3300005262 Ga0065165_1007831 Ga0065165_10078315 205
144 3300005327 Ga0070658_10072508 Ga0070658_100725082 205
145 3300005327 Ga0070658_10148497 Ga0070658_101484973 205
146 3300005327 Ga0070658_10242699 Ga0070658_102426991 205
147 3300005327 Ga0070658_10438400 Ga0070658_104384002 205
148 3300005329 Ga0070683_100781758 Ga0070683_1007817581 205
149 3300005331 Ga0070670_100000035 Ga0070670_100000035110 205
150 3300005331 Ga0070670_100111338 Ga0070670_1001113381 205
151 3300005334 Ga0068869_100503124 Ga0068869_1005031241 205
152 3300005335 Ga0070666_10057189 Ga0070666_100571892 205
153 3300005339 Ga0070660_100121721 Ga0070660_1001217212 205
154 3300005339 Ga0070660_100246720 Ga0070660_1002467202 205
155 3300005339 Ga0070660_100414739 Ga0070660_1004147392 205
156 3300005347 Ga0070668_100001655 Ga0070668_1000016556 205
157 3300005347 Ga0070668_100003652 Ga0070668_10000365210 205
158 3300005347 Ga0070668_100005042 Ga0070668_1000050428 205
159 3300005347 Ga0070668_100008290 Ga0070668_1000082906 205
160 3300005353 Ga0070669_100014476 Ga0070669_1000144766 205
161 3300005355 Ga0070671_100008156 Ga0070671_1000081562 205
162 3300005355 Ga0070671_100044283 Ga0070671_1000442832 205
163 3300005355 Ga0070671_100140031 Ga0070671_1001400313 205
164 3300005364 Ga0070673_100114753 Ga0070673_1001147533 205
165 3300005366 Ga0070659_100002173 Ga0070659_1000021734 205
166 3300005366 Ga0070659_100009683 Ga0070659_1000096837 205
167 3300005367 Ga0070667_100000711 Ga0070667_10000071110 205
168 3300005367 Ga0070667_100012351 Ga0070667_1000123515 205
169 3300005367 Ga0070667_100035524 Ga0070667_1000355241 205
170 3300005367 Ga0070667_100817038 Ga0070667_1008170382 205
171 3300005436 Ga0070713_100729594 Ga0070713_1007295941 205
172 3300005455 Ga0070663_100286146 Ga0070663_1002861463 205
173 3300005457 Ga0070662_100381076 Ga0070662_1003810762 205
174 3300005530 Ga0070679_100273069 Ga0070679_1002730692 205
175 3300005539 Ga0068853_100406572 Ga0068853_1004065722 205
176 3300005548 Ga0070665_100000433 Ga0070665_10000043331 205
177 3300005548 Ga0070665_100002042 Ga0070665_10000204218 205
178 3300005548 Ga0070665_100002102 Ga0070665_10000210211 205
179 3300005548 Ga0070665_100066800 Ga0070665_1000668005 205
180 3300005548 Ga0070665_100230031 Ga0070665_1002300312 205
181 3300005563 Ga0068855_100045250 Ga0068855_1000452504 205
182 3300005563 Ga0068855_100118233 Ga0068855_1001182332 205
183 3300005563 Ga0068855_100166242 Ga0068855_1001662423 205
184 3300005564 Ga0070664_100256593 Ga0070664_1002565932 205
185 3300005577 Ga0068857_100331549 Ga0068857_1003315492 205
186 3300005614 Ga0068856_100183347 Ga0068856_1001833473 205
187 3300005614 Ga0068856_100202083 Ga0068856_1002020833 205
188 3300005614 Ga0068856_100248032 Ga0068856_1002480321 205
189 3300005615 Ga0070702_100282566 Ga0070702_1002825662 205
190 3300005616 Ga0068852_100096346 Ga0068852_1000963462 205
191 3300005616 Ga0068852_100655154 Ga0068852_1006551542 205
192 3300005617 Ga0068859_100563028 Ga0068859_1005630281 205
193 3300005617 Ga0068859_100579944 Ga0068859_1005799442 205
194 3300005618 Ga0068864_100000102 Ga0068864_10000010256 205
195 3300005618 Ga0068864_100000165 Ga0068864_10000016520 205
196 3300005618 Ga0068864_100007387 Ga0068864_10000738710 205
197 3300005618 Ga0068864_100061222 Ga0068864_1000612223 205
198 3300005618 Ga0068864_100356324 Ga0068864_1003563242 205
199 3300005618 Ga0068864_100448911 Ga0068864_1004489112 205
200 3300005719 Ga0068861_100233239 Ga0068861_1002332392 205
201 3300005841 Ga0068863_100000128 Ga0068863_10000012815 205
202 3300005841 Ga0068863_100000958 Ga0068863_10000095825 205
203 3300005841 Ga0068863_100003725 Ga0068863_1000037255 205
204 3300005841 Ga0068863_100075883 Ga0068863_1000758831 205
205 3300005841 Ga0068863_100291190 Ga0068863_1002911902 205
206 3300005842 Ga0068858_100000117 Ga0068858_10000011714 205
207 3300005842 Ga0068858_100008401 Ga0068858_1000084013 205
208 3300005842 Ga0068858_100049265 Ga0068858_1000492654 205
209 3300005842 Ga0068858_100130572 Ga0068858_1001305723 205
210 3300005842 Ga0068858_100193698 Ga0068858_1001936981 205
211 3300005842 Ga0068858_100351911 Ga0068858_1003519111 205
212 3300005843 Ga0068860_100000100 Ga0068860_10000010099 205
213 3300005843 Ga0068860_100000157 Ga0068860_10000015796 205
214 3300005843 Ga0068860_100057712 Ga0068860_1000577122 205
215 3300005844 Ga0068862_100000368 Ga0068862_1000003683 205
216 3300005844 Ga0068862_100003705 Ga0068862_10000370514 205
217 3300005844 Ga0068862_100026735 Ga0068862_1000267352 205
218 3300005844 Ga0068862_100041760 Ga0068862_1000417602 205
219 3300006028 Ga0070717_10048558 Ga0070717_100485583 205
220 3300006177 Ga0075362_10017023 Ga0075362_100170233 205
221 3300006353 Ga0075370_10037819 Ga0075370_100378193 205
222 3300006881 Ga0068865_100021928 Ga0068865_1000219283 205
223 3300006881 Ga0068865_100450493 Ga0068865_1004504932 205
224 3300006931 Ga0097620_100562930 Ga0097620_1005629301 205
225 3300006931 Ga0097620_100579944 Ga0097620_1005799442 205
226 3300006946 Ga0079104_1021617 Ga0079104_10216173 205
227 3300009092 Ga0105250_10018847 Ga0105250_100188472 205
228 3300009093 Ga0105240_10002229 Ga0105240_100022295 205
229 3300009093 Ga0105240_10010678 Ga0105240_100106784 205
230 3300009093 Ga0105240_10089734 Ga0105240_100897344 205
231 3300009093 Ga0105240_10097510 Ga0105240_100975103 205
232 3300009093 Ga0105240_10219630 Ga0105240_102196303 205
233 3300009093 Ga0105240_10553010 Ga0105240_105530102 205
234 3300009093 Ga0105240_10941530 Ga0105240_109415301 205
235 3300009177 Ga0105248_10000280 Ga0105248_100002804 205
236 3300009177 Ga0105248_10005436 Ga0105248_100054366 205
237 3300009177 Ga0105248_10049590 Ga0105248_100495902 205
238 3300009177 Ga0105248_10059152 Ga0105248_100591524 205
239 3300009177 Ga0105248_10064503 Ga0105248_100645033 205
240 3300009545 Ga0105237_10272735 Ga0105237_102727351 205
241 3300009551 Ga0105238_10022800 Ga0105238_100228002 205
242 3300009551 Ga0105238_10113045 Ga0105238_101130453 205
243 3300009551 Ga0105238_10207720 Ga0105238_102077201 205
244 3300009551 Ga0105238_10334368 Ga0105238_103343682 205
245 3300009553 Ga0105249_10000525 Ga0105249_100005252 205
246 3300009553 Ga0105249_10224004 Ga0105249_102240042 205
247 3300010375 Ga0105239_10725713 Ga0105239_107257132 205
248 3300013100 Ga0157373_10124774 Ga0157373_101247742 205
249 3300013105 Ga0157369_10350357 Ga0157369_103503571 205
250 3300013105 Ga0157369_11026376 Ga0157369_110263761 205
251 3300013306 Ga0163162_10082033 Ga0163162_100820333 205
252 3300013306 Ga0163162_10704543 Ga0163162_107045432 205
253 3300013307 Ga0157372_11118425 Ga0157372_111184252 205
254 3300013308 Ga0157375_10066003 Ga0157375_100660033 205
255 3300013308 Ga0157375_11171804 Ga0157375_111718042 205
256 3300014325 Ga0163163_10003142 Ga0163163_1000314219 205
257 3300014325 Ga0163163_10223875 Ga0163163_102238752 205
258 3300014325 Ga0163163_10920367 Ga0163163_109203671 205
259 3300014325 Ga0163163_11081688 Ga0163163_110816882 205
260 3300014326 Ga0157380_10282640 Ga0157380_102826401 205
261 3300014968 Ga0157379_10003132 Ga0157379_100031326 205
262 3300014968 Ga0157379_10108966 Ga0157379_101089663 205
263 3300014968 Ga0157379_10173970 Ga0157379_101739702 205
264 3300014969 Ga0157376_10465622 Ga0157376_104656221 205
265 3300021361 Ga0213872_10047077 Ga0213872_100470771 205
266 3300021377 Ga0213874_10001579 Ga0213874_100015792 205
267 3300021384 Ga0213876_10000276 Ga0213876_1000027643 205
268 3300021384 Ga0213876_10306173 Ga0213876_103061732 205
269 3300021388 Ga0213875_10055927 Ga0213875_100559272 205
270 3300021388 Ga0213875_10256736 Ga0213875_102567361 205
271 3300025250 Ga0209026_1007030 Ga0209026_10070303 205
272 3300025250 Ga0209026_1028809 Ga0209026_10288091 205
273 3300025254 Ga0209148_1008212 Ga0209148_10082123 205
274 3300025254 Ga0209148_1009749 Ga0209148_10097491 205
275 3300025292 Ga0209676_1000467 Ga0209676_100046721 205
276 3300025292 Ga0209676_1000560 Ga0209676_100056021 205
277 3300025297 Ga0209758_1000331 Ga0209758_100033194 205
278 3300025298 Ga0209050_1000130 Ga0209050_100013068 205
279 3300025298 Ga0209050_1000461 Ga0209050_100046150 205
280 3300025298 Ga0209050_1001568 Ga0209050_10015685 205
281 3300025303 Ga0209051_1024035 Ga0209051_10240353 205
282 3300025304 Ga0209257_1000059 Ga0209257_1000059263 205
283 3300025304 Ga0209257_1000406 Ga0209257_100040683 205
284 3300025304 Ga0209257_1001256 Ga0209257_100125612 205
285 3300025304 Ga0209257_1006979 Ga0209257_10069793 205
286 3300025903 Ga0207680_10022747 Ga0207680_100227472 205
287 3300025903 Ga0207680_10077277 Ga0207680_100772773 205
288 3300025903 Ga0207680_10524106 Ga0207680_105241061 205
289 3300025909 Ga0207705_10000859 Ga0207705_100008595 205
290 3300025909 Ga0207705_10141061 Ga0207705_101410612 205
291 3300025912 Ga0207707_10025232 Ga0207707_100252323 205
292 3300025912 Ga0207707_10026000 Ga0207707_100260001 205
293 3300025913 Ga0207695_10001222 Ga0207695_1000122246 205
294 3300025913 Ga0207695_10017891 Ga0207695_100178916 205
295 3300025913 Ga0207695_10031617 Ga0207695_100316173 205
296 3300025913 Ga0207695_10127102 Ga0207695_101271023 205
297 3300025914 Ga0207671_10385287 Ga0207671_103852871 205
298 3300025914 Ga0207671_10601324 Ga0207671_106013242 205
299 3300025917 Ga0207660_10012963 Ga0207660_100129634 205
300 3300025918 Ga0207662_10300347 Ga0207662_103003472 205
301 3300025919 Ga0207657_10005498 Ga0207657_100054985 205
302 3300025919 Ga0207657_10101743 Ga0207657_101017433 205
303 3300025919 Ga0207657_10582931 Ga0207657_105829311 205
304 3300025920 Ga0207649_10259001 Ga0207649_102590012 205
305 3300025921 Ga0207652_10009199 Ga0207652_100091994 205
306 3300025921 Ga0207652_10411271 Ga0207652_104112711 205
307 3300025923 Ga0207681_10190318 Ga0207681_101903182 205
308 3300025924 Ga0207694_10007116 Ga0207694_100071166 205
309 3300025924 Ga0207694_10085746 Ga0207694_100857462 205
310 3300025924 Ga0207694_10096466 Ga0207694_100964661 205
311 3300025925 Ga0207650_10000327 Ga0207650_100003279 205
312 3300025925 Ga0207650_10643808 Ga0207650_106438082 205
313 3300025931 Ga0207644_10019082 Ga0207644_100190822 205
314 3300025931 Ga0207644_10098234 Ga0207644_100982342 205
315 3300025931 Ga0207644_10347652 Ga0207644_103476522 205
316 3300025932 Ga0207690_10000159 Ga0207690_1000015947 205
317 3300025932 Ga0207690_10015653 Ga0207690_100156534 205
318 3300025933 Ga0207706_10065814 Ga0207706_100658143 205
319 3300025938 Ga0207704_10002381 Ga0207704_100023816 205
320 3300025938 Ga0207704_10272173 Ga0207704_102721732 205
321 3300025941 Ga0207711_10003708 Ga0207711_100037084 205
322 3300025941 Ga0207711_10007949 Ga0207711_1000794910 205
323 3300025941 Ga0207711_10011616 Ga0207711_100116164 205
324 3300025941 Ga0207711_10081654 Ga0207711_100816542 205
325 3300025941 Ga0207711_10098929 Ga0207711_100989292 205
326 3300025941 Ga0207711_10258633 Ga0207711_102586331 205
327 3300025942 Ga0207689_10376150 Ga0207689_103761502 205
328 3300025944 Ga0207661_10306521 Ga0207661_103065212 205
329 3300025949 Ga0207667_10026359 Ga0207667_100263596 205
330 3300025949 Ga0207667_10189088 Ga0207667_101890883 205
331 3300025961 Ga0207712_10192593 Ga0207712_101925932 205
332 3300025972 Ga0207668_10000025 Ga0207668_1000002549 205
333 3300025972 Ga0207668_10001450 Ga0207668_100014507 205
334 3300025986 Ga0207658_10000300 Ga0207658_1000030057 205
335 3300025986 Ga0207658_10003134 Ga0207658_1000313410 205
336 3300025986 Ga0207658_10013264 Ga0207658_100132642 205
337 3300025986 Ga0207658_10086967 Ga0207658_100869672 205
338 3300026023 Ga0207677_10502724 Ga0207677_105027242 205
339 3300026035 Ga0207703_10002585 Ga0207703_100025853 205
340 3300026035 Ga0207703_10006338 Ga0207703_100063387 205
341 3300026041 Ga0207639_10152840 Ga0207639_101528402 205
342 3300026067 Ga0207678_10261526 Ga0207678_102615263 205
343 3300026078 Ga0207702_10446397 Ga0207702_104463972 205
344 3300026088 Ga0207641_10000005 Ga0207641_10000005397 205
345 3300026088 Ga0207641_10000777 Ga0207641_1000077721 205
346 3300026088 Ga0207641_10000994 Ga0207641_1000099427 205
347 3300026088 Ga0207641_10068771 Ga0207641_100687713 205
348 3300026088 Ga0207641_10223451 Ga0207641_102234513 205
349 3300026088 Ga0207641_10294648 Ga0207641_102946482 205
350 3300026088 Ga0207641_10456053 Ga0207641_104560531 205
351 3300026095 Ga0207676_10000066 Ga0207676_1000006684 205
352 3300026095 Ga0207676_10000145 Ga0207676_1000014514 205
353 3300026095 Ga0207676_10004781 Ga0207676_100047811 205
354 3300026095 Ga0207676_10044856 Ga0207676_100448562 205
355 3300026095 Ga0207676_10093677 Ga0207676_100936772 205
356 3300026116 Ga0207674_10146840 Ga0207674_101468402 205
357 3300026116 Ga0207674_10203578 Ga0207674_102035782 205
358 3300026118 Ga0207675_100170229 Ga0207675_1001702292 205
359 3300026118 Ga0207675_100227004 Ga0207675_1002270041 205
360 3300026118 Ga0207675_100497806 Ga0207675_1004978062 205
361 3300026118 Ga0207675_100733425 Ga0207675_1007334252 205
362 3300027378 Ga0209981_1000259 Ga0209981_10002594 205
363 3300027471 Ga0209995_1037821 Ga0209995_10378212 205
364 3300028379 Ga0268266_10000003 Ga0268266_10000003576 205
365 3300028379 Ga0268266_10000814 Ga0268266_1000081414 205
366 3300028379 Ga0268266_10000815 Ga0268266_100008157 205
367 3300028379 Ga0268266_10372963 Ga0268266_103729632 205
368 3300028380 Ga0268265_10000532 Ga0268265_100005326 205
369 3300028380 Ga0268265_10013139 Ga0268265_100131392 205
370 3300028380 Ga0268265_10014390 Ga0268265_100143906 205
371 3300028380 Ga0268265_10171432 Ga0268265_101714322 205
372 3300028380 Ga0268265_10243183 Ga0268265_102431832 205
373 3300028381 Ga0268264_10000002 Ga0268264_10000002739 205
374 3300028381 Ga0268264_10000211 Ga0268264_1000021157 205
375 3300028381 Ga0268264_10085306 Ga0268264_100853062 205
376 3300028558 Ga0265326_10016968 Ga0265326_100169682 205
377 3300028573 Ga0265334_10072210 Ga0265334_100722102 205
378 3300028786 Ga0307517_10002267 Ga0307517_100022673 205
379 3300028786 Ga0307517_10072546 Ga0307517_100725462 205
380 3300028800 Ga0265338_10005275 Ga0265338_100052759 205
381 3300028800 Ga0265338_10009016 Ga0265338_100090168 205
382 3300028800 Ga0265338_10052890 Ga0265338_100528902 205
383 3300028800 Ga0265338_10170717 Ga0265338_101707172 205
384 3300028800 Ga0265338_10380583 Ga0265338_103805832 205
385 3300030521 Ga0307511_10044683 Ga0307511_100446834 205
386 3300031247 Ga0265340_10038859 Ga0265340_100388592 205
387 3300031250 Ga0265331_10197635 Ga0265331_101976352 205
388 3300031251 Ga0265327_10001631 Ga0265327_1000163126 205
389 3300031251 Ga0265327_10002802 Ga0265327_100028026 205
390 3300031456 Ga0307513_10000790 Ga0307513_1000079031 205
391 3300031456 Ga0307513_10004139 Ga0307513_1000413915 205
392 3300031456 Ga0307513_10008435 Ga0307513_100084358 205
393 3300031711 Ga0265314_10107420 Ga0265314_101074202 205
394 3300031711 Ga0265314_10132382 Ga0265314_101323822 205
395 3300031852 Ga0307410_10037010 Ga0307410_100370103 205
396 3300031903 Ga0307407_10110006 Ga0307407_101100062 205
397 3300033180 Ga0307510_10174377 Ga0307510_101743773 205
398 3300035113 Ga0373936_0034195 Ga0373936_0034195_1216_1836 205
399 3300035692 Ga0373935_0118334 Ga0373935_0118334_271_891 205
400 3300035724 Ga0373933_0485269 Ga0373933_0485269_50_676 205
401 3300037312 Ga0395899_0000373 Ga0395899_0000373_21226_21846 205
402 3300037312 Ga0395899_0217152 Ga0395899_0217152_180_803 205
403 3300037418 Ga0395900_0000052 Ga0395900_0000052_90614_91234 205
404 3300037418 Ga0395900_0031072 Ga0395900_0031072_3518_4141 205
405 3300037418 Ga0395900_0210642 Ga0395900_0210642_429_1049 205
406 3300037418 Ga0395900_0558856 Ga0395900_0558856_426_1052 205
407 3300037466 Ga0395898_0003873 Ga0395898_0003873_4657_5277 205
408 3300037466 Ga0395898_0006482 Ga0395898_0006482_359_982 205
409 3300037466 Ga0395898_0272676 Ga0395898_0272676_881_1507 205
410 3300037471 Ga0395905_0092295 Ga0395905_0092295_2002_2625 205
411 3300037471 Ga0395905_0101606 Ga0395905_0101606_1600_2223 205
412 3300037471 Ga0395905_0133213 Ga0395905_0133213_1240_1860 205
413 3300037471 Ga0395905_0299461 Ga0395905_0299461_212_835 205
414 3300037471 Ga0395905_0536042 Ga0395905_0536042_28_651 205
415 3300037853 Ga0436364_0089346 Ga0436364_0089346_102_728 205
416 3300037853 Ga0436364_0548564 Ga0436364_0548564_422_1042 205
417 3300038443 Ga0395901_0000001 Ga0395901_0000001_696775_697395 205
418 3300038443 Ga0395901_0168174 Ga0395901_0168174_490_1113 205
419 3300039437 Ga0436365_0608786 Ga0436365_0608786_11342_11968 205
420 3300039437 Ga0436365_0738680 Ga0436365_0738680_459_1079 205
421 3300039437 Ga0436365_1407991 Ga0436365_1407991_97_717 205
422 3300039447 Ga0436361_0293275 Ga0436361_0293275_580_1206 205
423 3300039447 Ga0436361_0587620 Ga0436361_0587620_57_683 205
424 3300039447 Ga0436361_0709707 Ga0436361_0709707_1218_1844 205
425 3300039447 Ga0436361_0851335 Ga0436361_0851335_28_654 205
426 3300039447 Ga0436361_1100879 Ga0436361_1100879_12151_12774 205
427 3300039450 Ga0436363_1321778 Ga0436363_1321778_1603_2229 205
428 3300044656 Ga0466969_0172954 Ga0466969_0172954_158_778 205
429 3300044684 Ga0466966_0150141 Ga0466966_0150141_755_1387 205
430 3300044842 Ga0466957_0082183 Ga0466957_0082183_757_1374 205
431 3300044842 Ga0466957_0559211 Ga0466957_0559211_52_672 205
432 3300046459 Ga0495629_0254460 Ga0495629_0254460_162_785 205
433 3300046506 Ga0495583_0021172 Ga0495583_0021172_1199_1816 205
434 3300046506 Ga0495583_0066187 Ga0495583_0066187_865_1488 205
435 3300046512 Ga0495610_0056599 Ga0495610_0056599_378_1070 205
436 3300046515 Ga0495620_0031248 Ga0495620_0031248_324_947 205
437 3300046516 Ga0495628_0123949 Ga0495628_0123949_818_1438 205
438 3300046522 Ga0495643_0023869 Ga0495643_0023869_1155_1778 205
439 3300046523 Ga0495644_0022884 Ga0495644_0022884_943_1560 205
440 3300046528 Ga0495642_0045769 Ga0495642_0045769_422_1039 205
441 3300046528 Ga0495642_0248004 Ga0495642_0248004_23_640 205
442 3300046542 Ga0495597_0005539 Ga0495597_0005539_331_954 205
443 3300046543 Ga0495645_0011325 Ga0495645_0011325_314_934 205
444 3300046557 Ga0495622_0001326 Ga0495622_0001326_9702_10325 205
445 3300046616 Ga0495668_0000342 Ga0495668_0000342_58443_59060 205
446 3300046616 Ga0495668_0112168 Ga0495668_0112168_456_1073 205
447 3300046648 Ga0495611_0004244 Ga0495611_0004244_793_1410 205
448 3300046660 Ga0495625_0132268 Ga0495625_0132268_927_1544 205
449 3300046684 Ga0495669_0006893 Ga0495669_0006893_856_1476 205
450 3300046691 Ga0495670_0211907 Ga0495670_0211907_114_737 205
451 3300046810 Ga0495660_0038634 Ga0495660_0038634_297_920 205
452 3300047472 Ga0495686_0006019 Ga0495686_0006019_7891_8514 205
453 3300048903 Ga0496100_0047082 Ga0496100_0047082_481_1098 205
454 3300048903 Ga0496100_0414381 Ga0496100_0414381_15_635 205
455 3300048904 Ga0496101_0037941 Ga0496101_0037941_1490_2107 205
456 3300048905 Ga0496102_0334162 Ga0496102_0334162_252_875 205
457 3300048906 Ga0496103_0244583 Ga0496103_0244583_34_657 205
458 3300048911 Ga0496108_0033802 Ga0496108_0033802_2765_3382 205
459 3300048912 Ga0496109_0037712 Ga0496109_0037712_2507_3124 205
460 3300048914 Ga0496111_0285676 Ga0496111_0285676_352_972 205
461 3300048915 Ga0496112_0030512 Ga0496112_0030512_779_1414 205
462 3300048915 Ga0496112_0307857 Ga0496112_0307857_358_975 205
463 3300048918 Ga0496115_0011071 Ga0496115_0011071_2692_3312 205
464 3300048918 Ga0496115_0124346 Ga0496115_0124346_1023_1664 205
465 3300048918 Ga0496115_0480633 Ga0496115_0480633_325_942 205
466 3300048919 Ga0496116_0122364 Ga0496116_0122364_637_1260 205
467 3300048921 Ga0496118_0014017 Ga0496118_0014017_4739_5362 205
468 3300048924 Ga0496121_0000059 Ga0496121_0000059_131690_132313 205
469 3300048924 Ga0496121_0105913 Ga0496121_0105913_360_977 205
470 3300048924 Ga0496121_0216575 Ga0496121_0216575_10_627 205
471 3300048926 Ga0496123_0179087 Ga0496123_0179087_284_901 205
472 3300049569 Ga0501032_0308861 Ga0501032_0308861_299_919 205
473 3300049570 Ga0501033_0111129 Ga0501033_0111129_912_1529 205
474 3300049579 Ga0501043_0206723 Ga0501043_0206723_789_1406 205
475 3300049581 Ga0501047_0002933 Ga0501047_0002933_14301_14918 205
476 3300049581 Ga0501047_0065237 Ga0501047_0065237_88_705 205
477 3300049581 Ga0501047_0091858 Ga0501047_0091858_2003_2620 205
478 3300049581 Ga0501047_0112401 Ga0501047_0112401_101_724 205
479 3300049581 Ga0501047_0240499 Ga0501047_0240499_587_1207 205
480 3300049582 Ga0501048_0092541 Ga0501048_0092541_426_1046 205
481 3300049586 Ga0501070_0257167 Ga0501070_0257167_47_667 205
482 3300049686 Ga0501257_002053 Ga0501257_002053_1017_1634 205
483 3300049822 Ga0501035_0634393 Ga0501035_0634393_174_791 205
484 3300049823 Ga0501044_0005225 Ga0501044_0005225_224_841 205
485 3300049823 Ga0501044_0263518 Ga0501044_0263518_191_811 205
486 3300049823 Ga0501044_0310355 Ga0501044_0310355_694_1314 205
487 3300049823 Ga0501044_0569754 Ga0501044_0569754_306_923 205
488 3300050489 nmdc:mga03683_43059_c1 nmdc:mga03683_43059_c1_352_969 205
489 3300050493 nmdc:mga0k408_200610_c1 nmdc:mga0k408_200610_c1_180_803 205
490 3300050496 nmdc:mga07m45_30764_c1 nmdc:mga07m45_30764_c1_1096_1713 205
491 3300053080 Ga0500635_0000048 Ga0500635_0000048_23055_23678 205
492 3300053087 Ga0500643_018122 Ga0500643_018122_1441_2061 205
493 3300053090 Ga0500646_0110663 Ga0500646_0110663_44_667 205
494 3300053091 Ga0500647_0098144 Ga0500647_0098144_641_1264 205
495 3300053092 Ga0500583_0186355 Ga0500583_0186355_12_629 205
496 3300053093 Ga0500651_0183325 Ga0500651_0183325_238_861 205
497 3300053103 Ga0500555_002066 Ga0500555_002066_257_880 205
498 3300053108 Ga0500562_000146 Ga0500562_000146_19587_20207 205
499 3300053108 Ga0500562_001187 Ga0500562_001187_1011_1640 205
500 3300053109 Ga0500569_007140 Ga0500569_007140_1705_2328 205
501 3300053111 Ga0500572_036286 Ga0500572_036286_112_735 205
502 3300053119 Ga0500595_015940 Ga0500595_015940_1354_1977 205
503 3300053119 Ga0500595_049004 Ga0500595_049004_489_1106 205
504 3300053121 Ga0500607_025551 Ga0500607_025551_2348_2971 205
505 3300053122 Ga0500608_000187 Ga0500608_000187_4774_5391 205
506 3300053123 Ga0500614_002651 Ga0500614_002651_183_806 205
507 3300053130 Ga0500642_0100767 Ga0500642_0100767_23_646 205
508 3300053130 Ga0500642_0128924 Ga0500642_0128924_485_1108 205
509 3300053146 Ga0500588_0210200 Ga0500588_0210200_28_645 205
510 3300053150 Ga0500603_007476 Ga0500603_007476_1675_2298 205
511 3300053162 Ga0500638_043219 Ga0500638_043219_1492_2115 205
512 3300053177 Ga0500636_0011253 Ga0500636_0011253_637_1260 205
513 3300053178 Ga0500637_0165841 Ga0500637_0165841_460_1083 205
514 3300053730 Ga0500645_003039 Ga0500645_003039_256_894 205
515 3300053735 Ga0500596_015025 Ga0500596_015025_194_817 205
516 3300003215 JGI25153J46596_10034807 JGI25153J46596_100348072 206
517 3300003322 rootL2_10025033 rootL2_100250331 206
518 3300003322 rootL2_10025042 rootL2_100250424 206
519 3300003771 Ga0055526_1024695 Ga0055526_10246952 206
520 3300003773 Ga0055537_1004521 Ga0055537_10045212 206
521 3300003794 Ga0055531_10007738 Ga0055531_100077386 206
522 3300005262 Ga0065165_1001299 Ga0065165_100129911 206
523 3300005455 Ga0070663_100570848 Ga0070663_1005708482 206
524 3300006048 Ga0075363_100473288 Ga0075363_1004732881 206
525 3300006186 Ga0075369_10008852 Ga0075369_100088524 206
526 3300006353 Ga0075370_10241546 Ga0075370_102415462 206
527 3300025263 Ga0209565_1000402 Ga0209565_100040228 206
528 3300025273 Ga0209673_1000956 Ga0209673_100095645 206
529 3300025273 Ga0209673_1015564 Ga0209673_10155642 206
530 3300025291 Ga0209675_1010683 Ga0209675_10106833 206
531 3300025295 Ga0209564_1009991 Ga0209564_10099914 206
532 3300025295 Ga0209564_1032821 Ga0209564_10328212 206
533 3300025295 Ga0209564_1045539 Ga0209564_10455392 206
534 3300025297 Ga0209758_1002021 Ga0209758_100202123 206
535 3300025297 Ga0209758_1002093 Ga0209758_100209323 206
536 3300025299 Ga0209256_1001940 Ga0209256_100194016 206
537 3300025299 Ga0209256_1016311 Ga0209256_10163112 206
538 3300025299 Ga0209256_1040058 Ga0209256_10400582 206
539 3300025304 Ga0209257_1000186 Ga0209257_1000186135 206
540 3300028794 Ga0307515_10015777 Ga0307515_1001577711 206
541 3300028794 Ga0307515_10016786 Ga0307515_1001678613 206
542 3300030522 Ga0307512_10295428 Ga0307512_102954281 206
543 3300031251 Ga0265327_10017632 Ga0265327_100176324 206
544 3300031911 Ga0307412_10206480 Ga0307412_102064802 206
545 3300035724 Ga0373933_0332946 Ga0373933_0332946_236_874 206
546 3300037853 Ga0436364_1092164 Ga0436364_1092164_915_1538 206
547 3300039450 Ga0436363_0545590 Ga0436363_0545590_121_741 206
548 3300042156 Ga0439446_0013609 Ga0439446_0013609_365_991 206
549 3300046452 Ga0495617_074868 Ga0495617_074868_460_1080 206
550 3300046453 Ga0495627_003153 Ga0495627_003153_974_1594 206
551 3300046457 Ga0495590_0000589 Ga0495590_0000589_12178_12798 206
552 3300046460 Ga0495638_0001119 Ga0495638_0001119_980_1600 206
553 3300046460 Ga0495638_0007475 Ga0495638_0007475_2790_3410 206
554 3300046460 Ga0495638_0049281 Ga0495638_0049281_1901_2521 206
555 3300046460 Ga0495638_0162967 Ga0495638_0162967_14_634 206
556 3300046471 Ga0495650_0000403 Ga0495650_0000403_50862_51482 206
557 3300046492 Ga0495585_0071232 Ga0495585_0071232_733_1359 206
558 3300046501 Ga0495607_0033413 Ga0495607_0033413_106_732 206
559 3300046506 Ga0495583_0000005 Ga0495583_0000005_126120_126740 206
560 3300046507 Ga0495606_0003858 Ga0495606_0003858_2178_2798 206
561 3300046512 Ga0495610_0002475 Ga0495610_0002475_4621_5241 206
562 3300046512 Ga0495610_0004772 Ga0495610_0004772_5956_6576 206
563 3300046512 Ga0495610_0034131 Ga0495610_0034131_1814_2434 206
564 3300046513 Ga0495616_0000172 Ga0495616_0000172_28457_29083 206
565 3300046515 Ga0495620_0037176 Ga0495620_0037176_1294_1914 206
566 3300046518 Ga0495631_0004830 Ga0495631_0004830_1652_2272 206
567 3300046519 Ga0495632_0069706 Ga0495632_0069706_459_1085 206
568 3300046520 Ga0495637_0026229 Ga0495637_0026229_1055_1675 206
569 3300046524 Ga0495648_0014034 Ga0495648_0014034_685_1305 206
570 3300046525 Ga0495663_0030026 Ga0495663_0030026_764_1384 206
571 3300046530 Ga0495654_0000708 Ga0495654_0000708_20299_20919 206
572 3300046530 Ga0495654_0018186 Ga0495654_0018186_2274_2894 206
573 3300046538 Ga0495609_0105599 Ga0495609_0105599_304_924 206
574 3300046542 Ga0495597_0013122 Ga0495597_0013122_2878_3498 206
575 3300046616 Ga0495668_0000100 Ga0495668_0000100_132300_132920 206
576 3300046616 Ga0495668_0054552 Ga0495668_0054552_948_1574 206
577 3300046660 Ga0495625_0015370 Ga0495625_0015370_664_1284 206
578 3300046660 Ga0495625_0017433 Ga0495625_0017433_359_979 206
579 3300046660 Ga0495625_0020568 Ga0495625_0020568_2033_2653 206
580 3300046660 Ga0495625_0059935 Ga0495625_0059935_1782_2402 206
581 3300046660 Ga0495625_0196563 Ga0495625_0196563_678_1298 206
582 3300046691 Ga0495670_0215478 Ga0495670_0215478_156_776 206
583 3300046810 Ga0495660_0018592 Ga0495660_0018592_1715_2341 206
584 3300047320 Ga0495672_0001737 Ga0495672_0001737_19675_20295 206
585 3300047446 Ga0495679_054644 Ga0495679_054644_206_826 206
586 3300047469 Ga0495673_0000025 Ga0495673_0000025_221379_221999 206
587 3300047469 Ga0495673_0002412 Ga0495673_0002412_9926_10546 206
588 3300047470 Ga0495681_0032687 Ga0495681_0032687_93_713 206
589 3300047472 Ga0495686_0001965 Ga0495686_0001965_9800_10420 206
590 3300048904 Ga0496101_0068891 Ga0496101_0068891_1193_1813 206
591 3300048909 Ga0496106_0052300 Ga0496106_0052300_728_1348 206
592 3300048910 Ga0496107_0000063 Ga0496107_0000063_19351_19971 206
593 3300048918 Ga0496115_0225548 Ga0496115_0225548_903_1523 206
594 3300048927 Ga0496124_0021850 Ga0496124_0021850_481_1101 206
595 3300048928 Ga0496125_0185716 Ga0496125_0185716_572_1192 206
596 3300048929 Ga0496126_0311787 Ga0496126_0311787_608_1228 206
597 3300049459 Ga0495678_001968 Ga0495678_001968_4094_4714 206
598 3300049671 Ga0501238_000591 Ga0501238_000591_1753_2373 206
599 3300049671 Ga0501238_012001 Ga0501238_012001_479_1099 206
600 3300050490 nmdc:mga03n38_420517_c1 nmdc:mga03n38_420517_c1_70_696 206
601 3300050496 nmdc:mga07m45_158383_c1 nmdc:mga07m45_158383_c1_207_833 206
602 3300050516 nmdc:mga0sz30_5859_c1 nmdc:mga0sz30_5859_c1_1769_2389 206
603 3300053086 Ga0500578_0000913 Ga0500578_0000913_5129_5749 206
604 3300053088 Ga0500644_0026944 Ga0500644_0026944_738_1358 206
605 3300053104 Ga0500556_0000826 Ga0500556_0000826_16459_17079 206
606 3300053108 Ga0500562_006695 Ga0500562_006695_1436_2056 206
607 3300053118 Ga0500594_0000897 Ga0500594_0000897_5054_5674 206
608 3300053123 Ga0500614_003048 Ga0500614_003048_2079_2699 206
609 3300053125 Ga0500618_000319 Ga0500618_000319_15826_16446 206
610 3300053134 Ga0500658_0010151 Ga0500658_0010151_2044_2664 206
611 3300053136 Ga0500559_0000153 Ga0500559_0000153_19949_20569 206
612 3300053136 Ga0500559_0007015 Ga0500559_0007015_672_1292 206
613 3300053142 Ga0500577_0009083 Ga0500577_0009083_299_919 206
614 3300053153 Ga0500616_0020362 Ga0500616_0020362_2138_2758 206
615 3300053156 Ga0500622_0004117 Ga0500622_0004117_3438_4064 206
616 3300053156 Ga0500622_0025972 Ga0500622_0025972_1651_2271 206
617 3300053156 Ga0500622_0053777 Ga0500622_0053777_56_676 206
618 3300053730 Ga0500645_004474 Ga0500645_004474_314_934 206
619 3300053731 Ga0500609_001858 Ga0500609_001858_669_1289 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

27

214

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8axp-assembly1.cif.gz_B neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. 0.9296 2 187
7csn-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from acinetobacter baumannii at 1.00 a resolution 0.9175 1 193
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9159 2 178
3v2i-assembly1.cif.gz_A structure of a peptidyl-trna hydrolase (pth) from burkholderia thailandensis 0.9079 1 186
4olj-assembly1.cif.gz_A crystal structure of arg119gln mutant of peptidyl-trna hydrolase from acinetobacter baumannii at 1.49 a resolution 0.9043 1 193
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9118 62 187 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.8954 1 191 3.40.50.1470
af_Q10LI6_46_183_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.8939 2 135 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.8933 2 181 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.8855 1 189 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A434SHI8-F1-model_v4 Peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9786 1 180 GO:0004045
AF-A0A0Q4FF18-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9756 1 189 GO:0004045
GO:0005737
GO:0006412
AF-A0A7C1P4V1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9633 1 155 GO:0004045
GO:0005737
GO:0006412
AF-A0A059E7J4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9607 2 201 GO:0004045
GO:0005737
GO:0006412
AF-A0A4Q5XZD1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9593 1 199 GO:0004045
GO:0005737
GO:0006412

Feature Viewer

pLDDT pTM Quality
92.82 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map