F469738

General Info

Members Datasets Scaffolds Average Seq Length
618 193 618 362

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10106894|Ga0207709_101068942
Length 358
Sequence MVALFDPLMLGALDLPNRIVMAPLTRARAGREGVPNELMAAYYGQRASSGLIISEATGISREGLGWPNAPGLWSEAQVEGWKLVTKAVHDRGGRIVAQLWHMGRLVHPLVSGMEPVSSSATTAPDYAHTYEGKRPYLEARAATQDDLRRIVGDYARAASNAVAAGFDGVQVHGANGYLVDQFLRDGANFRTDDYGGPIDQRLRFMSAVLEAVGMARVGIRFSPNIYSQGVEDAYPIALFEAVARRLEEHKVPWIELREPRHPTSAGAIPTEPVSPAMRPLYSGRIVINSDYDWGDAWERVGAGHADAVSIGRLFIANPDLVKRIALGFPLNEGDSSTYYSGGASGYVDYPTLDEARAA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 4.37
Rhizosphere 95.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000554 3300001979 Bacteria 16027
2 JGI24739J22299_10000405 3300001989 Bacteria 14994
3 JGI24737J22298_10000061 3300001990 Bacteria 32526
4 JGI24737J22298_10002804 3300001990 Bacteria 6171
5 JGI24737J22298_10011266 3300001990 Bacteria 2934
6 JGI24738J21930_10000146 3300002075 Bacteria 17468
7 JGI24751J29686_10005552 3300002459 Bacteria 2568
8 Ga0065712_10138290 3300005290 Bacteria 1475
9 Ga0065715_10000291 3300005293 Bacteria 19586
10 Ga0065715_10133866 3300005293 Bacteria 1965
11 Ga0070658_10001056 3300005327 Bacteria 23556
12 Ga0070658_10001507 3300005327 Bacteria 19770
13 Ga0070658_10011106 3300005327 Bacteria 7221
14 Ga0070658_10047896 3300005327 Bacteria 3460
15 Ga0070658_10063072 3300005327 Bacteria 3021
16 Ga0070676_10008049 3300005328 Bacteria 5668
17 Ga0070676_10092736 3300005328 Bacteria 1853
18 Ga0070683_100001823 3300005329 Bacteria 16621
19 Ga0070690_100003412 3300005330 Bacteria 8690
20 Ga0070690_100081178 3300005330 Bacteria 2121
21 Ga0070670_100003544 3300005331 Bacteria 12981
22 Ga0070670_100007835 3300005331 Bacteria 9089
23 Ga0070670_100022832 3300005331 Bacteria 5384
24 Ga0070670_100028300 3300005331 Bacteria 4824
25 Ga0070670_100082354 3300005331 Bacteria 2765
26 Ga0070670_100134665 3300005331 Bacteria 2135
27 Ga0070677_10005808 3300005333 Bacteria 4083
28 Ga0070677_10007168 3300005333 Bacteria 3717
29 Ga0070677_10011411 3300005333 Bacteria 3064
30 Ga0070677_10016162 3300005333 Bacteria 2654
31 Ga0068869_100000493 3300005334 Bacteria 21956
32 Ga0068869_100033200 3300005334 Bacteria 3642
33 Ga0070666_10000310 3300005335 Bacteria 31154
34 Ga0070666_10044871 3300005335 Bacteria 2963
35 Ga0070666_10108188 3300005335 Bacteria 1921
36 Ga0070680_100001306 3300005336 Bacteria 18035
37 Ga0068868_100009873 3300005338 Bacteria 6893
38 Ga0068868_100063238 3300005338 Bacteria 2936
39 Ga0070660_100000393 3300005339 Bacteria 29017
40 Ga0070660_100002280 3300005339 Bacteria 13171
41 Ga0070660_100052230 3300005339 Bacteria 3151
42 Ga0070660_100100714 3300005339 Bacteria 2289
43 Ga0070660_100210468 3300005339 Bacteria 1578
44 Ga0070660_100257655 3300005339 Bacteria 1424
45 Ga0070661_100001818 3300005344 Bacteria 14787
46 Ga0070661_100031076 3300005344 Bacteria 3861
47 Ga0070661_100032079 3300005344 Bacteria 3801
48 Ga0070692_10056009 3300005345 Bacteria 2063
49 Ga0070692_10106386 3300005345 Bacteria 1545
50 Ga0070668_100001945 3300005347 Bacteria 15069
51 Ga0070668_100009752 3300005347 Bacteria 7119
52 Ga0070668_100018998 3300005347 Bacteria 5165
53 Ga0070668_100053578 3300005347 Bacteria 3111
54 Ga0070668_100124276 3300005347 Bacteria 2066
55 Ga0070669_100000532 3300005353 Bacteria 28333
56 Ga0070669_100021191 3300005353 Bacteria 4645
57 Ga0070669_100027300 3300005353 Bacteria 4108
58 Ga0070669_100054797 3300005353 Bacteria 2921
59 Ga0070669_100143954 3300005353 Bacteria 1840
60 Ga0070669_100195716 3300005353 Bacteria 1588
61 Ga0070675_100004774 3300005354 Bacteria 10338
62 Ga0070675_100018719 3300005354 Bacteria 5512
63 Ga0070671_100000254 3300005355 Bacteria 35845
64 Ga0070671_100000539 3300005355 Bacteria 26673
65 Ga0070671_100001204 3300005355 Bacteria 19366
66 Ga0070671_100008371 3300005355 Bacteria 8287
67 Ga0070671_100018815 3300005355 Bacteria 5614
68 Ga0070671_100033828 3300005355 Bacteria 4230
69 Ga0070671_100064368 3300005355 Bacteria 3054
70 Ga0070671_100076411 3300005355 Bacteria 2798
71 Ga0070671_100085050 3300005355 Bacteria 2645
72 Ga0070671_100104872 3300005355 Bacteria 2373
73 Ga0070671_100240431 3300005355 Bacteria 1537
74 Ga0070674_100004769 3300005356 Bacteria 7767
75 Ga0070674_100007740 3300005356 Bacteria 6346
76 Ga0070674_100166305 3300005356 Bacteria 1678
77 Ga0070673_100000058 3300005364 Bacteria 45772
78 Ga0070673_100011087 3300005364 Bacteria 6143
79 Ga0070673_100049943 3300005364 Bacteria 3268
80 Ga0070673_100123357 3300005364 Bacteria 2164
81 Ga0070673_100300939 3300005364 Bacteria 1412
82 Ga0070673_100413366 3300005364 Bacteria 1208
83 Ga0070659_100000564 3300005366 Bacteria 27103
84 Ga0070659_100002195 3300005366 Bacteria 13892
85 Ga0070659_100004781 3300005366 Bacteria 9681
86 Ga0070659_100010127 3300005366 Bacteria 6940
87 Ga0070659_100039287 3300005366 Bacteria 3694
88 Ga0070659_100046658 3300005366 Bacteria 3396
89 Ga0070659_100309051 3300005366 Bacteria 1320
90 Ga0070667_100003138 3300005367 Bacteria 14187
91 Ga0070667_100019854 3300005367 Bacteria 5576
92 Ga0070667_100021388 3300005367 Bacteria 5372
93 Ga0070667_100099897 3300005367 Bacteria 2505
94 Ga0070667_100105703 3300005367 Bacteria 2436
95 Ga0070667_100407463 3300005367 Bacteria 1238
96 Ga0070714_100043420 3300005435 Bacteria 3802
97 Ga0070694_100006264 3300005444 Bacteria 7223
98 Ga0070663_100000271 3300005455 Bacteria 26098
99 Ga0070663_100028965 3300005455 Bacteria 3777
100 Ga0070663_100059055 3300005455 Bacteria 2756
101 Ga0070663_100099972 3300005455 Bacteria 2163
102 Ga0070678_100034362 3300005456 Bacteria 3530
103 Ga0070678_100192611 3300005456 Bacteria 1677
104 Ga0070662_100000280 3300005457 Bacteria 30084
105 Ga0070662_100001326 3300005457 Bacteria 15206
106 Ga0070662_100002356 3300005457 Bacteria 11616
107 Ga0070662_100014088 3300005457 Bacteria 5333
108 Ga0070662_100022052 3300005457 Bacteria 4355
109 Ga0070662_100057035 3300005457 Bacteria 2837
110 Ga0070662_100112618 3300005457 Bacteria 2075
111 Ga0070662_100122369 3300005457 Bacteria 1996
112 Ga0070662_100144287 3300005457 Bacteria 1848
113 Ga0070681_10185287 3300005458 Bacteria 2002
114 Ga0068867_100000581 3300005459 Bacteria 24213
115 Ga0068867_100015265 3300005459 Bacteria 5445
116 Ga0068867_100034864 3300005459 Bacteria 3648
117 Ga0068867_100036996 3300005459 Bacteria 3547
118 Ga0070679_100000346 3300005530 Bacteria 39334
119 Ga0070684_100223481 3300005535 Bacteria 1718
120 Ga0068853_100000783 3300005539 Bacteria 22097
121 Ga0068853_100180146 3300005539 Bacteria 1916
122 Ga0070672_100003912 3300005543 Bacteria 9703
123 Ga0070672_100019251 3300005543 Bacteria 4952
124 Ga0070672_100030589 3300005543 Bacteria 4047
125 Ga0070672_100036550 3300005543 Bacteria 3742
126 Ga0070672_100092487 3300005543 Bacteria 2442
127 Ga0070672_100192909 3300005543 Bacteria 1701
128 Ga0070686_100057220 3300005544 Bacteria 2504
129 Ga0070665_100001540 3300005548 Bacteria 26631
130 Ga0070665_100004875 3300005548 Bacteria 13935
131 Ga0070665_100031329 3300005548 Bacteria 5352
132 Ga0070665_100047018 3300005548 Bacteria 4332
133 Ga0070665_100059010 3300005548 Bacteria 3846
134 Ga0070665_100386481 3300005548 Bacteria 1407
135 Ga0068855_100001416 3300005563 Bacteria 29777
136 Ga0068855_100001751 3300005563 Bacteria 27092
137 Ga0068855_100009125 3300005563 Bacteria 11978
138 Ga0068855_100145767 3300005563 Bacteria 2696
139 Ga0070664_100003969 3300005564 Bacteria 11899
140 Ga0070664_100011906 3300005564 Bacteria 7060
141 Ga0070664_100038862 3300005564 Bacteria 4007
142 Ga0070664_100122406 3300005564 Bacteria 2279
143 Ga0070664_100210794 3300005564 Bacteria 1736
144 Ga0068857_100000531 3300005577 Bacteria 27554
145 Ga0068857_100008327 3300005577 Bacteria 8959
146 Ga0068857_100021196 3300005577 Bacteria 5718
147 Ga0068857_100025898 3300005577 Bacteria 5166
148 Ga0068854_100003661 3300005578 Bacteria 9614
149 Ga0068854_100014014 3300005578 Bacteria 5275
150 Ga0068854_100044109 3300005578 Bacteria 3164
151 Ga0068856_100018394 3300005614 Bacteria 6772
152 Ga0068852_100003205 3300005616 Bacteria 11426
153 Ga0068852_100099279 3300005616 Bacteria 2624
154 Ga0068852_100182603 3300005616 Bacteria 1974
155 Ga0068859_100000136 3300005617 Bacteria 68907
156 Ga0068859_100001019 3300005617 Bacteria 28705
157 Ga0068859_100003244 3300005617 Bacteria 16555
158 Ga0068859_100047591 3300005617 Bacteria 4309
159 Ga0068859_100248933 3300005617 Bacteria 1867
160 Ga0068864_100000235 3300005618 Bacteria 49611
161 Ga0068864_100000540 3300005618 Bacteria 32248
162 Ga0068864_100000711 3300005618 Bacteria 27933
163 Ga0068864_100073022 3300005618 Bacteria 2991
164 Ga0068866_10084861 3300005718 Bacteria 1710
165 Ga0068861_100049365 3300005719 Bacteria 3186
166 Ga0068851_10057641 3300005834 Bacteria 1984
167 Ga0068863_100000140 3300005841 Bacteria 76175
168 Ga0068863_100001845 3300005841 Bacteria 21053
169 Ga0068863_100011565 3300005841 Bacteria 8537
170 Ga0068863_100014473 3300005841 Bacteria 7596
171 Ga0068863_100028097 3300005841 Bacteria 5369
172 Ga0068863_100120273 3300005841 Bacteria 2504
173 Ga0068858_100000514 3300005842 Bacteria 40588
174 Ga0068858_100002498 3300005842 Bacteria 18554
175 Ga0068858_100004922 3300005842 Bacteria 13083
176 Ga0068858_100010778 3300005842 Bacteria 8643
177 Ga0068858_100014241 3300005842 Bacteria 7499
178 Ga0068858_100032216 3300005842 Bacteria 4869
179 Ga0068858_100053887 3300005842 Bacteria 3719
180 Ga0068860_100026574 3300005843 Bacteria 5579
181 Ga0068860_100038700 3300005843 Bacteria 4563
182 Ga0068862_100032002 3300005844 Bacteria 4443
183 Ga0068862_100036248 3300005844 Bacteria 4181
184 Ga0068862_100106957 3300005844 Bacteria 2453
185 Ga0068862_100124023 3300005844 Bacteria 2279
186 Ga0068862_100137987 3300005844 Bacteria 2163
187 Ga0070717_10091811 3300006028 Bacteria 2564
188 Ga0097621_100098802 3300006237 Bacteria 2453
189 Ga0068871_100025268 3300006358 Bacteria 4618
190 Ga0075431_100143299 3300006847 Bacteria 2463
191 Ga0068865_100000697 3300006881 Bacteria 18907
192 Ga0068865_100011665 3300006881 Bacteria 5506
193 Ga0068865_100047539 3300006881 Bacteria 2949
194 Ga0068865_100135199 3300006881 Bacteria 1851
195 Ga0097620_100000136 3300006931 Bacteria 68907
196 Ga0097620_100001019 3300006931 Bacteria 28705
197 Ga0097620_100003244 3300006931 Bacteria 16555
198 Ga0097620_100047593 3300006931 Bacteria 4309
199 Ga0097620_100248931 3300006931 Bacteria 1867
200 Ga0111539_10067835 3300009094 Bacteria 4212
201 Ga0105245_10000170 3300009098 Bacteria 61721
202 Ga0105243_10127687 3300009148 Bacteria 2153
203 Ga0105241_10056381 3300009174 Bacteria 3012
204 Ga0105242_10268553 3300009176 Bacteria 1544
205 Ga0105248_10000184 3300009177 Bacteria 72728
206 Ga0105248_10001263 3300009177 Bacteria 28281
207 Ga0105248_10001269 3300009177 Bacteria 28212
208 Ga0105248_10003825 3300009177 Bacteria 16686
209 Ga0105248_10006079 3300009177 Bacteria 13251
210 Ga0105248_10011624 3300009177 Bacteria 9698
211 Ga0105248_10028196 3300009177 Bacteria 6253
212 Ga0105248_10245851 3300009177 Bacteria 2014
213 Ga0105238_10221656 3300009551 Bacteria 1867
214 Ga0105249_10175678 3300009553 Bacteria 2080
215 Ga0105249_10231839 3300009553 Bacteria 1821
216 Ga0105249_10481622 3300009553 Bacteria 1284
217 Ga0105239_10029054 3300010375 Bacteria 6078
218 Ga0105239_10093563 3300010375 Bacteria 3319
219 Ga0157373_10064478 3300013100 Bacteria 2593
220 Ga0157371_10000443 3300013102 Bacteria 50736
221 Ga0157371_10001298 3300013102 Bacteria 26285
222 Ga0157371_10086142 3300013102 Bacteria 2225
223 Ga0157370_10009490 3300013104 Bacteria 10384
224 Ga0157369_10148055 3300013105 Bacteria 2482
225 Ga0157378_10000312 3300013297 Bacteria 47527
226 Ga0163162_10006506 3300013306 Bacteria 11316
227 Ga0163162_10060796 3300013306 Bacteria 3814
228 Ga0163162_10281198 3300013306 Bacteria 1796
229 Ga0157372_10081710 3300013307 Bacteria 3658
230 Ga0157372_10487859 3300013307 Bacteria 1437
231 Ga0157375_10011093 3300013308 Bacteria 7946
232 Ga0157375_10025124 3300013308 Bacteria 5527
233 Ga0157375_10044879 3300013308 Bacteria 4299
234 Ga0157375_10099813 3300013308 Bacteria 2982
235 Ga0163163_10000131 3300014325 Bacteria 76809
236 Ga0163163_10388618 3300014325 Bacteria 1453
237 Ga0157380_10003736 3300014326 Bacteria 10475
238 Ga0157377_10019088 3300014745 Bacteria 3577
239 Ga0157379_10001982 3300014968 Bacteria 16935
240 Ga0157379_10320097 3300014968 Bacteria 1416
241 Ga0163161_10031389 3300017792 Bacteria 3785
242 Ga0206353_11034454 3300020082 Bacteria 4286
243 Ga0207697_10000063 3300025315 Bacteria 45019
244 Ga0207697_10000134 3300025315 Bacteria 35648
245 Ga0207697_10012389 3300025315 Bacteria 3575
246 Ga0207656_10001771 3300025321 Bacteria 7186
247 Ga0207682_10001817 3300025893 Bacteria 9749
248 Ga0207642_10003851 3300025899 Bacteria 4783
249 Ga0207688_10000106 3300025901 Bacteria 33178
250 Ga0207688_10074054 3300025901 Bacteria 1936
251 Ga0207680_10013612 3300025903 Bacteria 4185
252 Ga0207680_10058986 3300025903 Bacteria 2329
253 Ga0207680_10123938 3300025903 Bacteria 1694
254 Ga0207647_10000246 3300025904 Bacteria 44259
255 Ga0207647_10001685 3300025904 Bacteria 17028
256 Ga0207647_10047406 3300025904 Bacteria 2673
257 Ga0207647_10070855 3300025904 Bacteria 2104
258 Ga0207645_10001636 3300025907 Bacteria 18270
259 Ga0207645_10002473 3300025907 Bacteria 14517
260 Ga0207645_10017581 3300025907 Bacteria 4715
261 Ga0207643_10103522 3300025908 Bacteria 1671
262 Ga0207643_10178755 3300025908 Bacteria 1283
263 Ga0207705_10000270 3300025909 Bacteria 49639
264 Ga0207705_10000654 3300025909 Bacteria 28865
265 Ga0207705_10021694 3300025909 Bacteria 4581
266 Ga0207705_10036638 3300025909 Bacteria 3510
267 Ga0207705_10037664 3300025909 Bacteria 3460
268 Ga0207660_10002965 3300025917 Bacteria 11098
269 Ga0207660_10113000 3300025917 Bacteria 2047
270 Ga0207657_10000165 3300025919 Bacteria 67173
271 Ga0207657_10001091 3300025919 Bacteria 28769
272 Ga0207657_10002106 3300025919 Bacteria 21522
273 Ga0207657_10004437 3300025919 Bacteria 14844
274 Ga0207657_10117611 3300025919 Bacteria 2189
275 Ga0207657_10142195 3300025919 Bacteria 1960
276 Ga0207649_10025955 3300025920 Bacteria 3422
277 Ga0207649_10078632 3300025920 Bacteria 2129
278 Ga0207652_10000058 3300025921 Bacteria 113620
279 Ga0207652_10234716 3300025921 Bacteria 1653
280 Ga0207681_10000712 3300025923 Bacteria 21864
281 Ga0207681_10005179 3300025923 Bacteria 8006
282 Ga0207681_10018945 3300025923 Bacteria 4341
283 Ga0207681_10038999 3300025923 Bacteria 3151
284 Ga0207681_10072741 3300025923 Bacteria 2402
285 Ga0207681_10092359 3300025923 Bacteria 2164
286 Ga0207694_10222498 3300025924 Bacteria 1540
287 Ga0207694_10269206 3300025924 Bacteria 1397
288 Ga0207650_10017570 3300025925 Bacteria 5009
289 Ga0207650_10029240 3300025925 Bacteria 3960
290 Ga0207650_10034836 3300025925 Bacteria 3652
291 Ga0207650_10052250 3300025925 Bacteria 3027
292 Ga0207650_10257576 3300025925 Bacteria 1414
293 Ga0207659_10058140 3300025926 Bacteria 2775
294 Ga0207659_10090847 3300025926 Bacteria 2280
295 Ga0207664_10051524 3300025929 Bacteria 3251
296 Ga0207644_10001112 3300025931 Bacteria 17264
297 Ga0207644_10011791 3300025931 Bacteria 5788
298 Ga0207644_10012065 3300025931 Bacteria 5731
299 Ga0207644_10013797 3300025931 Bacteria 5398
300 Ga0207644_10014968 3300025931 Bacteria 5201
301 Ga0207644_10023425 3300025931 Bacteria 4229
302 Ga0207644_10039626 3300025931 Bacteria 3326
303 Ga0207644_10084201 3300025931 Bacteria 2357
304 Ga0207690_10002306 3300025932 Bacteria 11636
305 Ga0207690_10002510 3300025932 Bacteria 11089
306 Ga0207690_10010985 3300025932 Bacteria 5400
307 Ga0207706_10000224 3300025933 Bacteria 62043
308 Ga0207706_10003287 3300025933 Bacteria 15471
309 Ga0207706_10004293 3300025933 Bacteria 13391
310 Ga0207706_10008924 3300025933 Bacteria 9227
311 Ga0207706_10013030 3300025933 Bacteria 7567
312 Ga0207706_10022603 3300025933 Bacteria 5644
313 Ga0207706_10022695 3300025933 Bacteria 5633
314 Ga0207706_10045173 3300025933 Bacteria 3903
315 Ga0207706_10052300 3300025933 Bacteria 3606
316 Ga0207706_10197722 3300025933 Bacteria 1763
317 Ga0207709_10106894 3300025935 Bacteria 1862
318 Ga0207669_10012986 3300025937 Bacteria 4118
319 Ga0207704_10013542 3300025938 Bacteria 4085
320 Ga0207704_10054173 3300025938 Bacteria 2444
321 Ga0207704_10113647 3300025938 Bacteria 1836
322 Ga0207691_10000750 3300025940 Bacteria 32085
323 Ga0207691_10016053 3300025940 Bacteria 7113
324 Ga0207691_10016539 3300025940 Bacteria 7004
325 Ga0207691_10022329 3300025940 Bacteria 5968
326 Ga0207691_10041076 3300025940 Bacteria 4273
327 Ga0207691_10043740 3300025940 Bacteria 4126
328 Ga0207691_10068953 3300025940 Bacteria 3195
329 Ga0207691_10072558 3300025940 Bacteria 3105
330 Ga0207691_10079118 3300025940 Bacteria 2959
331 Ga0207691_10117052 3300025940 Bacteria 2365
332 Ga0207691_10132368 3300025940 Bacteria 2202
333 Ga0207711_10000105 3300025941 Bacteria 90036
334 Ga0207711_10000190 3300025941 Bacteria 65723
335 Ga0207711_10000908 3300025941 Bacteria 28478
336 Ga0207711_10001131 3300025941 Bacteria 25459
337 Ga0207711_10002435 3300025941 Bacteria 16611
338 Ga0207711_10029578 3300025941 Bacteria 4623
339 Ga0207711_10032566 3300025941 Bacteria 4408
340 Ga0207711_10158829 3300025941 Bacteria 2045
341 Ga0207689_10000051 3300025942 Bacteria 88480
342 Ga0207689_10026198 3300025942 Bacteria 4883
343 Ga0207689_10037169 3300025942 Bacteria 4040
344 Ga0207689_10084910 3300025942 Bacteria 2602
345 Ga0207689_10122965 3300025942 Bacteria 2134
346 Ga0207661_10002950 3300025944 Bacteria 11762
347 Ga0207679_10022639 3300025945 Bacteria 4282
348 Ga0207679_10045361 3300025945 Bacteria 3178
349 Ga0207679_10098481 3300025945 Bacteria 2280
350 Ga0207679_10104923 3300025945 Bacteria 2218
351 Ga0207679_10150221 3300025945 Bacteria 1895
352 Ga0207667_10000579 3300025949 Bacteria 47716
353 Ga0207667_10006485 3300025949 Bacteria 14155
354 Ga0207667_10012465 3300025949 Bacteria 9792
355 Ga0207651_10000226 3300025960 Bacteria 24290
356 Ga0207651_10031763 3300025960 Bacteria 3381
357 Ga0207651_10038101 3300025960 Bacteria 3156
358 Ga0207712_10013421 3300025961 Bacteria 5252
359 Ga0207712_10310069 3300025961 Bacteria 1298
360 Ga0207668_10000086 3300025972 Bacteria 69871
361 Ga0207668_10004997 3300025972 Bacteria 7806
362 Ga0207668_10025381 3300025972 Bacteria 3835
363 Ga0207668_10041535 3300025972 Bacteria 3110
364 Ga0207668_10154422 3300025972 Bacteria 1781
365 Ga0207640_10000428 3300025981 Bacteria 25901
366 Ga0207658_10002031 3300025986 Bacteria 15107
367 Ga0207658_10002254 3300025986 Bacteria 14276
368 Ga0207658_10008914 3300025986 Bacteria 6803
369 Ga0207658_10030169 3300025986 Bacteria 3837
370 Ga0207658_10049703 3300025986 Bacteria 3082
371 Ga0207658_10051031 3300025986 Bacteria 3047
372 Ga0207677_10000578 3300026023 Bacteria 22844
373 Ga0207677_10039632 3300026023 Bacteria 3100
374 Ga0207703_10006127 3300026035 Bacteria 9627
375 Ga0207703_10006394 3300026035 Bacteria 9419
376 Ga0207703_10007523 3300026035 Bacteria 8644
377 Ga0207703_10013542 3300026035 Bacteria 6353
378 Ga0207703_10047395 3300026035 Bacteria 3465
379 Ga0207639_10004387 3300026041 Bacteria 9521
380 Ga0207639_10168845 3300026041 Bacteria 1851
381 Ga0207639_10187687 3300026041 Bacteria 1763
382 Ga0207678_10000217 3300026067 Bacteria 51179
383 Ga0207678_10028227 3300026067 Bacteria 4900
384 Ga0207678_10049040 3300026067 Bacteria 3648
385 Ga0207678_10058756 3300026067 Bacteria 3309
386 Ga0207678_10068668 3300026067 Bacteria 3040
387 Ga0207678_10115760 3300026067 Bacteria 2287
388 Ga0207678_10120685 3300026067 Bacteria 2237
389 Ga0207702_10013141 3300026078 Bacteria 6883
390 Ga0207702_10017620 3300026078 Bacteria 5911
391 Ga0207641_10000172 3300026088 Bacteria 90549
392 Ga0207641_10013909 3300026088 Bacteria 6600
393 Ga0207641_10015982 3300026088 Bacteria 6144
394 Ga0207641_10019848 3300026088 Bacteria 5516
395 Ga0207641_10109167 3300026088 Bacteria 2450
396 Ga0207641_10121959 3300026088 Bacteria 2327
397 Ga0207648_10001346 3300026089 Bacteria 27263
398 Ga0207648_10001535 3300026089 Bacteria 25421
399 Ga0207648_10005651 3300026089 Bacteria 12555
400 Ga0207648_10006756 3300026089 Bacteria 11374
401 Ga0207648_10038813 3300026089 Bacteria 4190
402 Ga0207676_10000300 3300026095 Bacteria 42535
403 Ga0207676_10001388 3300026095 Bacteria 18023
404 Ga0207676_10002706 3300026095 Bacteria 12613
405 Ga0207676_10034395 3300026095 Bacteria 3836
406 Ga0207676_10098089 3300026095 Bacteria 2422
407 Ga0207674_10001184 3300026116 Bacteria 33891
408 Ga0207674_10001894 3300026116 Bacteria 26625
409 Ga0207674_10010389 3300026116 Bacteria 10551
410 Ga0207674_10017887 3300026116 Bacteria 7725
411 Ga0207675_100019233 3300026118 Bacteria 6373
412 Ga0207683_10002394 3300026121 Bacteria 16388
413 Ga0207683_10024963 3300026121 Bacteria 5152
414 Ga0207683_10045072 3300026121 Bacteria 3856
415 Ga0207683_10115487 3300026121 Bacteria 2406
416 Ga0207698_10252621 3300026142 Bacteria 1614
417 Ga0209974_10001669 3300027876 Bacteria 8032
418 Ga0207428_10236043 3300027907 Bacteria 1367
419 Ga0268266_10000200 3300028379 Bacteria 104456
420 Ga0268266_10032344 3300028379 Bacteria 4445
421 Ga0268266_10034821 3300028379 Bacteria 4284
422 Ga0268266_10034827 3300028379 Bacteria 4283
423 Ga0268266_10036783 3300028379 Bacteria 4170
424 Ga0268265_10002511 3300028380 Bacteria 13738
425 Ga0268265_10004607 3300028380 Bacteria 9529
426 Ga0268265_10006624 3300028380 Bacteria 7841
427 Ga0268265_10029772 3300028380 Bacteria 3925
428 Ga0268265_10142620 3300028380 Bacteria 2008
429 Ga0268264_10002073 3300028381 Bacteria 17893
430 Ga0268264_10002535 3300028381 Bacteria 16046
431 Ga0268264_10003947 3300028381 Bacteria 12698
432 Ga0307408_100014535 3300031548 Bacteria 5230
433 Ga0307408_100136971 3300031548 Bacteria 1917
434 Ga0307408_100196454 3300031548 Bacteria 1629
435 Ga0307405_10022850 3300031731 Bacteria 3543
436 Ga0307405_10127868 3300031731 Bacteria 1750
437 Ga0307413_10000501 3300031824 Bacteria 12919
438 Ga0307413_10012107 3300031824 Bacteria 4277
439 Ga0307413_10015940 3300031824 Bacteria 3865
440 Ga0307413_10075802 3300031824 Bacteria 2136
441 Ga0307413_10110922 3300031824 Bacteria 1836
442 Ga0307413_10134667 3300031824 Bacteria 1697
443 Ga0307410_10000194 3300031852 Bacteria 22605
444 Ga0307410_10000659 3300031852 Bacteria 14273
445 Ga0307410_10003653 3300031852 Bacteria 7768
446 Ga0307410_10062206 3300031852 Bacteria 2557
447 Ga0307410_10087068 3300031852 Bacteria 2208
448 Ga0307410_10087815 3300031852 Bacteria 2200
449 Ga0307410_10098322 3300031852 Bacteria 2093
450 Ga0307410_10121987 3300031852 Bacteria 1902
451 Ga0307410_10166169 3300031852 Bacteria 1658
452 Ga0307406_10014646 3300031901 Bacteria 4515
453 Ga0307406_10050187 3300031901 Bacteria 2644
454 Ga0307406_10053523 3300031901 Bacteria 2571
455 Ga0307406_10060778 3300031901 Bacteria 2438
456 Ga0307406_10125628 3300031901 Bacteria 1791
457 Ga0307407_10005193 3300031903 Bacteria 5620
458 Ga0307407_10009974 3300031903 Bacteria 4453
459 Ga0307407_10047857 3300031903 Bacteria 2430
460 Ga0307407_10099369 3300031903 Bacteria 1802
461 Ga0307412_10041981 3300031911 Bacteria 2968
462 Ga0307412_10175788 3300031911 Bacteria 1605
463 Ga0307409_100000069 3300031995 Bacteria 37984
464 Ga0307409_100001351 3300031995 Bacteria 11931
465 Ga0307409_100002642 3300031995 Bacteria 9432
466 Ga0307409_100008461 3300031995 Bacteria 6248
467 Ga0307409_100009398 3300031995 Bacteria 6004
468 Ga0307409_100070075 3300031995 Bacteria 2781
469 Ga0307409_100122998 3300031995 Bacteria 2201
470 Ga0307416_100026375 3300032002 Bacteria 4281
471 Ga0307416_100027002 3300032002 Bacteria 4242
472 Ga0307416_100028804 3300032002 Bacteria 4137
473 Ga0307416_100038812 3300032002 Bacteria 3678
474 Ga0307416_100039397 3300032002 Bacteria 3658
475 Ga0307416_100092263 3300032002 Bacteria 2604
476 Ga0307414_10000651 3300032004 Bacteria 17739
477 Ga0307414_10000834 3300032004 Bacteria 15720
478 Ga0307414_10014060 3300032004 Bacteria 4784
479 Ga0307414_10026705 3300032004 Bacteria 3720
480 Ga0307414_10114529 3300032004 Bacteria 2060
481 Ga0307414_10187431 3300032004 Bacteria 1670
482 Ga0307411_10001475 3300032005 Bacteria 9664
483 Ga0307411_10002773 3300032005 Bacteria 7885
484 Ga0307411_10014422 3300032005 Bacteria 4395
485 Ga0307411_10021069 3300032005 Bacteria 3805
486 Ga0307411_10021860 3300032005 Bacteria 3754
487 Ga0307411_10021910 3300032005 Bacteria 3751
488 Ga0307411_10225984 3300032005 Bacteria 1455
489 Ga0307415_100003122 3300032126 Bacteria 8390
490 Ga0307415_100007803 3300032126 Bacteria 5879
491 Ga0307415_100048792 3300032126 Bacteria 2858
492 Ga0307415_100085000 3300032126 Bacteria 2272
493 Ga0307415_100189869 3300032126 Bacteria 1620
494 Ga0395899_0000998 3300037312 Bacteria 25996
495 Ga0395899_0001390 3300037312 Bacteria 20752
496 Ga0395899_0003175 3300037312 Bacteria 13042
497 Ga0395899_0024353 3300037312 Bacteria 4577
498 Ga0395899_0027967 3300037312 Bacteria 4247
499 Ga0395900_0000290 3300037418 Bacteria 75444
500 Ga0395900_0004722 3300037418 Bacteria 14370
501 Ga0395900_0009923 3300037418 Bacteria 9749
502 Ga0395900_0043706 3300037418 Bacteria 4618
503 Ga0395900_0059316 3300037418 Bacteria 3939
504 Ga0395900_0089484 3300037418 Bacteria 3164
505 Ga0395900_0118125 3300037418 Bacteria 2721
506 Ga0395900_0123203 3300037418 Bacteria 2659
507 Ga0395900_0255922 3300037418 Bacteria 1750
508 Ga0395898_0000054 3300037466 Bacteria 279561
509 Ga0395898_0002537 3300037466 Bacteria 21412
510 Ga0395898_0002720 3300037466 Bacteria 20390
511 Ga0395898_0020658 3300037466 Bacteria 6686
512 Ga0395898_0041320 3300037466 Bacteria 4555
513 Ga0395898_0046065 3300037466 Bacteria 4284
514 Ga0395898_0286211 3300037466 Bacteria 1572
515 Ga0395905_0000046 3300037471 Bacteria 240463
516 Ga0395905_0001881 3300037471 Bacteria 24188
517 Ga0395905_0003151 3300037471 Bacteria 17763
518 Ga0395905_0004285 3300037471 Bacteria 14873
519 Ga0395905_0007333 3300037471 Bacteria 10985
520 Ga0395905_0007948 3300037471 Bacteria 10491
521 Ga0395905_0008923 3300037471 Bacteria 9847
522 Ga0395905_0009946 3300037471 Bacteria 9268
523 Ga0395905_0011831 3300037471 Bacteria 8424
524 Ga0395905_0012556 3300037471 Bacteria 8148
525 Ga0395905_0015579 3300037471 Bacteria 7223
526 Ga0395905_0022116 3300037471 Bacteria 6016
527 Ga0395905_0040463 3300037471 Bacteria 4373
528 Ga0395905_0044960 3300037471 Bacteria 4142
529 Ga0395905_0054473 3300037471 Bacteria 3743
530 Ga0395905_0061948 3300037471 Bacteria 3499
531 Ga0395905_0084874 3300037471 Bacteria 2967
532 Ga0395905_0089664 3300037471 Bacteria 2882
533 Ga0395905_0108987 3300037471 Bacteria 2600
534 Ga0395905_0110415 3300037471 Bacteria 2582
535 Ga0395905_0125912 3300037471 Bacteria 2409
536 Ga0395905_0154652 3300037471 Bacteria 2157
537 Ga0395901_0000102 3300038443 Bacteria 115611
538 Ga0395901_0003921 3300038443 Bacteria 14966
539 Ga0395901_0004019 3300038443 Bacteria 14813
540 Ga0395901_0004628 3300038443 Bacteria 13884
541 Ga0395901_0008199 3300038443 Bacteria 10557
542 Ga0395901_0008454 3300038443 Bacteria 10402
543 Ga0395901_0021833 3300038443 Bacteria 6561
544 Ga0395901_0088285 3300038443 Bacteria 3243
545 Ga0395901_0107380 3300038443 Bacteria 2930
546 Ga0395901_0110317 3300038443 Bacteria 2888
547 Ga0395901_0115931 3300038443 Bacteria 2814
548 Ga0395901_0199899 3300038443 Bacteria 2095
549 Ga0395901_0380027 3300038443 Bacteria 1454
550 Ga0395901_0381421 3300038443 Bacteria 1451
551 Ga0395901_0520355 3300038443 Bacteria 1209
552 Ga0439432_016328 3300042006 Bacteria 2500
553 Ga0439449_0021347 3300042007 Bacteria 2425
554 Ga0439458_0003767 3300042157 Bacteria 3511
555 Ga0466969_0057952 3300044656 Bacteria 1887
556 Ga0466972_0013676 3300044658 Bacteria 4072
557 Ga0466966_0047394 3300044684 Bacteria 2740
558 Ga0466966_0048941 3300044684 Bacteria 2692
559 Ga0466963_0135050 3300044694 Bacteria 1706
560 Ga0466971_0019852 3300044719 Bacteria 2985
561 Ga0466957_0081655 3300044842 Bacteria 2013
562 Ga0466959_0029553 3300045049 Bacteria 4061
563 Ga0466959_0032655 3300045049 Bacteria 3853
564 Ga0466959_0312786 3300045049 Bacteria 1075
565 Ga0466958_0009773 3300045836 Bacteria 5352
566 Ga0466958_0061275 3300045836 Bacteria 2291
567 Ga0466967_0036825 3300045976 Bacteria 4181
568 Ga0495585_0053016 3300046492 Bacteria 2245
569 Ga0495663_0001341 3300046525 Bacteria 7780
570 Ga0495642_0043133 3300046528 Bacteria 1839
571 Ga0495621_0003469 3300046539 Bacteria 4351
572 Ga0495621_0011641 3300046539 Bacteria 2727
573 Ga0495668_0005141 3300046616 Bacteria 8993
574 Ga0495668_0006700 3300046616 Bacteria 7502
575 Ga0495669_0000644 3300046684 Bacteria 15189
576 Ga0495669_0010498 3300046684 Bacteria 3916
577 Ga0495669_0012236 3300046684 Bacteria 3649
578 Ga0495669_0013035 3300046684 Bacteria 3542
579 Ga0495669_0026403 3300046684 Bacteria 2538
580 Ga0495669_0027132 3300046684 Bacteria 2504
581 Ga0495669_0047355 3300046684 Bacteria 1920
582 Ga0495669_0145956 3300046684 Bacteria 1118
583 Ga0495670_0013778 3300046691 Bacteria 3975
584 Ga0495677_0004567 3300047445 Bacteria 5295
585 Ga0495677_0014711 3300047445 Bacteria 2846
586 Ga0496101_0046155 3300048904 Bacteria 3124
587 Ga0496102_0615579 3300048905 Bacteria 1009
588 Ga0496103_0112290 3300048906 Bacteria 1732
589 Ga0496103_0150333 3300048906 Bacteria 1492
590 Ga0496104_0088229 3300048907 Bacteria 2963
591 Ga0496107_0001322 3300048910 Bacteria 15195
592 Ga0496107_0096407 3300048910 Bacteria 2165
593 Ga0496108_0007117 3300048911 Bacteria 9064
594 Ga0496108_0034858 3300048911 Bacteria 4181
595 Ga0496108_0150214 3300048911 Bacteria 2010
596 Ga0496109_0003294 3300048912 Bacteria 13487
597 Ga0496109_0079464 3300048912 Bacteria 3022
598 Ga0496109_0086239 3300048912 Bacteria 2899
599 Ga0496110_0023225 3300048913 Bacteria 5273
600 Ga0496110_0032219 3300048913 Bacteria 4525
601 Ga0496111_0025676 3300048914 Bacteria 4157
602 Ga0496111_0043684 3300048914 Bacteria 3221
603 Ga0496111_0310864 3300048914 Bacteria 1168
604 Ga0496112_0000242 3300048915 Bacteria 35031
605 Ga0496112_0137145 3300048915 Bacteria 2416
606 Ga0496112_0200497 3300048915 Bacteria 1955
607 Ga0496112_0257639 3300048915 Bacteria 1694
608 Ga0496112_0294767 3300048915 Bacteria 1568
609 Ga0496113_0002738 3300048916 Bacteria 10360
610 Ga0496113_0011264 3300048916 Bacteria 5956
611 Ga0496113_0013132 3300048916 Bacteria 5594
612 Ga0496114_0083136 3300048917 Bacteria 2708
613 Ga0501069_0020563 3300049585 Bacteria 3577
614 nmdc:mga06r32_100419_c1 3300050510 Bacteria 2839
615 nmdc:mga08y16_277904_c1 3300050511 Bacteria 1728
616 nmdc:mga0rr50_417799_c1 3300050513 Bacteria 1134
617 Ga0500658_0000032 3300053134 Bacteria 90863
618 Ga0466962_0036732 3300061719 Bacteria 2345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0615579 Ga0496102_0615579_14_988 324
2 3300048914 Ga0496111_0310864 Ga0496111_0310864_19_993 324
3 3300048915 Ga0496112_0137145 Ga0496112_0137145_42_1016 324
4 3300044684 Ga0466966_0047394 Ga0466966_0047394_754_1779 341
5 3300044694 Ga0466963_0135050 Ga0466963_0135050_400_1425 341
6 3300045836 Ga0466958_0061275 Ga0466958_0061275_414_1439 341
7 3300005564 Ga0070664_100210794 Ga0070664_1002107942 342
8 3300026095 Ga0207676_10034395 Ga0207676_100343954 342
9 3300037466 Ga0395898_0041320 Ga0395898_0041320_3490_4518 342
10 3300042006 Ga0439432_016328 Ga0439432_016328_1451_2479 342
11 3300042157 Ga0439458_0003767 Ga0439458_0003767_31_1059 342
12 3300045049 Ga0466959_0312786 Ga0466959_0312786_10_1038 342
13 3300046684 Ga0495669_0010498 Ga0495669_0010498_1855_2883 342
14 3300046684 Ga0495669_0145956 Ga0495669_0145956_23_1051 342
15 3300048906 Ga0496103_0112290 Ga0496103_0112290_41_1069 342
16 3300048916 Ga0496113_0011264 Ga0496113_0011264_24_1052 342
17 3300005844 Ga0068862_100124023 Ga0068862_1001240233 349
18 3300028380 Ga0268265_10029772 Ga0268265_100297723 349
19 3300031824 Ga0307413_10000501 Ga0307413_100005016 351
20 3300031852 Ga0307410_10000194 Ga0307410_100001941 351
21 3300031901 Ga0307406_10060778 Ga0307406_100607781 351
22 3300031995 Ga0307409_100000069 Ga0307409_1000000695 351
23 3300032004 Ga0307414_10000651 Ga0307414_100006514 351
24 3300032005 Ga0307411_10001475 Ga0307411_100014752 351
25 3300025933 Ga0207706_10197722 Ga0207706_101977222 352
26 3300005844 Ga0068862_100137987 Ga0068862_1001379872 354
27 3300025935 Ga0207709_10106894 Ga0207709_101068942 358
28 3300005328 Ga0070676_10092736 Ga0070676_100927362 360
29 3300005330 Ga0070690_100003412 Ga0070690_1000034122 360
30 3300005335 Ga0070666_10000310 Ga0070666_1000031015 360
31 3300005338 Ga0068868_100009873 Ga0068868_1000098731 360
32 3300005355 Ga0070671_100064368 Ga0070671_1000643682 360
33 3300005366 Ga0070659_100309051 Ga0070659_1003090512 360
34 3300005367 Ga0070667_100003138 Ga0070667_10000313811 360
35 3300005457 Ga0070662_100144287 Ga0070662_1001442872 360
36 3300005544 Ga0070686_100057220 Ga0070686_1000572202 360
37 3300005718 Ga0068866_10084861 Ga0068866_100848612 360
38 3300005842 Ga0068858_100010778 Ga0068858_1000107788 360
39 3300009177 Ga0105248_10006079 Ga0105248_1000607911 360
40 3300025899 Ga0207642_10003851 Ga0207642_100038515 360
41 3300025903 Ga0207680_10058986 Ga0207680_100589863 360
42 3300025904 Ga0207647_10001685 Ga0207647_100016853 360
43 3300025931 Ga0207644_10014968 Ga0207644_100149683 360
44 3300025940 Ga0207691_10043740 Ga0207691_100437402 360
45 3300025941 Ga0207711_10000190 Ga0207711_100001909 360
46 3300025986 Ga0207658_10008914 Ga0207658_100089145 360
47 3300026035 Ga0207703_10006394 Ga0207703_100063947 360
48 3300048915 Ga0496112_0200497 Ga0496112_0200497_357_1439 360
49 3300005327 Ga0070658_10001056 Ga0070658_100010563 361
50 3300005329 Ga0070683_100001823 Ga0070683_10000182315 361
51 3300005336 Ga0070680_100001306 Ga0070680_10000130610 361
52 3300005339 Ga0070660_100002280 Ga0070660_1000022805 361
53 3300005345 Ga0070692_10056009 Ga0070692_100560092 361
54 3300005455 Ga0070663_100000271 Ga0070663_10000027125 361
55 3300005530 Ga0070679_100000346 Ga0070679_10000034632 361
56 3300005535 Ga0070684_100223481 Ga0070684_1002234812 361
57 3300005563 Ga0068855_100009125 Ga0068855_1000091255 361
58 3300005614 Ga0068856_100018394 Ga0068856_1000183944 361
59 3300005616 Ga0068852_100099279 Ga0068852_1000992792 361
60 3300013104 Ga0157370_10009490 Ga0157370_100094907 361
61 3300013307 Ga0157372_10487859 Ga0157372_104878592 361
62 3300020082 Ga0206353_11034454 Ga0206353_110344542 361
63 3300025909 Ga0207705_10000270 Ga0207705_1000027042 361
64 3300025917 Ga0207660_10002965 Ga0207660_100029659 361
65 3300025919 Ga0207657_10001091 Ga0207657_1000109110 361
66 3300025921 Ga0207652_10000058 Ga0207652_1000005876 361
67 3300025944 Ga0207661_10002950 Ga0207661_1000295012 361
68 3300025949 Ga0207667_10006485 Ga0207667_1000648510 361
69 3300026067 Ga0207678_10000217 Ga0207678_1000021714 361
70 3300026078 Ga0207702_10013141 Ga0207702_100131414 361
71 3300026142 Ga0207698_10252621 Ga0207698_102526212 361
72 3300031995 Ga0307409_100001351 Ga0307409_10000135112 361
73 3300037312 Ga0395899_0000998 Ga0395899_0000998_17875_18960 361
74 3300037418 Ga0395900_0004722 Ga0395900_0004722_7050_8135 361
75 3300037466 Ga0395898_0002537 Ga0395898_0002537_2536_3621 361
76 3300037471 Ga0395905_0004285 Ga0395905_0004285_7553_8638 361
77 3300037471 Ga0395905_0154652 Ga0395905_0154652_155_1240 361
78 3300038443 Ga0395901_0004019 Ga0395901_0004019_7553_8638 361
79 3300044656 Ga0466969_0057952 Ga0466969_0057952_251_1336 361
80 3300044658 Ga0466972_0013676 Ga0466972_0013676_1296_2381 361
81 3300044684 Ga0466966_0048941 Ga0466966_0048941_488_1573 361
82 3300044719 Ga0466971_0019852 Ga0466971_0019852_523_1617 361
83 3300044842 Ga0466957_0081655 Ga0466957_0081655_436_1530 361
84 3300045049 Ga0466959_0029553 Ga0466959_0029553_76_1161 361
85 3300045049 Ga0466959_0032655 Ga0466959_0032655_1575_2660 361
86 3300045836 Ga0466958_0009773 Ga0466958_0009773_3987_5072 361
87 3300045976 Ga0466967_0036825 Ga0466967_0036825_487_1581 361
88 3300061719 Ga0466962_0036732 Ga0466962_0036732_182_1330 361
89 3300001979 JGI24740J21852_10000554 JGI24740J21852_100005549 362
90 3300001989 JGI24739J22299_10000405 JGI24739J22299_100004053 362
91 3300001990 JGI24737J22298_10000061 JGI24737J22298_1000006116 362
92 3300001990 JGI24737J22298_10002804 JGI24737J22298_100028042 362
93 3300001990 JGI24737J22298_10011266 JGI24737J22298_100112663 362
94 3300002075 JGI24738J21930_10000146 JGI24738J21930_1000014616 362
95 3300002459 JGI24751J29686_10005552 JGI24751J29686_100055522 362
96 3300005290 Ga0065712_10138290 Ga0065712_101382902 362
97 3300005293 Ga0065715_10000291 Ga0065715_1000029115 362
98 3300005293 Ga0065715_10133866 Ga0065715_101338662 362
99 3300005327 Ga0070658_10001507 Ga0070658_100015075 362
100 3300005327 Ga0070658_10011106 Ga0070658_100111063 362
101 3300005327 Ga0070658_10047896 Ga0070658_100478963 362
102 3300005327 Ga0070658_10063072 Ga0070658_100630722 362
103 3300005328 Ga0070676_10008049 Ga0070676_100080493 362
104 3300005330 Ga0070690_100081178 Ga0070690_1000811781 362
105 3300005331 Ga0070670_100003544 Ga0070670_1000035442 362
106 3300005331 Ga0070670_100007835 Ga0070670_1000078354 362
107 3300005331 Ga0070670_100022832 Ga0070670_1000228326 362
108 3300005331 Ga0070670_100028300 Ga0070670_1000283003 362
109 3300005331 Ga0070670_100082354 Ga0070670_1000823541 362
110 3300005331 Ga0070670_100134665 Ga0070670_1001346652 362
111 3300005333 Ga0070677_10005808 Ga0070677_100058082 362
112 3300005333 Ga0070677_10007168 Ga0070677_100071684 362
113 3300005333 Ga0070677_10011411 Ga0070677_100114113 362
114 3300005333 Ga0070677_10016162 Ga0070677_100161623 362
115 3300005334 Ga0068869_100000493 Ga0068869_1000004933 362
116 3300005334 Ga0068869_100033200 Ga0068869_1000332002 362
117 3300005335 Ga0070666_10044871 Ga0070666_100448713 362
118 3300005335 Ga0070666_10108188 Ga0070666_101081883 362
119 3300005338 Ga0068868_100063238 Ga0068868_1000632383 362
120 3300005339 Ga0070660_100000393 Ga0070660_10000039321 362
121 3300005339 Ga0070660_100052230 Ga0070660_1000522303 362
122 3300005339 Ga0070660_100100714 Ga0070660_1001007142 362
123 3300005339 Ga0070660_100210468 Ga0070660_1002104682 362
124 3300005339 Ga0070660_100257655 Ga0070660_1002576552 362
125 3300005344 Ga0070661_100001818 Ga0070661_10000181814 362
126 3300005344 Ga0070661_100031076 Ga0070661_1000310763 362
127 3300005344 Ga0070661_100032079 Ga0070661_1000320793 362
128 3300005345 Ga0070692_10106386 Ga0070692_101063862 362
129 3300005347 Ga0070668_100001945 Ga0070668_1000019455 362
130 3300005347 Ga0070668_100009752 Ga0070668_1000097525 362
131 3300005347 Ga0070668_100018998 Ga0070668_1000189985 362
132 3300005347 Ga0070668_100053578 Ga0070668_1000535783 362
133 3300005347 Ga0070668_100124276 Ga0070668_1001242763 362
134 3300005353 Ga0070669_100000532 Ga0070669_10000053217 362
135 3300005353 Ga0070669_100021191 Ga0070669_1000211914 362
136 3300005353 Ga0070669_100027300 Ga0070669_1000273001 362
137 3300005353 Ga0070669_100054797 Ga0070669_1000547972 362
138 3300005353 Ga0070669_100143954 Ga0070669_1001439542 362
139 3300005353 Ga0070669_100195716 Ga0070669_1001957162 362
140 3300005354 Ga0070675_100004774 Ga0070675_10000477412 362
141 3300005354 Ga0070675_100018719 Ga0070675_1000187196 362
142 3300005355 Ga0070671_100000254 Ga0070671_10000025436 362
143 3300005355 Ga0070671_100000539 Ga0070671_10000053915 362
144 3300005355 Ga0070671_100001204 Ga0070671_10000120411 362
145 3300005355 Ga0070671_100008371 Ga0070671_1000083719 362
146 3300005355 Ga0070671_100018815 Ga0070671_1000188155 362
147 3300005355 Ga0070671_100033828 Ga0070671_1000338283 362
148 3300005355 Ga0070671_100076411 Ga0070671_1000764113 362
149 3300005355 Ga0070671_100085050 Ga0070671_1000850503 362
150 3300005355 Ga0070671_100104872 Ga0070671_1001048722 362
151 3300005355 Ga0070671_100240431 Ga0070671_1002404311 362
152 3300005356 Ga0070674_100004769 Ga0070674_1000047698 362
153 3300005356 Ga0070674_100007740 Ga0070674_1000077403 362
154 3300005356 Ga0070674_100166305 Ga0070674_1001663052 362
155 3300005364 Ga0070673_100000058 Ga0070673_10000005844 362
156 3300005364 Ga0070673_100011087 Ga0070673_1000110876 362
157 3300005364 Ga0070673_100049943 Ga0070673_1000499432 362
158 3300005364 Ga0070673_100123357 Ga0070673_1001233571 362
159 3300005364 Ga0070673_100300939 Ga0070673_1003009392 362
160 3300005364 Ga0070673_100413366 Ga0070673_1004133661 362
161 3300005366 Ga0070659_100000564 Ga0070659_1000005647 362
162 3300005366 Ga0070659_100002195 Ga0070659_1000021959 362
163 3300005366 Ga0070659_100004781 Ga0070659_10000478110 362
164 3300005366 Ga0070659_100010127 Ga0070659_1000101275 362
165 3300005366 Ga0070659_100039287 Ga0070659_1000392873 362
166 3300005366 Ga0070659_100046658 Ga0070659_1000466582 362
167 3300005367 Ga0070667_100019854 Ga0070667_1000198543 362
168 3300005367 Ga0070667_100021388 Ga0070667_1000213882 362
169 3300005367 Ga0070667_100099897 Ga0070667_1000998971 362
170 3300005367 Ga0070667_100105703 Ga0070667_1001057032 362
171 3300005367 Ga0070667_100407463 Ga0070667_1004074632 362
172 3300005435 Ga0070714_100043420 Ga0070714_1000434204 362
173 3300005444 Ga0070694_100006264 Ga0070694_1000062646 362
174 3300005455 Ga0070663_100028965 Ga0070663_1000289652 362
175 3300005455 Ga0070663_100059055 Ga0070663_1000590552 362
176 3300005455 Ga0070663_100099972 Ga0070663_1000999723 362
177 3300005456 Ga0070678_100034362 Ga0070678_1000343622 362
178 3300005456 Ga0070678_100192611 Ga0070678_1001926111 362
179 3300005457 Ga0070662_100000280 Ga0070662_10000028016 362
180 3300005457 Ga0070662_100001326 Ga0070662_10000132610 362
181 3300005457 Ga0070662_100002356 Ga0070662_1000023563 362
182 3300005457 Ga0070662_100014088 Ga0070662_1000140885 362
183 3300005457 Ga0070662_100022052 Ga0070662_1000220523 362
184 3300005457 Ga0070662_100057035 Ga0070662_1000570353 362
185 3300005457 Ga0070662_100112618 Ga0070662_1001126182 362
186 3300005457 Ga0070662_100122369 Ga0070662_1001223692 362
187 3300005458 Ga0070681_10185287 Ga0070681_101852872 362
188 3300005459 Ga0068867_100000581 Ga0068867_1000005813 362
189 3300005459 Ga0068867_100015265 Ga0068867_1000152653 362
190 3300005459 Ga0068867_100034864 Ga0068867_1000348643 362
191 3300005459 Ga0068867_100036996 Ga0068867_1000369963 362
192 3300005539 Ga0068853_100000783 Ga0068853_1000007835 362
193 3300005539 Ga0068853_100180146 Ga0068853_1001801461 362
194 3300005543 Ga0070672_100003912 Ga0070672_10000391211 362
195 3300005543 Ga0070672_100019251 Ga0070672_1000192513 362
196 3300005543 Ga0070672_100030589 Ga0070672_1000305892 362
197 3300005543 Ga0070672_100036550 Ga0070672_1000365503 362
198 3300005543 Ga0070672_100092487 Ga0070672_1000924873 362
199 3300005543 Ga0070672_100192909 Ga0070672_1001929092 362
200 3300005548 Ga0070665_100001540 Ga0070665_1000015407 362
201 3300005548 Ga0070665_100004875 Ga0070665_10000487512 362
202 3300005548 Ga0070665_100031329 Ga0070665_1000313294 362
203 3300005548 Ga0070665_100047018 Ga0070665_1000470183 362
204 3300005548 Ga0070665_100059010 Ga0070665_1000590105 362
205 3300005548 Ga0070665_100386481 Ga0070665_1003864811 362
206 3300005563 Ga0068855_100001416 Ga0068855_10000141614 362
207 3300005563 Ga0068855_100001751 Ga0068855_10000175121 362
208 3300005563 Ga0068855_100145767 Ga0068855_1001457673 362
209 3300005564 Ga0070664_100003969 Ga0070664_10000396912 362
210 3300005564 Ga0070664_100011906 Ga0070664_1000119064 362
211 3300005564 Ga0070664_100038862 Ga0070664_1000388621 362
212 3300005564 Ga0070664_100122406 Ga0070664_1001224063 362
213 3300005577 Ga0068857_100000531 Ga0068857_10000053127 362
214 3300005577 Ga0068857_100008327 Ga0068857_1000083273 362
215 3300005577 Ga0068857_100021196 Ga0068857_1000211961 362
216 3300005577 Ga0068857_100025898 Ga0068857_1000258983 362
217 3300005578 Ga0068854_100003661 Ga0068854_1000036614 362
218 3300005578 Ga0068854_100014014 Ga0068854_1000140145 362
219 3300005578 Ga0068854_100044109 Ga0068854_1000441094 362
220 3300005616 Ga0068852_100003205 Ga0068852_1000032053 362
221 3300005616 Ga0068852_100182603 Ga0068852_1001826033 362
222 3300005617 Ga0068859_100000136 Ga0068859_10000013654 362
223 3300005617 Ga0068859_100001019 Ga0068859_1000010195 362
224 3300005617 Ga0068859_100003244 Ga0068859_10000324415 362
225 3300005617 Ga0068859_100047591 Ga0068859_1000475913 362
226 3300005617 Ga0068859_100248933 Ga0068859_1002489333 362
227 3300005618 Ga0068864_100000235 Ga0068864_10000023520 362
228 3300005618 Ga0068864_100000540 Ga0068864_10000054018 362
229 3300005618 Ga0068864_100000711 Ga0068864_10000071110 362
230 3300005618 Ga0068864_100073022 Ga0068864_1000730222 362
231 3300005719 Ga0068861_100049365 Ga0068861_1000493653 362
232 3300005834 Ga0068851_10057641 Ga0068851_100576412 362
233 3300005841 Ga0068863_100000140 Ga0068863_10000014056 362
234 3300005841 Ga0068863_100001845 Ga0068863_10000184520 362
235 3300005841 Ga0068863_100011565 Ga0068863_1000115658 362
236 3300005841 Ga0068863_100014473 Ga0068863_1000144735 362
237 3300005841 Ga0068863_100028097 Ga0068863_1000280974 362
238 3300005841 Ga0068863_100120273 Ga0068863_1001202733 362
239 3300005842 Ga0068858_100000514 Ga0068858_10000051420 362
240 3300005842 Ga0068858_100002498 Ga0068858_10000249813 362
241 3300005842 Ga0068858_100004922 Ga0068858_1000049223 362
242 3300005842 Ga0068858_100014241 Ga0068858_1000142417 362
243 3300005842 Ga0068858_100032216 Ga0068858_1000322163 362
244 3300005842 Ga0068858_100053887 Ga0068858_1000538874 362
245 3300005843 Ga0068860_100026574 Ga0068860_1000265746 362
246 3300005843 Ga0068860_100038700 Ga0068860_1000387005 362
247 3300005844 Ga0068862_100032002 Ga0068862_1000320024 362
248 3300005844 Ga0068862_100036248 Ga0068862_1000362482 362
249 3300005844 Ga0068862_100106957 Ga0068862_1001069572 362
250 3300006028 Ga0070717_10091811 Ga0070717_100918112 362
251 3300006237 Ga0097621_100098802 Ga0097621_1000988022 362
252 3300006358 Ga0068871_100025268 Ga0068871_1000252683 362
253 3300006847 Ga0075431_100143299 Ga0075431_1001432991 362
254 3300006881 Ga0068865_100000697 Ga0068865_10000069713 362
255 3300006881 Ga0068865_100011665 Ga0068865_1000116654 362
256 3300006881 Ga0068865_100047539 Ga0068865_1000475393 362
257 3300006881 Ga0068865_100135199 Ga0068865_1001351992 362
258 3300006931 Ga0097620_100000136 Ga0097620_10000013654 362
259 3300006931 Ga0097620_100001019 Ga0097620_10000101926 362
260 3300006931 Ga0097620_100003244 Ga0097620_10000324415 362
261 3300006931 Ga0097620_100047593 Ga0097620_1000475934 362
262 3300006931 Ga0097620_100248931 Ga0097620_1002489313 362
263 3300009094 Ga0111539_10067835 Ga0111539_100678354 362
264 3300009098 Ga0105245_10000170 Ga0105245_1000017018 362
265 3300009148 Ga0105243_10127687 Ga0105243_101276872 362
266 3300009174 Ga0105241_10056381 Ga0105241_100563813 362
267 3300009176 Ga0105242_10268553 Ga0105242_102685532 362
268 3300009177 Ga0105248_10000184 Ga0105248_1000018465 362
269 3300009177 Ga0105248_10001263 Ga0105248_100012634 362
270 3300009177 Ga0105248_10001269 Ga0105248_1000126912 362
271 3300009177 Ga0105248_10003825 Ga0105248_100038258 362
272 3300009177 Ga0105248_10011624 Ga0105248_100116245 362
273 3300009177 Ga0105248_10028196 Ga0105248_100281963 362
274 3300009177 Ga0105248_10245851 Ga0105248_102458512 362
275 3300009551 Ga0105238_10221656 Ga0105238_102216563 362
276 3300009553 Ga0105249_10175678 Ga0105249_101756782 362
277 3300009553 Ga0105249_10231839 Ga0105249_102318393 362
278 3300009553 Ga0105249_10481622 Ga0105249_104816221 362
279 3300010375 Ga0105239_10029054 Ga0105239_100290545 362
280 3300010375 Ga0105239_10093563 Ga0105239_100935632 362
281 3300013100 Ga0157373_10064478 Ga0157373_100644783 362
282 3300013102 Ga0157371_10000443 Ga0157371_1000044345 362
283 3300013102 Ga0157371_10001298 Ga0157371_100012987 362
284 3300013102 Ga0157371_10086142 Ga0157371_100861421 362
285 3300013105 Ga0157369_10148055 Ga0157369_101480553 362
286 3300013297 Ga0157378_10000312 Ga0157378_1000031228 362
287 3300013306 Ga0163162_10006506 Ga0163162_100065065 362
288 3300013306 Ga0163162_10060796 Ga0163162_100607964 362
289 3300013306 Ga0163162_10281198 Ga0163162_102811982 362
290 3300013307 Ga0157372_10081710 Ga0157372_100817103 362
291 3300013308 Ga0157375_10011093 Ga0157375_1001109310 362
292 3300013308 Ga0157375_10025124 Ga0157375_100251242 362
293 3300013308 Ga0157375_10044879 Ga0157375_100448795 362
294 3300013308 Ga0157375_10099813 Ga0157375_100998133 362
295 3300014325 Ga0163163_10000131 Ga0163163_1000013157 362
296 3300014325 Ga0163163_10388618 Ga0163163_103886181 362
297 3300014326 Ga0157380_10003736 Ga0157380_100037365 362
298 3300014745 Ga0157377_10019088 Ga0157377_100190883 362
299 3300014968 Ga0157379_10001982 Ga0157379_100019827 362
300 3300014968 Ga0157379_10320097 Ga0157379_103200971 362
301 3300017792 Ga0163161_10031389 Ga0163161_100313894 362
302 3300025315 Ga0207697_10000063 Ga0207697_1000006323 362
303 3300025315 Ga0207697_10000134 Ga0207697_1000013422 362
304 3300025315 Ga0207697_10012389 Ga0207697_100123893 362
305 3300025321 Ga0207656_10001771 Ga0207656_100017715 362
306 3300025893 Ga0207682_10001817 Ga0207682_100018177 362
307 3300025901 Ga0207688_10000106 Ga0207688_100001065 362
308 3300025901 Ga0207688_10074054 Ga0207688_100740542 362
309 3300025903 Ga0207680_10013612 Ga0207680_100136123 362
310 3300025903 Ga0207680_10123938 Ga0207680_101239383 362
311 3300025904 Ga0207647_10000246 Ga0207647_1000024616 362
312 3300025904 Ga0207647_10047406 Ga0207647_100474063 362
313 3300025904 Ga0207647_10070855 Ga0207647_100708552 362
314 3300025907 Ga0207645_10001636 Ga0207645_1000163619 362
315 3300025907 Ga0207645_10002473 Ga0207645_100024735 362
316 3300025907 Ga0207645_10017581 Ga0207645_100175812 362
317 3300025908 Ga0207643_10103522 Ga0207643_101035223 362
318 3300025908 Ga0207643_10178755 Ga0207643_101787551 362
319 3300025909 Ga0207705_10000654 Ga0207705_1000065421 362
320 3300025909 Ga0207705_10021694 Ga0207705_100216944 362
321 3300025909 Ga0207705_10036638 Ga0207705_100366383 362
322 3300025909 Ga0207705_10037664 Ga0207705_100376642 362
323 3300025917 Ga0207660_10113000 Ga0207660_101130002 362
324 3300025919 Ga0207657_10000165 Ga0207657_1000016564 362
325 3300025919 Ga0207657_10002106 Ga0207657_1000210623 362
326 3300025919 Ga0207657_10004437 Ga0207657_100044378 362
327 3300025919 Ga0207657_10117611 Ga0207657_101176111 362
328 3300025919 Ga0207657_10142195 Ga0207657_101421952 362
329 3300025920 Ga0207649_10025955 Ga0207649_100259552 362
330 3300025920 Ga0207649_10078632 Ga0207649_100786321 362
331 3300025921 Ga0207652_10234716 Ga0207652_102347162 362
332 3300025923 Ga0207681_10000712 Ga0207681_1000071217 362
333 3300025923 Ga0207681_10005179 Ga0207681_100051798 362
334 3300025923 Ga0207681_10018945 Ga0207681_100189454 362
335 3300025923 Ga0207681_10038999 Ga0207681_100389992 362
336 3300025923 Ga0207681_10072741 Ga0207681_100727413 362
337 3300025923 Ga0207681_10092359 Ga0207681_100923591 362
338 3300025924 Ga0207694_10222498 Ga0207694_102224982 362
339 3300025924 Ga0207694_10269206 Ga0207694_102692062 362
340 3300025925 Ga0207650_10017570 Ga0207650_100175705 362
341 3300025925 Ga0207650_10029240 Ga0207650_100292404 362
342 3300025925 Ga0207650_10034836 Ga0207650_100348363 362
343 3300025925 Ga0207650_10052250 Ga0207650_100522504 362
344 3300025925 Ga0207650_10257576 Ga0207650_102575762 362
345 3300025926 Ga0207659_10058140 Ga0207659_100581402 362
346 3300025926 Ga0207659_10090847 Ga0207659_100908472 362
347 3300025929 Ga0207664_10051524 Ga0207664_100515242 362
348 3300025931 Ga0207644_10001112 Ga0207644_100011125 362
349 3300025931 Ga0207644_10011791 Ga0207644_100117912 362
350 3300025931 Ga0207644_10012065 Ga0207644_100120653 362
351 3300025931 Ga0207644_10013797 Ga0207644_100137974 362
352 3300025931 Ga0207644_10023425 Ga0207644_100234255 362
353 3300025931 Ga0207644_10039626 Ga0207644_100396263 362
354 3300025931 Ga0207644_10084201 Ga0207644_100842011 362
355 3300025932 Ga0207690_10002306 Ga0207690_100023068 362
356 3300025932 Ga0207690_10002510 Ga0207690_100025102 362
357 3300025932 Ga0207690_10010985 Ga0207690_100109855 362
358 3300025933 Ga0207706_10000224 Ga0207706_1000022432 362
359 3300025933 Ga0207706_10003287 Ga0207706_1000328715 362
360 3300025933 Ga0207706_10004293 Ga0207706_100042937 362
361 3300025933 Ga0207706_10008924 Ga0207706_100089247 362
362 3300025933 Ga0207706_10013030 Ga0207706_100130308 362
363 3300025933 Ga0207706_10022603 Ga0207706_100226033 362
364 3300025933 Ga0207706_10022695 Ga0207706_100226954 362
365 3300025933 Ga0207706_10045173 Ga0207706_100451733 362
366 3300025933 Ga0207706_10052300 Ga0207706_100523004 362
367 3300025937 Ga0207669_10012986 Ga0207669_100129863 362
368 3300025938 Ga0207704_10013542 Ga0207704_100135425 362
369 3300025938 Ga0207704_10054173 Ga0207704_100541732 362
370 3300025938 Ga0207704_10113647 Ga0207704_101136472 362
371 3300025940 Ga0207691_10000750 Ga0207691_100007503 362
372 3300025940 Ga0207691_10016053 Ga0207691_100160539 362
373 3300025940 Ga0207691_10016539 Ga0207691_100165391 362
374 3300025940 Ga0207691_10022329 Ga0207691_100223293 362
375 3300025940 Ga0207691_10041076 Ga0207691_100410765 362
376 3300025940 Ga0207691_10068953 Ga0207691_100689533 362
377 3300025940 Ga0207691_10072558 Ga0207691_100725584 362
378 3300025940 Ga0207691_10079118 Ga0207691_100791183 362
379 3300025940 Ga0207691_10117052 Ga0207691_101170523 362
380 3300025940 Ga0207691_10132368 Ga0207691_101323682 362
381 3300025941 Ga0207711_10000105 Ga0207711_1000010548 362
382 3300025941 Ga0207711_10000908 Ga0207711_1000090827 362
383 3300025941 Ga0207711_10001131 Ga0207711_1000113110 362
384 3300025941 Ga0207711_10002435 Ga0207711_1000243517 362
385 3300025941 Ga0207711_10029578 Ga0207711_100295783 362
386 3300025941 Ga0207711_10032566 Ga0207711_100325663 362
387 3300025941 Ga0207711_10158829 Ga0207711_101588292 362
388 3300025942 Ga0207689_10000051 Ga0207689_1000005170 362
389 3300025942 Ga0207689_10026198 Ga0207689_100261985 362
390 3300025942 Ga0207689_10037169 Ga0207689_100371693 362
391 3300025942 Ga0207689_10084910 Ga0207689_100849102 362
392 3300025942 Ga0207689_10122965 Ga0207689_101229652 362
393 3300025945 Ga0207679_10022639 Ga0207679_100226393 362
394 3300025945 Ga0207679_10045361 Ga0207679_100453613 362
395 3300025945 Ga0207679_10098481 Ga0207679_100984812 362
396 3300025945 Ga0207679_10104923 Ga0207679_101049233 362
397 3300025945 Ga0207679_10150221 Ga0207679_101502211 362
398 3300025949 Ga0207667_10000579 Ga0207667_1000057941 362
399 3300025949 Ga0207667_10012465 Ga0207667_100124659 362
400 3300025960 Ga0207651_10000226 Ga0207651_100002263 362
401 3300025960 Ga0207651_10031763 Ga0207651_100317633 362
402 3300025960 Ga0207651_10038101 Ga0207651_100381012 362
403 3300025961 Ga0207712_10013421 Ga0207712_100134215 362
404 3300025961 Ga0207712_10310069 Ga0207712_103100691 362
405 3300025972 Ga0207668_10000086 Ga0207668_1000008641 362
406 3300025972 Ga0207668_10004997 Ga0207668_1000499710 362
407 3300025972 Ga0207668_10025381 Ga0207668_100253812 362
408 3300025972 Ga0207668_10041535 Ga0207668_100415352 362
409 3300025972 Ga0207668_10154422 Ga0207668_101544222 362
410 3300025981 Ga0207640_10000428 Ga0207640_1000042822 362
411 3300025986 Ga0207658_10002031 Ga0207658_1000203114 362
412 3300025986 Ga0207658_10002254 Ga0207658_100022545 362
413 3300025986 Ga0207658_10030169 Ga0207658_100301694 362
414 3300025986 Ga0207658_10049703 Ga0207658_100497033 362
415 3300025986 Ga0207658_10051031 Ga0207658_100510311 362
416 3300026023 Ga0207677_10000578 Ga0207677_100005783 362
417 3300026023 Ga0207677_10039632 Ga0207677_100396323 362
418 3300026035 Ga0207703_10006127 Ga0207703_100061274 362
419 3300026035 Ga0207703_10007523 Ga0207703_100075233 362
420 3300026035 Ga0207703_10013542 Ga0207703_100135423 362
421 3300026035 Ga0207703_10047395 Ga0207703_100473952 362
422 3300026041 Ga0207639_10004387 Ga0207639_1000438710 362
423 3300026041 Ga0207639_10168845 Ga0207639_101688453 362
424 3300026041 Ga0207639_10187687 Ga0207639_101876872 362
425 3300026067 Ga0207678_10028227 Ga0207678_100282274 362
426 3300026067 Ga0207678_10049040 Ga0207678_100490405 362
427 3300026067 Ga0207678_10058756 Ga0207678_100587562 362
428 3300026067 Ga0207678_10068668 Ga0207678_100686682 362
429 3300026067 Ga0207678_10115760 Ga0207678_101157602 362
430 3300026067 Ga0207678_10120685 Ga0207678_101206853 362
431 3300026078 Ga0207702_10017620 Ga0207702_100176205 362
432 3300026088 Ga0207641_10000172 Ga0207641_1000017247 362
433 3300026088 Ga0207641_10013909 Ga0207641_100139095 362
434 3300026088 Ga0207641_10015982 Ga0207641_100159822 362
435 3300026088 Ga0207641_10019848 Ga0207641_100198484 362
436 3300026088 Ga0207641_10109167 Ga0207641_101091673 362
437 3300026088 Ga0207641_10121959 Ga0207641_101219591 362
438 3300026089 Ga0207648_10001346 Ga0207648_1000134626 362
439 3300026089 Ga0207648_10001535 Ga0207648_1000153518 362
440 3300026089 Ga0207648_10005651 Ga0207648_1000565113 362
441 3300026089 Ga0207648_10006756 Ga0207648_100067562 362
442 3300026089 Ga0207648_10038813 Ga0207648_100388134 362
443 3300026095 Ga0207676_10000300 Ga0207676_1000030015 362
444 3300026095 Ga0207676_10001388 Ga0207676_100013883 362
445 3300026095 Ga0207676_10002706 Ga0207676_100027065 362
446 3300026095 Ga0207676_10098089 Ga0207676_100980893 362
447 3300026116 Ga0207674_10001184 Ga0207674_1000118411 362
448 3300026116 Ga0207674_10001894 Ga0207674_1000189425 362
449 3300026116 Ga0207674_10010389 Ga0207674_1001038911 362
450 3300026116 Ga0207674_10017887 Ga0207674_100178878 362
451 3300026118 Ga0207675_100019233 Ga0207675_1000192336 362
452 3300026121 Ga0207683_10002394 Ga0207683_1000239417 362
453 3300026121 Ga0207683_10024963 Ga0207683_100249633 362
454 3300026121 Ga0207683_10045072 Ga0207683_100450724 362
455 3300026121 Ga0207683_10115487 Ga0207683_101154873 362
456 3300027876 Ga0209974_10001669 Ga0209974_100016692 362
457 3300027907 Ga0207428_10236043 Ga0207428_102360432 362
458 3300028379 Ga0268266_10000200 Ga0268266_1000020012 362
459 3300028379 Ga0268266_10032344 Ga0268266_100323441 362
460 3300028379 Ga0268266_10034821 Ga0268266_100348211 362
461 3300028379 Ga0268266_10034827 Ga0268266_100348273 362
462 3300028379 Ga0268266_10036783 Ga0268266_100367833 362
463 3300028380 Ga0268265_10002511 Ga0268265_100025119 362
464 3300028380 Ga0268265_10004607 Ga0268265_100046078 362
465 3300028380 Ga0268265_10006624 Ga0268265_100066249 362
466 3300028380 Ga0268265_10142620 Ga0268265_101426201 362
467 3300028381 Ga0268264_10002073 Ga0268264_1000207310 362
468 3300028381 Ga0268264_10002535 Ga0268264_100025357 362
469 3300028381 Ga0268264_10003947 Ga0268264_100039473 362
470 3300031548 Ga0307408_100014535 Ga0307408_1000145354 362
471 3300031548 Ga0307408_100136971 Ga0307408_1001369712 362
472 3300031548 Ga0307408_100196454 Ga0307408_1001964542 362
473 3300031731 Ga0307405_10022850 Ga0307405_100228503 362
474 3300031731 Ga0307405_10127868 Ga0307405_101278682 362
475 3300031824 Ga0307413_10012107 Ga0307413_100121072 362
476 3300031824 Ga0307413_10015940 Ga0307413_100159403 362
477 3300031824 Ga0307413_10075802 Ga0307413_100758023 362
478 3300031824 Ga0307413_10110922 Ga0307413_101109222 362
479 3300031824 Ga0307413_10134667 Ga0307413_101346672 362
480 3300031852 Ga0307410_10000659 Ga0307410_1000065912 362
481 3300031852 Ga0307410_10003653 Ga0307410_100036538 362
482 3300031852 Ga0307410_10062206 Ga0307410_100622061 362
483 3300031852 Ga0307410_10087068 Ga0307410_100870682 362
484 3300031852 Ga0307410_10087815 Ga0307410_100878152 362
485 3300031852 Ga0307410_10098322 Ga0307410_100983222 362
486 3300031852 Ga0307410_10121987 Ga0307410_101219872 362
487 3300031852 Ga0307410_10166169 Ga0307410_101661692 362
488 3300031901 Ga0307406_10014646 Ga0307406_100146462 362
489 3300031901 Ga0307406_10050187 Ga0307406_100501872 362
490 3300031901 Ga0307406_10053523 Ga0307406_100535233 362
491 3300031901 Ga0307406_10125628 Ga0307406_101256282 362
492 3300031903 Ga0307407_10005193 Ga0307407_100051934 362
493 3300031903 Ga0307407_10009974 Ga0307407_100099745 362
494 3300031903 Ga0307407_10047857 Ga0307407_100478573 362
495 3300031903 Ga0307407_10099369 Ga0307407_100993692 362
496 3300031911 Ga0307412_10041981 Ga0307412_100419813 362
497 3300031911 Ga0307412_10175788 Ga0307412_101757882 362
498 3300031995 Ga0307409_100002642 Ga0307409_10000264211 362
499 3300031995 Ga0307409_100008461 Ga0307409_1000084613 362
500 3300031995 Ga0307409_100009398 Ga0307409_1000093981 362
501 3300031995 Ga0307409_100070075 Ga0307409_1000700752 362
502 3300031995 Ga0307409_100122998 Ga0307409_1001229982 362
503 3300032002 Ga0307416_100026375 Ga0307416_1000263753 362
504 3300032002 Ga0307416_100027002 Ga0307416_1000270024 362
505 3300032002 Ga0307416_100028804 Ga0307416_1000288042 362
506 3300032002 Ga0307416_100038812 Ga0307416_1000388122 362
507 3300032002 Ga0307416_100039397 Ga0307416_1000393972 362
508 3300032002 Ga0307416_100092263 Ga0307416_1000922633 362
509 3300032004 Ga0307414_10000834 Ga0307414_1000083412 362
510 3300032004 Ga0307414_10014060 Ga0307414_100140604 362
511 3300032004 Ga0307414_10026705 Ga0307414_100267054 362
512 3300032004 Ga0307414_10114529 Ga0307414_101145292 362
513 3300032004 Ga0307414_10187431 Ga0307414_101874312 362
514 3300032005 Ga0307411_10002773 Ga0307411_100027733 362
515 3300032005 Ga0307411_10014422 Ga0307411_100144222 362
516 3300032005 Ga0307411_10021069 Ga0307411_100210692 362
517 3300032005 Ga0307411_10021860 Ga0307411_100218604 362
518 3300032005 Ga0307411_10021910 Ga0307411_100219105 362
519 3300032005 Ga0307411_10225984 Ga0307411_102259841 362
520 3300032126 Ga0307415_100003122 Ga0307415_10000312210 362
521 3300032126 Ga0307415_100007803 Ga0307415_1000078036 362
522 3300032126 Ga0307415_100048792 Ga0307415_1000487923 362
523 3300032126 Ga0307415_100085000 Ga0307415_1000850002 362
524 3300032126 Ga0307415_100189869 Ga0307415_1001898692 362
525 3300037312 Ga0395899_0001390 Ga0395899_0001390_3496_4584 362
526 3300037312 Ga0395899_0003175 Ga0395899_0003175_10450_11538 362
527 3300037312 Ga0395899_0024353 Ga0395899_0024353_708_1796 362
528 3300037312 Ga0395899_0027967 Ga0395899_0027967_568_1656 362
529 3300037418 Ga0395900_0000290 Ga0395900_0000290_51451_52605 362
530 3300037418 Ga0395900_0009923 Ga0395900_0009923_4185_5273 362
531 3300037418 Ga0395900_0043706 Ga0395900_0043706_1800_2888 362
532 3300037418 Ga0395900_0059316 Ga0395900_0059316_2732_3820 362
533 3300037418 Ga0395900_0089484 Ga0395900_0089484_1574_2662 362
534 3300037418 Ga0395900_0118125 Ga0395900_0118125_352_1440 362
535 3300037418 Ga0395900_0123203 Ga0395900_0123203_1461_2549 362
536 3300037418 Ga0395900_0255922 Ga0395900_0255922_370_1458 362
537 3300037466 Ga0395898_0000054 Ga0395898_0000054_222211_223365 362
538 3300037466 Ga0395898_0002720 Ga0395898_0002720_2619_3707 362
539 3300037466 Ga0395898_0020658 Ga0395898_0020658_1168_2256 362
540 3300037466 Ga0395898_0046065 Ga0395898_0046065_963_2051 362
541 3300037466 Ga0395898_0286211 Ga0395898_0286211_319_1407 362
542 3300037471 Ga0395905_0000046 Ga0395905_0000046_183217_184371 362
543 3300037471 Ga0395905_0001881 Ga0395905_0001881_20208_21296 362
544 3300037471 Ga0395905_0003151 Ga0395905_0003151_1204_2292 362
545 3300037471 Ga0395905_0007333 Ga0395905_0007333_4165_5253 362
546 3300037471 Ga0395905_0007948 Ga0395905_0007948_7551_8708 362
547 3300037471 Ga0395905_0008923 Ga0395905_0008923_7635_8723 362
548 3300037471 Ga0395905_0009946 Ga0395905_0009946_2878_3966 362
549 3300037471 Ga0395905_0011831 Ga0395905_0011831_901_2067 362
550 3300037471 Ga0395905_0012556 Ga0395905_0012556_5272_6360 362
551 3300037471 Ga0395905_0015579 Ga0395905_0015579_398_1486 362
552 3300037471 Ga0395905_0022116 Ga0395905_0022116_4769_5863 362
553 3300037471 Ga0395905_0040463 Ga0395905_0040463_2862_3950 362
554 3300037471 Ga0395905_0044960 Ga0395905_0044960_1544_2644 362
555 3300037471 Ga0395905_0054473 Ga0395905_0054473_524_1612 362
556 3300037471 Ga0395905_0061948 Ga0395905_0061948_753_1841 362
557 3300037471 Ga0395905_0084874 Ga0395905_0084874_792_1880 362
558 3300037471 Ga0395905_0089664 Ga0395905_0089664_1170_2258 362
559 3300037471 Ga0395905_0108987 Ga0395905_0108987_685_1773 362
560 3300037471 Ga0395905_0110415 Ga0395905_0110415_199_1287 362
561 3300037471 Ga0395905_0125912 Ga0395905_0125912_661_1749 362
562 3300038443 Ga0395901_0000102 Ga0395901_0000102_39746_40900 362
563 3300038443 Ga0395901_0003921 Ga0395901_0003921_8452_9540 362
564 3300038443 Ga0395901_0004628 Ga0395901_0004628_12245_13333 362
565 3300038443 Ga0395901_0008199 Ga0395901_0008199_7588_8676 362
566 3300038443 Ga0395901_0008454 Ga0395901_0008454_7113_8201 362
567 3300038443 Ga0395901_0021833 Ga0395901_0021833_3663_4751 362
568 3300038443 Ga0395901_0088285 Ga0395901_0088285_1119_2207 362
569 3300038443 Ga0395901_0107380 Ga0395901_0107380_1491_2657 362
570 3300038443 Ga0395901_0110317 Ga0395901_0110317_1707_2795 362
571 3300038443 Ga0395901_0115931 Ga0395901_0115931_1480_2568 362
572 3300038443 Ga0395901_0199899 Ga0395901_0199899_364_1452 362
573 3300038443 Ga0395901_0380027 Ga0395901_0380027_326_1414 362
574 3300038443 Ga0395901_0381421 Ga0395901_0381421_317_1405 362
575 3300038443 Ga0395901_0520355 Ga0395901_0520355_25_1113 362
576 3300042007 Ga0439449_0021347 Ga0439449_0021347_441_1529 362
577 3300046492 Ga0495585_0053016 Ga0495585_0053016_695_1783 362
578 3300046525 Ga0495663_0001341 Ga0495663_0001341_6608_7696 362
579 3300046528 Ga0495642_0043133 Ga0495642_0043133_79_1167 362
580 3300046539 Ga0495621_0003469 Ga0495621_0003469_2494_3582 362
581 3300046539 Ga0495621_0011641 Ga0495621_0011641_1304_2437 362
582 3300046616 Ga0495668_0005141 Ga0495668_0005141_2169_3257 362
583 3300046616 Ga0495668_0006700 Ga0495668_0006700_5300_6388 362
584 3300046684 Ga0495669_0000644 Ga0495669_0000644_3791_4879 362
585 3300046684 Ga0495669_0012236 Ga0495669_0012236_954_2042 362
586 3300046684 Ga0495669_0013035 Ga0495669_0013035_1185_2273 362
587 3300046684 Ga0495669_0026403 Ga0495669_0026403_998_2086 362
588 3300046684 Ga0495669_0027132 Ga0495669_0027132_214_1302 362
589 3300046684 Ga0495669_0047355 Ga0495669_0047355_587_1675 362
590 3300046691 Ga0495670_0013778 Ga0495670_0013778_1883_2971 362
591 3300047445 Ga0495677_0004567 Ga0495677_0004567_4123_5211 362
592 3300047445 Ga0495677_0014711 Ga0495677_0014711_177_1265 362
593 3300048904 Ga0496101_0046155 Ga0496101_0046155_911_1999 362
594 3300048906 Ga0496103_0150333 Ga0496103_0150333_55_1143 362
595 3300048907 Ga0496104_0088229 Ga0496104_0088229_94_1182 362
596 3300048910 Ga0496107_0001322 Ga0496107_0001322_8894_9982 362
597 3300048910 Ga0496107_0096407 Ga0496107_0096407_330_1418 362
598 3300048911 Ga0496108_0007117 Ga0496108_0007117_1388_2512 362
599 3300048911 Ga0496108_0034858 Ga0496108_0034858_948_2036 362
600 3300048911 Ga0496108_0150214 Ga0496108_0150214_819_1907 362
601 3300048912 Ga0496109_0003294 Ga0496109_0003294_12001_13089 362
602 3300048912 Ga0496109_0079464 Ga0496109_0079464_1779_2867 362
603 3300048912 Ga0496109_0086239 Ga0496109_0086239_1615_2703 362
604 3300048913 Ga0496110_0023225 Ga0496110_0023225_4110_5207 362
605 3300048913 Ga0496110_0032219 Ga0496110_0032219_412_1500 362
606 3300048914 Ga0496111_0025676 Ga0496111_0025676_2306_3403 362
607 3300048914 Ga0496111_0043684 Ga0496111_0043684_1840_2928 362
608 3300048915 Ga0496112_0000242 Ga0496112_0000242_9101_10189 362
609 3300048915 Ga0496112_0257639 Ga0496112_0257639_308_1396 362
610 3300048915 Ga0496112_0294767 Ga0496112_0294767_275_1363 362
611 3300048916 Ga0496113_0002738 Ga0496113_0002738_3523_4611 362
612 3300048916 Ga0496113_0013132 Ga0496113_0013132_2225_3322 362
613 3300048917 Ga0496114_0083136 Ga0496114_0083136_810_1898 362
614 3300049585 Ga0501069_0020563 Ga0501069_0020563_191_1279 362
615 3300050510 nmdc:mga06r32_100419_c1 nmdc:mga06r32_100419_c1_624_1712 362
616 3300050511 nmdc:mga08y16_277904_c1 nmdc:mga08y16_277904_c1_418_1506 362
617 3300050513 nmdc:mga0rr50_417799_c1 nmdc:mga0rr50_417799_c1_16_1104 362
618 3300053134 Ga0500658_0000032 Ga0500658_0000032_58788_59876 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

3

331

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6myw-assembly2.cif.gz_B gluconobacter ene-reductase (gluer) mutant - t36a 0.978 1 356
6o08-assembly1.cif.gz_A gluconobacter ene-reductase (gluer) 0.977 1 358
8fw1-assembly3.cif.gz_C gluconobacter ene-reductase (gluer) mutant - pager 0.9766 1 357
6myw-assembly2.cif.gz_B gluconobacter ene-reductase (gluer) mutant - t36a 0.9753 1 356
4a3u-assembly2.cif.gz_B x-structure of the old yellow enzyme homologue from zymomonas mobilis (ncr) 0.9743 2 356
ID Description Score Start End Superfamily
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9761 2 356 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9734 2 356 3.20.20.70
af_E9AGH8_6_374_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9523 2 356 3.20.20.70
af_Q4CNI1_1_256_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9483 4 227 3.20.20.70
af_E9AGH7_3_365_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9483 4 356 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6M1QEG4-F1-model_v4 deleted 0.9944 1 110
AF-A0A2T0KAG2-F1-model_v4 NADH:flavin oxidoreductase/NADH oxidase family protein 0.9865 1 147 GO:0005829
GO:0010181
GO:0016491
AF-A0A164GDP6-F1-model_v4 NADH-dependent flavin oxidoreductase yqiG-like protein 0.9846 154 250 GO:0005829
GO:0010181
GO:0016491
AF-A0A4Q2X3D4-F1-model_v4 deleted 0.9836 1 295
AF-A0A090QN19-F1-model_v4 2,4-dienoyl-CoA reductase (EC 1.3.1.34) 0.9824 4 262 GO:0005829
GO:0008670
GO:0010181

Feature Viewer

pLDDT pTM Quality
93.98 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map