F469736

General Info

Members Datasets Scaffolds Average Seq Length
618 256 612 85

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10672470|Ga0207645_106724702
Length 105
Sequence LDLEELTHLSSLEKCSHKPLMENKEIIEKIHSFLVEEFEVEPEKIVPEANLKETLGLDSLDYIDLVVVIESNFAFKVKPEDFTDIATFQDFCDYVISRVNSKELV

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
166 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
170 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
236 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
237 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
245 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
246 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
254 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
255 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
256 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 0
Rhizoplane 2.1
Rhizosphere 86.25
Stem 0
Stem Tuber 0
Unclassified 6.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F7QKVOU01BIBUY 2088090002 Bacteria 507
2 MBSR1b_contig_1436207 2162886012 Bacteria 1379
3 JGI24740J21852_10080703 3300001979 Bacteria 853
4 JGI24737J22298_10000148 3300001990 Bacteria 21941
5 JGI24735J21928_10000020 3300002067 Bacteria 108706
6 rootH1_10000337 3300003316 Bacteria 26455
7 rootH1_10000337 3300003323 Bacteria 8315
8 rootH1_10021873 3300003316 Bacteria 26221
9 rootH2_10001223 3300003320 Bacteria 131149
10 rootH2_10003246 3300003320 Bacteria 168239
11 rootH2_10340990 3300003320 Bacteria 1547
12 rootL2_10021639 3300003322 Bacteria 6506
13 rootL2_10023564 3300003322 Bacteria 9230
14 rootL2_10033367 3300003322 Bacteria 8550
15 rootH1_10002599 3300003316 Bacteria 7117
16 rootH1_10002599 3300003323 Bacteria 52591
17 rootH1_10027970 3300003323 Bacteria 2715
18 rootH1_10029269 3300003323 Bacteria 5270
19 rootH1_10052813 3300003323 Bacteria 3790
20 rootH1_10100022 3300003323 Bacteria 1243
21 Ga0065165_1007023 3300005262 Bacteria 5676
22 Ga0065714_10003718 3300005288 Bacteria 9007
23 Ga0065714_10076271 3300005288 Bacteria 2811
24 Ga0065714_10263545 3300005288 Bacteria 752
25 Ga0065714_10400664 3300005288 Bacteria 584
26 Ga0065704_10302631 3300005289 Bacteria 882
27 Ga0065707_10255691 3300005295 Bacteria 1112
28 Ga0070658_10104568 3300005327 Bacteria 2342
29 Ga0070658_10367116 3300005327 Bacteria 1234
30 Ga0070676_10000231 3300005328 Bacteria 23863
31 Ga0070676_10743144 3300005328 Unclassified 720
32 Ga0068869_100002049 3300005334 Bacteria 12106
33 Ga0068869_100157523 3300005334 Bacteria 1766
34 Ga0068869_100366804 3300005334 Bacteria 1177
35 Ga0068869_100557167 3300005334 Bacteria 964
36 Ga0068869_101151799 3300005334 Bacteria 680
37 Ga0070666_10000078 3300005335 Bacteria 69922
38 Ga0070666_10980979 3300005335 Unclassified 626
39 Ga0068868_100008072 3300005338 Bacteria 7529
40 Ga0068868_100028945 3300005338 Bacteria 4240
41 Ga0068868_100106199 3300005338 Bacteria 2277
42 Ga0068868_100249591 3300005338 Bacteria 1493
43 Ga0068868_100816863 3300005338 Bacteria 842
44 Ga0068868_101398951 3300005338 Unclassified 652
45 Ga0070689_100521400 3300005340 Bacteria 1020
46 Ga0070687_100862824 3300005343 Bacteria 646
47 Ga0070661_100578755 3300005344 Bacteria 906
48 Ga0070661_101268405 3300005344 Bacteria 617
49 Ga0070661_101559674 3300005344 Bacteria 558
50 Ga0070668_100081121 3300005347 Bacteria 2543
51 Ga0070668_100633423 3300005347 Bacteria 938
52 Ga0070668_101051238 3300005347 Bacteria 733
53 Ga0070675_100175229 3300005354 Bacteria 1852
54 Ga0070675_100192214 3300005354 Bacteria 1769
55 Ga0070675_101036663 3300005354 Bacteria 754
56 Ga0070671_100061553 3300005355 Bacteria 3126
57 Ga0070671_100134878 3300005355 Bacteria 2081
58 Ga0070671_100143560 3300005355 Bacteria 2015
59 Ga0070671_100149624 3300005355 Bacteria 1971
60 Ga0070674_100282843 3300005356 Bacteria 1315
61 Ga0070674_101264134 3300005356 Bacteria 657
62 Ga0070673_100018285 3300005364 Bacteria 5002
63 Ga0070673_100062741 3300005364 Bacteria 2954
64 Ga0070673_100073158 3300005364 Bacteria 2758
65 Ga0070673_100493944 3300005364 Bacteria 1106
66 Ga0070673_102281815 3300005364 Bacteria 514
67 Ga0070688_100057899 3300005365 Bacteria 2438
68 Ga0070688_101316324 3300005365 Bacteria 583
69 Ga0070688_101739910 3300005365 Bacteria 511
70 Ga0070667_100011803 3300005367 Bacteria 7222
71 Ga0070667_100026421 3300005367 Bacteria 4829
72 Ga0070667_100087311 3300005367 Bacteria 2677
73 Ga0070667_100743791 3300005367 Bacteria 909
74 Ga0070667_100822763 3300005367 Bacteria 863
75 Ga0070667_101514261 3300005367 Bacteria 630
76 Ga0070700_100141012 3300005441 Bacteria 1638
77 Ga0070700_100148338 3300005441 Bacteria 1601
78 Ga0070663_100364896 3300005455 Unclassified 1172
79 Ga0070663_100673765 3300005455 Bacteria 877
80 Ga0070678_100189429 3300005456 Bacteria 1690
81 Ga0070678_100393105 3300005456 Unclassified 1203
82 Ga0070678_100789775 3300005456 Bacteria 861
83 Ga0070662_100331851 3300005457 Unclassified 1243
84 Ga0068867_100000586 3300005459 Bacteria 24122
85 Ga0068867_100180724 3300005459 Bacteria 1677
86 Ga0068867_100590481 3300005459 Bacteria 967
87 Ga0068867_101964633 3300005459 Bacteria 552
88 Ga0070685_10013986 3300005466 Bacteria 4246
89 Ga0070685_10800480 3300005466 Bacteria 695
90 Ga0070685_10821806 3300005466 Bacteria 686
91 Ga0070685_11113106 3300005466 Bacteria 597
92 Ga0070679_100147590 3300005530 Unclassified 2329
93 Ga0068853_100007787 3300005539 Bacteria 8592
94 Ga0068853_100013770 3300005539 Bacteria 6608
95 Ga0068853_100091439 3300005539 Bacteria 2676
96 Ga0068853_100163124 3300005539 Bacteria 2012
97 Ga0070672_100102064 3300005543 Bacteria 2328
98 Ga0070672_100223214 3300005543 Bacteria 1581
99 Ga0070672_100261544 3300005543 Unclassified 1459
100 Ga0070672_100330760 3300005543 Bacteria 1296
101 Ga0070672_100801359 3300005543 Bacteria 829
102 Ga0070665_101761329 3300005548 Unclassified 626
103 Ga0068855_100053370 3300005563 Bacteria 4756
104 Ga0068855_100061731 3300005563 Bacteria 4378
105 Ga0068857_100059756 3300005577 Bacteria 3387
106 Ga0068857_101986428 3300005577 Unclassified 570
107 Ga0068854_100130757 3300005578 Bacteria 1916
108 Ga0068854_100293820 3300005578 Bacteria 1312
109 Ga0068854_100421874 3300005578 Bacteria 1108
110 Ga0068856_100003542 3300005614 Bacteria 15720
111 Ga0068856_100010896 3300005614 Bacteria 8825
112 Ga0068856_101259362 3300005614 Archaea 755
113 Ga0068856_101888544 3300005614 Bacteria 608
114 Ga0068852_100000614 3300005616 Bacteria 23382
115 Ga0068852_100002267 3300005616 Bacteria 13207
116 Ga0068852_100693104 3300005616 Bacteria 1028
117 Ga0068852_101397974 3300005616 Bacteria 722
118 Ga0068852_102302514 3300005616 Bacteria 560
119 Ga0068859_100000003 3300005617 Bacteria 479218
120 Ga0068859_100018877 3300005617 Bacteria 6929
121 Ga0068859_100081374 3300005617 Bacteria 3281
122 Ga0068859_100204161 3300005617 Bacteria 2061
123 Ga0068859_100336376 3300005617 Bacteria 1604
124 Ga0068859_101044336 3300005617 Bacteria 898
125 Ga0068864_100003917 3300005618 Bacteria 12262
126 Ga0068864_100167138 3300005618 Bacteria 2003
127 Ga0068864_100308683 3300005618 Bacteria 1483
128 Ga0068864_101851077 3300005618 Bacteria 609
129 Ga0068866_10001781 3300005718 Bacteria 9071
130 Ga0068866_10173086 3300005718 Unclassified 1269
131 Ga0068861_101452453 3300005719 Bacteria 671
132 Ga0068861_102162576 3300005719 Bacteria 557
133 Ga0068851_10028995 3300005834 Bacteria 2737
134 Ga0068851_10082916 3300005834 Bacteria 1677
135 Ga0068851_10099533 3300005834 Bacteria 1541
136 Ga0068851_10578827 3300005834 Bacteria 681
137 Ga0068863_100006890 3300005841 Bacteria 11136
138 Ga0068863_100265284 3300005841 Bacteria 1661
139 Ga0068863_100441702 3300005841 Bacteria 1276
140 Ga0068863_101311389 3300005841 Unclassified 731
141 Ga0068863_101565280 3300005841 Bacteria 668
142 Ga0068863_102043464 3300005841 Bacteria 583
143 Ga0068858_100002816 3300005842 Bacteria 17485
144 Ga0068858_101406486 3300005842 Bacteria 687
145 Ga0068860_100002009 3300005843 Bacteria 21464
146 Ga0068860_100007756 3300005843 Bacteria 10722
147 Ga0068860_100016973 3300005843 Bacteria 7095
148 Ga0068860_100704279 3300005843 Bacteria 1020
149 Ga0068860_101019895 3300005843 Bacteria 846
150 Ga0068860_102051766 3300005843 Unclassified 593
151 Ga0068862_100133101 3300005844 Bacteria 2201
152 Ga0068862_101787858 3300005844 Bacteria 624
153 Ga0075369_10341444 3300006186 Bacteria 702
154 Ga0075366_10000091 3300006195 Bacteria 36066
155 Ga0075366_10092113 3300006195 Bacteria 1816
156 Ga0075366_10558183 3300006195 Bacteria 709
157 Ga0097621_100000777 3300006237 Bacteria 22354
158 Ga0097621_100001974 3300006237 Bacteria 13971
159 Ga0097621_100143444 3300006237 Bacteria 2043
160 Ga0097621_100738492 3300006237 Bacteria 908
161 Ga0097621_100894428 3300006237 Unclassified 827
162 Ga0097621_101036554 3300006237 Bacteria 768
163 Ga0075370_10596015 3300006353 Bacteria 669
164 Ga0068871_100000154 3300006358 Bacteria 45466
165 Ga0068871_100074646 3300006358 Bacteria 2798
166 Ga0068871_100180249 3300006358 Bacteria 1815
167 Ga0068871_101179246 3300006358 Bacteria 718
168 Ga0068871_101388425 3300006358 Bacteria 662
169 Ga0068871_101849478 3300006358 Bacteria 574
170 Ga0075430_100128116 3300006846 Bacteria 2116
171 Ga0075431_100915216 3300006847 Bacteria 846
172 Ga0068865_100000172 3300006881 Bacteria 35866
173 Ga0068865_100182295 3300006881 Bacteria 1618
174 Ga0068865_100253168 3300006881 Bacteria 1391
175 Ga0068865_101536913 3300006881 Unclassified 597
176 Ga0097620_100000003 3300006931 Bacteria 479218
177 Ga0097620_100018877 3300006931 Bacteria 6929
178 Ga0097620_100081377 3300006931 Bacteria 3281
179 Ga0097620_100204160 3300006931 Bacteria 2061
180 Ga0097620_100336379 3300006931 Bacteria 1604
181 Ga0097620_101044479 3300006931 Bacteria 898
182 Ga0105240_11649717 3300009093 Bacteria 670
183 Ga0105240_11863377 3300009093 Bacteria 626
184 Ga0105240_12443212 3300009093 Bacteria 541
185 Ga0111539_10018476 3300009094 Bacteria 8635
186 Ga0111539_10024964 3300009094 Bacteria 7325
187 Ga0111539_10342300 3300009094 Bacteria 1741
188 Ga0111539_11216489 3300009094 Bacteria 875
189 Ga0111539_11365601 3300009094 Bacteria 822
190 Ga0105245_10504692 3300009098 Bacteria 1226
191 Ga0105245_10714983 3300009098 Bacteria 1036
192 Ga0105247_10001017 3300009101 Bacteria 21132
193 Ga0105247_10402581 3300009101 Bacteria 976
194 Ga0105247_10823230 3300009101 Unclassified 710
195 Ga0105243_10207292 3300009148 Bacteria 1723
196 Ga0105243_10618732 3300009148 Bacteria 1045
197 Ga0105243_12410793 3300009148 Bacteria 565
198 Ga0105241_10000847 3300009174 Bacteria 23164
199 Ga0105241_10013980 3300009174 Bacteria 5886
200 Ga0105241_10374406 3300009174 Bacteria 1242
201 Ga0105241_12369509 3300009174 Bacteria 529
202 Ga0105242_10020115 3300009176 Bacteria 5232
203 Ga0105242_10083586 3300009176 Bacteria 2674
204 Ga0105242_10104661 3300009176 Unclassified 2403
205 Ga0105242_10784764 3300009176 Bacteria 941
206 Ga0105242_12137198 3300009176 Unclassified 604
207 Ga0105242_12147183 3300009176 Bacteria 603
208 Ga0105248_10497438 3300009177 Bacteria 1374
209 Ga0105237_10001395 3300009545 Bacteria 31908
210 Ga0105237_10001455 3300009545 Bacteria 31241
211 Ga0105237_10466611 3300009545 Bacteria 1269
212 Ga0105237_12399183 3300009545 Bacteria 538
213 Ga0105237_12767060 3300009545 Bacteria 502
214 Ga0105238_10596424 3300009551 Unclassified 1112
215 Ga0105238_11200254 3300009551 Bacteria 783
216 Ga0105238_11568767 3300009551 Bacteria 688
217 Ga0105249_10005639 3300009553 Bacteria 10832
218 Ga0105249_10687441 3300009553 Bacteria 1082
219 Ga0105249_11752232 3300009553 Bacteria 694
220 Ga0105249_12597274 3300009553 Bacteria 579
221 Ga0105249_12642204 3300009553 Unclassified 574
222 Ga0105239_10054410 3300010375 Bacteria 4390
223 Ga0105239_10064333 3300010375 Bacteria 4026
224 Ga0105239_10160641 3300010375 Bacteria 2510
225 Ga0105239_10176462 3300010375 Bacteria 2390
226 Ga0105239_10513044 3300010375 Bacteria 1363
227 Ga0105239_11841067 3300010375 Bacteria 702
228 Ga0105246_10087476 3300011119 Bacteria 2237
229 Ga0105246_10291745 3300011119 Bacteria 1313
230 Ga0157371_10042159 3300013102 Bacteria 3254
231 Ga0157370_10231082 3300013104 Bacteria 1712
232 Ga0157370_10399185 3300013104 Unclassified 1266
233 Ga0157370_10914332 3300013104 Bacteria 796
234 Ga0157370_11278688 3300013104 Bacteria 661
235 Ga0157369_10185088 3300013105 Bacteria 2190
236 Ga0157374_10000849 3300013296 Bacteria 26704
237 Ga0157374_10131243 3300013296 Bacteria 2425
238 Ga0157374_10211921 3300013296 Bacteria 1899
239 Ga0157374_10294586 3300013296 Bacteria 1604
240 Ga0157374_10388546 3300013296 Bacteria 1391
241 Ga0157374_11134958 3300013296 Bacteria 802
242 Ga0157374_11256376 3300013296 Bacteria 762
243 Ga0157378_10007598 3300013297 Bacteria 9463
244 Ga0157378_10038908 3300013297 Bacteria 4217
245 Ga0157378_10080319 3300013297 Bacteria 2946
246 Ga0157378_10158378 3300013297 Bacteria 2116
247 Ga0157378_10617202 3300013297 Bacteria 1097
248 Ga0157378_11732384 3300013297 Bacteria 672
249 Ga0157378_12878957 3300013297 Bacteria 533
250 Ga0157378_13032038 3300013297 Bacteria 521
251 Ga0163162_10000361 3300013306 Bacteria 41263
252 Ga0163162_10000568 3300013306 Bacteria 34113
253 Ga0163162_10061419 3300013306 Bacteria 3796
254 Ga0163162_10065676 3300013306 Bacteria 3676
255 Ga0163162_10172866 3300013306 Bacteria 2285
256 Ga0163162_10456307 3300013306 Bacteria 1410
257 Ga0163162_10593971 3300013306 Bacteria 1234
258 Ga0163162_10775708 3300013306 Unclassified 1077
259 Ga0163162_11239030 3300013306 Unclassified 847
260 Ga0163162_11905804 3300013306 Bacteria 680
261 Ga0157372_10001279 3300013307 Bacteria 27221
262 Ga0157372_10027329 3300013307 Bacteria 6213
263 Ga0157372_11032845 3300013307 Bacteria 952
264 Ga0157375_10003003 3300013308 Bacteria 14649
265 Ga0157375_10239294 3300013308 Bacteria 1975
266 Ga0157375_10309110 3300013308 Bacteria 1745
267 Ga0157375_10364905 3300013308 Bacteria 1610
268 Ga0157375_10416474 3300013308 Bacteria 1510
269 Ga0157375_11184975 3300013308 Bacteria 896
270 Ga0157375_11283565 3300013308 Bacteria 860
271 Ga0157375_13342079 3300013308 Bacteria 535
272 Ga0163163_10086565 3300014325 Bacteria 3143
273 Ga0163163_10098735 3300014325 Bacteria 2941
274 Ga0163163_10623390 3300014325 Bacteria 1142
275 Ga0163163_10831385 3300014325 Bacteria 987
276 Ga0163163_11095282 3300014325 Unclassified 859
277 Ga0163163_12098616 3300014325 Bacteria 625
278 Ga0163163_12139922 3300014325 Bacteria 619
279 Ga0157380_10000046 3300014326 Bacteria 73022
280 Ga0157380_10009471 3300014326 Bacteria 6980
281 Ga0157380_10021434 3300014326 Bacteria 4846
282 Ga0157380_10591603 3300014326 Bacteria 1096
283 Ga0157380_10794307 3300014326 Bacteria 963
284 Ga0157380_12417229 3300014326 Bacteria 591
285 Ga0157380_13310532 3300014326 Bacteria 515
286 Ga0157377_10540315 3300014745 Unclassified 821
287 Ga0157377_10561183 3300014745 Bacteria 808
288 Ga0157377_10759002 3300014745 Bacteria 711
289 Ga0157379_10123204 3300014968 Bacteria 2333
290 Ga0157379_10245139 3300014968 Bacteria 1625
291 Ga0157379_11535403 3300014968 Bacteria 649
292 Ga0157379_12131652 3300014968 Bacteria 556
293 Ga0157376_10082731 3300014969 Unclassified 2759
294 Ga0157376_10319822 3300014969 Unclassified 1475
295 Ga0157376_11329550 3300014969 Bacteria 749
296 Ga0157376_12037201 3300014969 Bacteria 612
297 Ga0163161_10222185 3300017792 Bacteria 1463
298 Ga0163161_11763991 3300017792 Bacteria 549
299 Ga0206351_10503684 3300020077 Bacteria 1872
300 Ga0209258_128797 3300025242 Bacteria 527
301 Ga0209026_1000226 3300025250 Bacteria 77076
302 Ga0207656_10018556 3300025321 Bacteria 2741
303 Ga0207656_10018811 3300025321 Bacteria 2724
304 Ga0207656_10400381 3300025321 Bacteria 690
305 Ga0207656_10593079 3300025321 Bacteria 566
306 Ga0207682_10191800 3300025893 Bacteria 937
307 Ga0207682_10205562 3300025893 Bacteria 907
308 Ga0207682_10541329 3300025893 Unclassified 551
309 Ga0207642_10254681 3300025899 Unclassified 998
310 Ga0207710_10021990 3300025900 Bacteria 2735
311 Ga0207710_10222228 3300025900 Bacteria 938
312 Ga0207688_10815651 3300025901 Unclassified 591
313 Ga0207680_10000102 3300025903 Bacteria 39308
314 Ga0207680_11196778 3300025903 Unclassified 542
315 Ga0207647_10028556 3300025904 Bacteria 3621
316 Ga0207647_10247553 3300025904 Bacteria 1023
317 Ga0207647_10430505 3300025904 Bacteria 741
318 Ga0207645_10000146 3300025907 Bacteria 55323
319 Ga0207645_10627096 3300025907 Bacteria 730
320 Ga0207645_10672470 3300025907 Unclassified 703
321 Ga0207705_10373636 3300025909 Bacteria 1101
322 Ga0207654_10010768 3300025911 Bacteria 4657
323 Ga0207654_10023238 3300025911 Bacteria 3318
324 Ga0207654_10968169 3300025911 Bacteria 618
325 Ga0207695_11317652 3300025913 Bacteria 602
326 Ga0207671_10007457 3300025914 Bacteria 9492
327 Ga0207671_10194657 3300025914 Unclassified 1582
328 Ga0207649_11069273 3300025920 Bacteria 636
329 Ga0207649_11118181 3300025920 Bacteria 622
330 Ga0207649_11356511 3300025920 Bacteria 563
331 Ga0207652_11064618 3300025921 Unclassified 709
332 Ga0207681_10505150 3300025923 Bacteria 990
333 Ga0207681_10658458 3300025923 Bacteria 869
334 Ga0207694_10009457 3300025924 Bacteria 7347
335 Ga0207650_10036252 3300025925 Bacteria 3587
336 Ga0207650_10087490 3300025925 Bacteria 2374
337 Ga0207650_10292844 3300025925 Bacteria 1328
338 Ga0207650_11394195 3300025925 Bacteria 596
339 Ga0207650_11538583 3300025925 Bacteria 565
340 Ga0207659_10107535 3300025926 Bacteria 2114
341 Ga0207659_10820061 3300025926 Bacteria 799
342 Ga0207687_10534911 3300025927 Bacteria 981
343 Ga0207687_10919561 3300025927 Bacteria 749
344 Ga0207644_10021819 3300025931 Bacteria 4367
345 Ga0207644_10043479 3300025931 Bacteria 3188
346 Ga0207644_10086484 3300025931 Bacteria 2328
347 Ga0207706_10226838 3300025933 Bacteria 1635
348 Ga0207686_10097460 3300025934 Bacteria 1956
349 Ga0207686_10188577 3300025934 Bacteria 1468
350 Ga0207686_10329227 3300025934 Unclassified 1144
351 Ga0207709_10218997 3300025935 Bacteria 1371
352 Ga0207669_11463752 3300025937 Bacteria 582
353 Ga0207704_10000205 3300025938 Bacteria 30268
354 Ga0207704_10131108 3300025938 Bacteria 1736
355 Ga0207704_11356321 3300025938 Bacteria 609
356 Ga0207691_10120725 3300025940 Bacteria 2323
357 Ga0207691_10128331 3300025940 Unclassified 2242
358 Ga0207691_10178850 3300025940 Bacteria 1854
359 Ga0207691_10286780 3300025940 Bacteria 1416
360 Ga0207689_10003994 3300025942 Bacteria 13420
361 Ga0207689_10205674 3300025942 Unclassified 1626
362 Ga0207679_10738451 3300025945 Bacteria 895
363 Ga0207679_11225023 3300025945 Bacteria 689
364 Ga0207667_10070023 3300025949 Bacteria 3651
365 Ga0207667_10438577 3300025949 Bacteria 1328
366 Ga0207667_11250387 3300025949 Bacteria 720
367 Ga0207651_10042253 3300025960 Bacteria 3033
368 Ga0207651_10214971 3300025960 Unclassified 1550
369 Ga0207651_10663007 3300025960 Bacteria 916
370 Ga0207651_12028967 3300025960 Bacteria 517
371 Ga0207712_10001952 3300025961 Bacteria 13536
372 Ga0207712_10101960 3300025961 Bacteria 2135
373 Ga0207712_10247582 3300025961 Bacteria 1439
374 Ga0207712_11651169 3300025961 Unclassified 574
375 Ga0207668_10147319 3300025972 Bacteria 1818
376 Ga0207668_10252846 3300025972 Bacteria 1432
377 Ga0207668_11459364 3300025972 Bacteria 617
378 Ga0207640_10264593 3300025981 Bacteria 1342
379 Ga0207658_10024854 3300025986 Bacteria 4191
380 Ga0207658_10059050 3300025986 Bacteria 2857
381 Ga0207658_10075189 3300025986 Bacteria 2569
382 Ga0207658_10473783 3300025986 Unclassified 1112
383 Ga0207658_11194764 3300025986 Bacteria 695
384 Ga0207677_10002126 3300026023 Bacteria 10402
385 Ga0207677_10043214 3300026023 Bacteria 2994
386 Ga0207677_10192782 3300026023 Bacteria 1613
387 Ga0207677_11224845 3300026023 Bacteria 688
388 Ga0207703_10004081 3300026035 Bacteria 12045
389 Ga0207703_11324738 3300026035 Bacteria 693
390 Ga0207703_12169099 3300026035 Bacteria 532
391 Ga0207639_10009956 3300026041 Bacteria 6569
392 Ga0207639_10034913 3300026041 Unclassified 3720
393 Ga0207639_10064192 3300026041 Bacteria 2846
394 Ga0207639_10152291 3300026041 Bacteria 1938
395 Ga0207639_10207681 3300026041 Bacteria 1684
396 Ga0207639_11126736 3300026041 Bacteria 736
397 Ga0207678_10747799 3300026067 Unclassified 862
398 Ga0207708_10153497 3300026075 Bacteria 1815
399 Ga0207702_10024888 3300026078 Bacteria 4967
400 Ga0207702_10029754 3300026078 Bacteria 4546
401 Ga0207641_10000015 3300026088 Bacteria 321332
402 Ga0207641_10012810 3300026088 Bacteria 6875
403 Ga0207641_10801050 3300026088 Unclassified 932
404 Ga0207641_11301333 3300026088 Bacteria 727
405 Ga0207648_10000747 3300026089 Bacteria 36518
406 Ga0207648_10047974 3300026089 Bacteria 3741
407 Ga0207648_10223369 3300026089 Bacteria 1674
408 Ga0207648_11614730 3300026089 Unclassified 609
409 Ga0207648_12066969 3300026089 Bacteria 531
410 Ga0207676_10002059 3300026095 Bacteria 14593
411 Ga0207676_10262176 3300026095 Bacteria 1561
412 Ga0207676_10842640 3300026095 Bacteria 896
413 Ga0207676_10963491 3300026095 Unclassified 839
414 Ga0207676_11342469 3300026095 Bacteria 710
415 Ga0207674_10314308 3300026116 Bacteria 1516
416 Ga0207674_10913472 3300026116 Bacteria 846
417 Ga0207675_100731756 3300026118 Bacteria 1000
418 Ga0207675_100774128 3300026118 Bacteria 972
419 Ga0207683_10006913 3300026121 Bacteria 9712
420 Ga0207683_10168572 3300026121 Bacteria 1982
421 Ga0207683_10211041 3300026121 Bacteria 1767
422 Ga0207683_10967059 3300026121 Bacteria 791
423 Ga0207698_10003892 3300026142 Bacteria 9039
424 Ga0207698_10021755 3300026142 Unclassified 4442
425 Ga0207698_10895928 3300026142 Bacteria 894
426 Ga0207698_11523284 3300026142 Bacteria 684
427 Ga0207698_11840514 3300026142 Unclassified 620
428 Ga0209968_1040181 3300027526 Bacteria 799
429 Ga0209966_1026011 3300027695 Bacteria 1164
430 Ga0207428_10019792 3300027907 Bacteria 5733
431 Ga0207428_10611661 3300027907 Bacteria 784
432 Ga0268265_10475192 3300028380 Bacteria 1173
433 Ga0268265_10504424 3300028380 Bacteria 1141
434 Ga0268265_12062726 3300028380 Bacteria 577
435 Ga0268264_10001199 3300028381 Bacteria 25035
436 Ga0268264_10002153 3300028381 Bacteria 17563
437 Ga0268264_10003263 3300028381 Bacteria 14030
438 Ga0268264_11297099 3300028381 Bacteria 738
439 Ga0307515_10000001 3300028794 Bacteria 4259510
440 Ga0307515_10000031 3300028794 Bacteria 358648
441 Ga0307515_10000667 3300028794 Bacteria 79135
442 Ga0307515_10000790 3300028794 Bacteria 72891
443 Ga0307515_10461049 3300028794 Bacteria 885
444 Ga0307513_10254115 3300031456 Bacteria 1552
445 Ga0307513_10356067 3300031456 Bacteria 1210
446 Ga0307513_10732073 3300031456 Bacteria 695
447 Ga0307509_10278917 3300031507 Bacteria 1434
448 Ga0307509_10399904 3300031507 Bacteria 1081
449 Ga0307408_100077086 3300031548 Bacteria 2482
450 Ga0307514_10051268 3300031649 Bacteria 3199
451 Ga0307514_10415306 3300031649 Bacteria 679
452 Ga0307516_10307902 3300031730 Bacteria 1258
453 Ga0307516_10453204 3300031730 Bacteria 939
454 Ga0307413_10164185 3300031824 Bacteria 1564
455 Ga0307410_11427670 3300031852 Bacteria 608
456 Ga0307412_11616238 3300031911 Unclassified 592
457 Ga0307416_102413489 3300032002 Bacteria 625
458 Ga0307414_10141912 3300032004 Unclassified 1882
459 Ga0307411_12057236 3300032005 Bacteria 534
460 Ga0307507_10000144 3300033179 Bacteria 123842
461 Ga0373945_0533537 3300035116 Bacteria 525
462 Ga0395899_0037668 3300037312 Bacteria 3625
463 Ga0395900_0027720 3300037418 Bacteria 5803
464 Ga0395898_0827926 3300037466 Bacteria 865
465 Ga0395905_0000003 3300037471 Bacteria 1347396
466 Ga0395905_0000049 3300037471 Bacteria 230719
467 Ga0395905_0001249 3300037471 Bacteria 31492
468 Ga0395901_0003386 3300038443 Bacteria 16061
469 Ga0439436_0143721 3300041404 Unclassified 671
470 Ga0439453_0178518 3300041408 Bacteria 517
471 Ga0451787_422665 3300041441 Unclassified 523
472 Ga0451789_0303625 3300041443 Bacteria 1449
473 Ga0451791_0797082 3300041451 Bacteria 546
474 Ga0451793_0259997 3300041452 Bacteria 2004
475 Ga0451793_0929927 3300041452 Bacteria 789
476 Ga0451797_0007636 3300041453 Bacteria 515
477 Ga0451800_0613430 3300041459 Unclassified 511
478 Ga0451800_0742141 3300041459 Unclassified 602
479 Ga0451802_0652972 3300041460 Bacteria 509
480 Ga0451802_1007957 3300041460 Bacteria 674
481 Ga0451802_1093250 3300041460 Bacteria 823
482 Ga0451807_0874893 3300041486 Unclassified 670
483 Ga0451849_0096302 3300041505 Bacteria 561
484 Ga0451849_0521996 3300041505 Unclassified 1395
485 Ga0451849_1063937 3300041505 Bacteria 534
486 Ga0451851_0284543 3300041507 Bacteria 906
487 Ga0451851_1334134 3300041507 Unclassified 740
488 Ga0451853_0724937 3300041512 Unclassified 525
489 Ga0451853_0791209 3300041512 Bacteria 634
490 Ga0451853_1889411 3300041512 Bacteria 656
491 Ga0451853_2398176 3300041512 Bacteria 544
492 Ga0466966_0066002 3300044684 Unclassified 2275
493 Ga0466964_0085184 3300044706 Bacteria 1364
494 Ga0453684_0748735 3300044712 Bacteria 1058
495 Ga0466967_1979102 3300045976 Bacteria 579
496 Ga0495592_0478108 3300046454 Bacteria 776
497 Ga0495592_0775841 3300046454 Bacteria 571
498 Ga0495629_0121363 3300046459 Bacteria 1821
499 Ga0495629_0879716 3300046459 Bacteria 588
500 Ga0495638_0247841 3300046460 Bacteria 983
501 Ga0495651_0180197 3300046462 Bacteria 1496
502 Ga0495651_0759170 3300046462 Bacteria 601
503 Ga0495650_0000095 3300046471 Bacteria 218020
504 Ga0495585_0000057 3300046492 Bacteria 113069
505 Ga0495585_0002733 3300046492 Bacteria 12319
506 Ga0495585_0011600 3300046492 Bacteria 5211
507 Ga0495583_0005597 3300046506 Bacteria 8469
508 Ga0495583_0381052 3300046506 Bacteria 555
509 Ga0495606_0000009 3300046507 Bacteria 306313
510 Ga0495606_0191418 3300046507 Bacteria 1172
511 Ga0495608_0076564 3300046511 Bacteria 2179
512 Ga0495610_0000867 3300046512 Bacteria 28278
513 Ga0495610_0260541 3300046512 Bacteria 683
514 Ga0495610_0306604 3300046512 Bacteria 610
515 Ga0495616_0000733 3300046513 Bacteria 24135
516 Ga0495618_0670649 3300046514 Bacteria 612
517 Ga0495628_0076588 3300046516 Bacteria 2603
518 Ga0495628_1161392 3300046516 Bacteria 525
519 Ga0495631_0120747 3300046518 Bacteria 1127
520 Ga0495631_0120947 3300046518 Bacteria 1126
521 Ga0495637_0117271 3300046520 Bacteria 1027
522 Ga0495637_0135435 3300046520 Bacteria 938
523 Ga0495648_0003800 3300046524 Bacteria 13122
524 Ga0495648_0036248 3300046524 Bacteria 3185
525 Ga0495648_0057079 3300046524 Bacteria 2344
526 Ga0495663_0196072 3300046525 Bacteria 703
527 Ga0495652_0304302 3300046529 Bacteria 1158
528 Ga0495652_0368867 3300046529 Bacteria 1024
529 Ga0495654_0078110 3300046530 Bacteria 1557
530 Ga0495654_0242893 3300046530 Bacteria 753
531 Ga0495598_0178109 3300046537 Bacteria 757
532 Ga0495609_0015217 3300046538 Bacteria 3603
533 Ga0495609_0018877 3300046538 Bacteria 3193
534 Ga0495609_0037794 3300046538 Bacteria 2177
535 Ga0495621_0063398 3300046539 Bacteria 1347
536 Ga0495622_0008647 3300046557 Bacteria 4718
537 Ga0495622_0037148 3300046557 Bacteria 2269
538 Ga0495622_0220672 3300046557 Bacteria 840
539 Ga0495633_0000275 3300046558 Bacteria 60032
540 Ga0495633_0003968 3300046558 Bacteria 9609
541 Ga0495668_0000017 3300046616 Bacteria 434025
542 Ga0495668_0198463 3300046616 Bacteria 1099
543 Ga0495625_0000007 3300046660 Bacteria 565749
544 Ga0495625_0000435 3300046660 Bacteria 62758
545 Ga0495625_0001213 3300046660 Bacteria 32692
546 Ga0495625_0040215 3300046660 Bacteria 3412
547 Ga0495661_0000576 3300046665 Bacteria 38166
548 Ga0495588_0102322 3300046674 Bacteria 1506
549 Ga0495658_0025386 3300046683 Bacteria 3167
550 Ga0495658_0044823 3300046683 Bacteria 2479
551 Ga0495670_0151582 3300046691 Bacteria 1216
552 Ga0495670_0844602 3300046691 Bacteria 500
553 Ga0495671_0027550 3300046692 Bacteria 2934
554 Ga0495649_0000007 3300046694 Bacteria 518037
555 Ga0495600_0219554 3300046809 Bacteria 1216
556 Ga0495600_0686852 3300046809 Bacteria 617
557 Ga0495660_0020251 3300046810 Bacteria 3812
558 Ga0495660_0102272 3300046810 Bacteria 1473
559 Ga0495636_0120574 3300047318 Bacteria 1160
560 Ga0495672_0037564 3300047320 Bacteria 2962
561 Ga0495676_0441869 3300047321 Bacteria 859
562 Ga0495683_0082685 3300047323 Bacteria 1564
563 Ga0495687_000440 3300047443 Bacteria 51285
564 Ga0495687_036112 3300047443 Bacteria 2214
565 Ga0495677_0447931 3300047445 Bacteria 511
566 Ga0495679_160294 3300047446 Bacteria 601
567 Ga0495673_0029094 3300047469 Bacteria 2611
568 Ga0495686_0031274 3300047472 Bacteria 3453
569 Ga0495686_0619986 3300047472 Bacteria 558
570 Ga0495602_0879454 3300048088 Bacteria 597
571 Ga0495614_0019267 3300048089 Bacteria 2953
572 Ga0495626_0117421 3300048091 Bacteria 1147
573 Ga0496110_1333775 3300048913 Bacteria 627
574 Ga0495682_0052571 3300049460 Bacteria 1480
575 Ga0501322_012301 3300049538 Bacteria 679
576 Ga0501323_019456 3300049539 Bacteria 885
577 Ga0501032_0107271 3300049569 Bacteria 1850
578 Ga0501034_0000002 3300049571 Bacteria 565510
579 Ga0501036_0564675 3300049572 Bacteria 945
580 Ga0501037_0424039 3300049573 Bacteria 910
581 Ga0501047_0430720 3300049581 Bacteria 1150
582 Ga0501202_061324 3300049652 Unclassified 851
583 Ga0501236_001209 3300049670 Bacteria 2928
584 Ga0501264_002656 3300049761 Bacteria 1647
585 nmdc:mga0k408_490_c1 3300050493 Bacteria 21695
586 nmdc:mga0k408_5994_c1 3300050493 Bacteria 6487
587 nmdc:mga0k408_656162_c1 3300050493 Bacteria 617
588 nmdc:mga07m45_548033_c1 3300050496 Bacteria 669
589 nmdc:mga0qj67_50936_c1 3300050509 Bacteria 3273
590 nmdc:mga06r32_983902_c1 3300050510 Bacteria 797
591 nmdc:mga08y16_22038_c1 3300050511 Bacteria 6727
592 nmdc:mga08y16_22108_c1 3300050511 Bacteria 6714
593 nmdc:mga08y16_284540_c1 3300050511 Bacteria 1705
594 nmdc:mga0sz30_160790_c1 3300050516 Bacteria 995
595 Ga0500646_0143247 3300053090 Bacteria 786
596 Ga0500646_0289881 3300053090 Bacteria 585
597 Ga0500646_0292639 3300053090 Bacteria 582
598 Ga0500562_086968 3300053108 Bacteria 847
599 Ga0500594_0210115 3300053118 Bacteria 641
600 Ga0500618_000033 3300053125 Bacteria 121886
601 Ga0500618_033636 3300053125 Bacteria 1195
602 Ga0500655_031304 3300053133 Bacteria 1025
603 Ga0500658_0250366 3300053134 Bacteria 814
604 Ga0500561_0168618 3300053137 Bacteria 686
605 Ga0500604_0001406 3300053151 Bacteria 6702
606 Ga0500622_0000012 3300053156 Bacteria 383183
607 Ga0500622_0000030 3300053156 Bacteria 208734
608 Ga0500622_0012337 3300053156 Bacteria 4627
609 Ga0500627_0066865 3300053158 Bacteria 1588
610 Ga0500634_0124452 3300053161 Bacteria 1249
611 Ga0500567_259717 3300053723 Bacteria 505
612 Ga0500661_003220 3300055283 Bacteria 3074

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_11216489 Ga0111539_112164892 82
2 3300009553 Ga0105249_11752232 Ga0105249_117522321 82
3 3300013308 Ga0157375_10416474 Ga0157375_104164742 82
4 3300014325 Ga0163163_10831385 Ga0163163_108313852 82
5 3300003316 rootH1_10000337 rootH1_100003375 83
6 3300003316 rootH1_10021873 rootH1_100218732 83
7 3300003320 rootH2_10003246 rootH2_10003246131 83
8 3300003322 rootL2_10023564 rootL2_100235643 83
9 3300003322 rootL2_10033367 rootL2_100333675 83
10 3300003323 rootH1_10002599 rootH1_1000259925 83
11 3300003323 rootH1_10029269 rootH1_100292696 83
12 3300003323 rootH1_10052813 rootH1_100528132 83
13 3300003323 rootH1_10100022 rootH1_101000221 83
14 3300005262 Ga0065165_1007023 Ga0065165_10070235 83
15 3300006195 Ga0075366_10558183 Ga0075366_105581832 83
16 3300006846 Ga0075430_100128116 Ga0075430_1001281161 83
17 3300006847 Ga0075431_100915216 Ga0075431_1009152161 83
18 3300009094 Ga0111539_10018476 Ga0111539_100184767 83
19 3300009094 Ga0111539_10024964 Ga0111539_100249646 83
20 3300010375 Ga0105239_11841067 Ga0105239_118410672 83
21 3300013297 Ga0157378_12878957 Ga0157378_128789571 83
22 3300014326 Ga0157380_10021434 Ga0157380_100214343 83
23 3300026118 Ga0207675_100774128 Ga0207675_1007741282 83
24 3300027526 Ga0209968_1040181 Ga0209968_10401812 83
25 3300027695 Ga0209966_1026011 Ga0209966_10260112 83
26 3300027907 Ga0207428_10019792 Ga0207428_100197923 83
27 3300027907 Ga0207428_10611661 Ga0207428_106116611 83
28 3300028794 Ga0307515_10461049 Ga0307515_104610492 83
29 3300031456 Ga0307513_10254115 Ga0307513_102541152 83
30 3300031456 Ga0307513_10732073 Ga0307513_107320732 83
31 3300031507 Ga0307509_10399904 Ga0307509_103999042 83
32 3300031548 Ga0307408_100077086 Ga0307408_1000770863 83
33 3300031730 Ga0307516_10307902 Ga0307516_103079022 83
34 3300031730 Ga0307516_10453204 Ga0307516_104532041 83
35 3300031824 Ga0307413_10164185 Ga0307413_101641852 83
36 3300031852 Ga0307410_11427670 Ga0307410_114276702 83
37 3300032002 Ga0307416_102413489 Ga0307416_1024134891 83
38 3300032005 Ga0307411_12057236 Ga0307411_120572362 83
39 3300041404 Ga0439436_0143721 Ga0439436_0143721_193_450 83
40 3300041408 Ga0439453_0178518 Ga0439453_0178518_164_421 83
41 3300041441 Ga0451787_422665 Ga0451787_422665_84_341 83
42 3300041453 Ga0451797_0007636 Ga0451797_0007636_28_285 83
43 3300041459 Ga0451800_0613430 Ga0451800_0613430_152_409 83
44 3300041459 Ga0451800_0742141 Ga0451800_0742141_288_551 83
45 3300041460 Ga0451802_1007957 Ga0451802_1007957_44_301 83
46 3300041460 Ga0451802_1093250 Ga0451802_1093250_547_807 83
47 3300041486 Ga0451807_0874893 Ga0451807_0874893_231_488 83
48 3300041505 Ga0451849_0521996 Ga0451849_0521996_999_1256 83
49 3300041507 Ga0451851_1334134 Ga0451851_1334134_397_654 83
50 3300041512 Ga0451853_0724937 Ga0451853_0724937_47_304 83
51 3300041512 Ga0451853_2398176 Ga0451853_2398176_125_391 83
52 3300044706 Ga0466964_0085184 Ga0466964_0085184_412_669 83
53 3300045976 Ga0466967_1979102 Ga0466967_1979102_66_323 83
54 3300049539 Ga0501323_019456 Ga0501323_019456_562_834 83
55 3300049652 Ga0501202_061324 Ga0501202_061324_150_422 83
56 3300049670 Ga0501236_001209 Ga0501236_001209_966_1238 83
57 3300049761 Ga0501264_002656 Ga0501264_002656_473_745 83
58 3300050509 nmdc:mga0qj67_50936_c1 nmdc:mga0qj67_50936_c1_1316_1573 83
59 3300050510 nmdc:mga06r32_983902_c1 nmdc:mga06r32_983902_c1_354_611 83
60 3300050511 nmdc:mga08y16_22038_c1 nmdc:mga08y16_22038_c1_3834_4091 83
61 3300050511 nmdc:mga08y16_22108_c1 nmdc:mga08y16_22108_c1_2935_3192 83
62 3300053108 Ga0500562_086968 Ga0500562_086968_281_538 83
63 3300053133 Ga0500655_031304 Ga0500655_031304_538_795 83
64 3300053134 Ga0500658_0250366 Ga0500658_0250366_438_692 83
65 3300053151 Ga0500604_0001406 Ga0500604_0001406_5840_6112 83
66 3300053156 Ga0500622_0000012 Ga0500622_0000012_4506_4778 83
67 3300053156 Ga0500622_0000030 Ga0500622_0000030_4476_4733 83
68 3300053156 Ga0500622_0012337 Ga0500622_0012337_2548_2820 83
69 3300053158 Ga0500627_0066865 Ga0500627_0066865_16_273 83
70 3300003320 rootH2_10001223 rootH2_10001223122 84
71 3300005344 Ga0070661_100578755 Ga0070661_1005787552 84
72 3300005614 Ga0068856_100010896 Ga0068856_1000108962 84
73 3300006353 Ga0075370_10596015 Ga0075370_105960152 84
74 3300014326 Ga0157380_10000046 Ga0157380_1000004645 84
75 3300025250 Ga0209026_1000226 Ga0209026_100022632 84
76 3300025920 Ga0207649_11356511 Ga0207649_113565111 84
77 3300026078 Ga0207702_10029754 Ga0207702_100297547 84
78 3300031649 Ga0307514_10051268 Ga0307514_100512683 84
79 3300044712 Ga0453684_0748735 Ga0453684_0748735_225_479 84
80 3300046616 Ga0495668_0198463 Ga0495668_0198463_74_328 84
81 3300050496 nmdc:mga07m45_548033_c1 nmdc:mga07m45_548033_c1_228_482 84
82 2088090002 CNA_F7QKVOU01BIBUY CNA_00870220 85
83 2162886012 MBSR1b_contig_1436207 MBSR1b_0079.00005080 85
84 3300001979 JGI24740J21852_10080703 JGI24740J21852_100807032 85
85 3300001990 JGI24737J22298_10000148 JGI24737J22298_100001482 85
86 3300002067 JGI24735J21928_10000020 JGI24735J21928_1000002058 85
87 3300003320 rootH2_10340990 rootH2_103409902 85
88 3300003322 rootL2_10021639 rootL2_100216393 85
89 3300003323 rootH1_10027970 rootH1_100279703 85
90 3300005288 Ga0065714_10003718 Ga0065714_100037189 85
91 3300005288 Ga0065714_10076271 Ga0065714_100762713 85
92 3300005288 Ga0065714_10263545 Ga0065714_102635452 85
93 3300005288 Ga0065714_10400664 Ga0065714_104006642 85
94 3300005289 Ga0065704_10302631 Ga0065704_103026312 85
95 3300005295 Ga0065707_10255691 Ga0065707_102556912 85
96 3300005327 Ga0070658_10104568 Ga0070658_101045683 85
97 3300005327 Ga0070658_10367116 Ga0070658_103671162 85
98 3300005328 Ga0070676_10000231 Ga0070676_1000023117 85
99 3300005328 Ga0070676_10743144 Ga0070676_107431442 85
100 3300005334 Ga0068869_100002049 Ga0068869_1000020497 85
101 3300005334 Ga0068869_100157523 Ga0068869_1001575232 85
102 3300005334 Ga0068869_100366804 Ga0068869_1003668042 85
103 3300005334 Ga0068869_100557167 Ga0068869_1005571672 85
104 3300005334 Ga0068869_101151799 Ga0068869_1011517992 85
105 3300005335 Ga0070666_10000078 Ga0070666_1000007824 85
106 3300005335 Ga0070666_10980979 Ga0070666_109809792 85
107 3300005338 Ga0068868_100008072 Ga0068868_1000080724 85
108 3300005338 Ga0068868_100028945 Ga0068868_1000289455 85
109 3300005338 Ga0068868_100106199 Ga0068868_1001061993 85
110 3300005338 Ga0068868_100249591 Ga0068868_1002495912 85
111 3300005338 Ga0068868_100816863 Ga0068868_1008168631 85
112 3300005338 Ga0068868_101398951 Ga0068868_1013989512 85
113 3300005340 Ga0070689_100521400 Ga0070689_1005214002 85
114 3300005343 Ga0070687_100862824 Ga0070687_1008628242 85
115 3300005344 Ga0070661_101268405 Ga0070661_1012684052 85
116 3300005344 Ga0070661_101559674 Ga0070661_1015596741 85
117 3300005347 Ga0070668_100081121 Ga0070668_1000811212 85
118 3300005347 Ga0070668_100633423 Ga0070668_1006334232 85
119 3300005347 Ga0070668_101051238 Ga0070668_1010512382 85
120 3300005354 Ga0070675_100175229 Ga0070675_1001752291 85
121 3300005354 Ga0070675_100192214 Ga0070675_1001922142 85
122 3300005354 Ga0070675_101036663 Ga0070675_1010366631 85
123 3300005355 Ga0070671_100061553 Ga0070671_1000615535 85
124 3300005355 Ga0070671_100134878 Ga0070671_1001348782 85
125 3300005355 Ga0070671_100143560 Ga0070671_1001435602 85
126 3300005355 Ga0070671_100149624 Ga0070671_1001496242 85
127 3300005356 Ga0070674_100282843 Ga0070674_1002828432 85
128 3300005356 Ga0070674_101264134 Ga0070674_1012641341 85
129 3300005364 Ga0070673_100018285 Ga0070673_1000182854 85
130 3300005364 Ga0070673_100062741 Ga0070673_1000627412 85
131 3300005364 Ga0070673_100073158 Ga0070673_1000731583 85
132 3300005364 Ga0070673_100493944 Ga0070673_1004939442 85
133 3300005364 Ga0070673_102281815 Ga0070673_1022818152 85
134 3300005365 Ga0070688_100057899 Ga0070688_1000578994 85
135 3300005365 Ga0070688_101316324 Ga0070688_1013163241 85
136 3300005365 Ga0070688_101739910 Ga0070688_1017399102 85
137 3300005367 Ga0070667_100011803 Ga0070667_1000118032 85
138 3300005367 Ga0070667_100026421 Ga0070667_1000264213 85
139 3300005367 Ga0070667_100087311 Ga0070667_1000873111 85
140 3300005367 Ga0070667_100743791 Ga0070667_1007437912 85
141 3300005367 Ga0070667_100822763 Ga0070667_1008227632 85
142 3300005367 Ga0070667_101514261 Ga0070667_1015142611 85
143 3300005441 Ga0070700_100141012 Ga0070700_1001410122 85
144 3300005441 Ga0070700_100148338 Ga0070700_1001483382 85
145 3300005455 Ga0070663_100364896 Ga0070663_1003648962 85
146 3300005455 Ga0070663_100673765 Ga0070663_1006737652 85
147 3300005456 Ga0070678_100189429 Ga0070678_1001894293 85
148 3300005456 Ga0070678_100393105 Ga0070678_1003931052 85
149 3300005456 Ga0070678_100789775 Ga0070678_1007897752 85
150 3300005457 Ga0070662_100331851 Ga0070662_1003318512 85
151 3300005459 Ga0068867_100000586 Ga0068867_10000058619 85
152 3300005459 Ga0068867_100180724 Ga0068867_1001807243 85
153 3300005459 Ga0068867_100590481 Ga0068867_1005904812 85
154 3300005459 Ga0068867_101964633 Ga0068867_1019646331 85
155 3300005466 Ga0070685_10013986 Ga0070685_100139862 85
156 3300005466 Ga0070685_10800480 Ga0070685_108004801 85
157 3300005466 Ga0070685_10821806 Ga0070685_108218061 85
158 3300005466 Ga0070685_11113106 Ga0070685_111131061 85
159 3300005530 Ga0070679_100147590 Ga0070679_1001475902 85
160 3300005539 Ga0068853_100007787 Ga0068853_1000077879 85
161 3300005539 Ga0068853_100013770 Ga0068853_1000137709 85
162 3300005539 Ga0068853_100091439 Ga0068853_1000914394 85
163 3300005539 Ga0068853_100163124 Ga0068853_1001631243 85
164 3300005543 Ga0070672_100102064 Ga0070672_1001020642 85
165 3300005543 Ga0070672_100223214 Ga0070672_1002232142 85
166 3300005543 Ga0070672_100261544 Ga0070672_1002615442 85
167 3300005543 Ga0070672_100330760 Ga0070672_1003307601 85
168 3300005543 Ga0070672_100801359 Ga0070672_1008013592 85
169 3300005548 Ga0070665_101761329 Ga0070665_1017613291 85
170 3300005563 Ga0068855_100053370 Ga0068855_1000533703 85
171 3300005563 Ga0068855_100061731 Ga0068855_1000617313 85
172 3300005577 Ga0068857_100059756 Ga0068857_1000597562 85
173 3300005577 Ga0068857_101986428 Ga0068857_1019864281 85
174 3300005578 Ga0068854_100130757 Ga0068854_1001307572 85
175 3300005578 Ga0068854_100293820 Ga0068854_1002938202 85
176 3300005578 Ga0068854_100421874 Ga0068854_1004218742 85
177 3300005614 Ga0068856_100003542 Ga0068856_10000354219 85
178 3300005614 Ga0068856_101259362 Ga0068856_1012593622 85
179 3300005614 Ga0068856_101888544 Ga0068856_1018885442 85
180 3300005616 Ga0068852_100000614 Ga0068852_1000006149 85
181 3300005616 Ga0068852_100002267 Ga0068852_1000022674 85
182 3300005616 Ga0068852_100693104 Ga0068852_1006931042 85
183 3300005616 Ga0068852_101397974 Ga0068852_1013979741 85
184 3300005616 Ga0068852_102302514 Ga0068852_1023025141 85
185 3300005617 Ga0068859_100000003 Ga0068859_100000003260 85
186 3300005617 Ga0068859_100018877 Ga0068859_1000188771 85
187 3300005617 Ga0068859_100081374 Ga0068859_1000813743 85
188 3300005617 Ga0068859_100204161 Ga0068859_1002041612 85
189 3300005617 Ga0068859_100336376 Ga0068859_1003363763 85
190 3300005617 Ga0068859_101044336 Ga0068859_1010443362 85
191 3300005618 Ga0068864_100003917 Ga0068864_1000039174 85
192 3300005618 Ga0068864_100167138 Ga0068864_1001671382 85
193 3300005618 Ga0068864_100308683 Ga0068864_1003086832 85
194 3300005618 Ga0068864_101851077 Ga0068864_1018510772 85
195 3300005718 Ga0068866_10001781 Ga0068866_100017816 85
196 3300005718 Ga0068866_10173086 Ga0068866_101730861 85
197 3300005719 Ga0068861_101452453 Ga0068861_1014524532 85
198 3300005719 Ga0068861_102162576 Ga0068861_1021625762 85
199 3300005834 Ga0068851_10028995 Ga0068851_100289952 85
200 3300005834 Ga0068851_10082916 Ga0068851_100829162 85
201 3300005834 Ga0068851_10099533 Ga0068851_100995332 85
202 3300005834 Ga0068851_10578827 Ga0068851_105788272 85
203 3300005841 Ga0068863_100006890 Ga0068863_1000068908 85
204 3300005841 Ga0068863_100265284 Ga0068863_1002652842 85
205 3300005841 Ga0068863_100441702 Ga0068863_1004417022 85
206 3300005841 Ga0068863_101311389 Ga0068863_1013113892 85
207 3300005841 Ga0068863_101565280 Ga0068863_1015652802 85
208 3300005841 Ga0068863_102043464 Ga0068863_1020434642 85
209 3300005842 Ga0068858_100002816 Ga0068858_1000028162 85
210 3300005842 Ga0068858_101406486 Ga0068858_1014064862 85
211 3300005843 Ga0068860_100002009 Ga0068860_1000020099 85
212 3300005843 Ga0068860_100007756 Ga0068860_10000775611 85
213 3300005843 Ga0068860_100016973 Ga0068860_1000169735 85
214 3300005843 Ga0068860_100704279 Ga0068860_1007042791 85
215 3300005843 Ga0068860_101019895 Ga0068860_1010198952 85
216 3300005843 Ga0068860_102051766 Ga0068860_1020517662 85
217 3300005844 Ga0068862_100133101 Ga0068862_1001331012 85
218 3300005844 Ga0068862_101787858 Ga0068862_1017878581 85
219 3300006186 Ga0075369_10341444 Ga0075369_103414442 85
220 3300006195 Ga0075366_10000091 Ga0075366_1000009116 85
221 3300006195 Ga0075366_10000091 Ga0075366_1000009128 85
222 3300006195 Ga0075366_10092113 Ga0075366_100921132 85
223 3300006237 Ga0097621_100000777 Ga0097621_1000007776 85
224 3300006237 Ga0097621_100001974 Ga0097621_10000197418 85
225 3300006237 Ga0097621_100143444 Ga0097621_1001434442 85
226 3300006237 Ga0097621_100738492 Ga0097621_1007384922 85
227 3300006237 Ga0097621_100894428 Ga0097621_1008944282 85
228 3300006237 Ga0097621_101036554 Ga0097621_1010365541 85
229 3300006358 Ga0068871_100000154 Ga0068871_10000015421 85
230 3300006358 Ga0068871_100074646 Ga0068871_1000746465 85
231 3300006358 Ga0068871_100180249 Ga0068871_1001802492 85
232 3300006358 Ga0068871_101179246 Ga0068871_1011792462 85
233 3300006358 Ga0068871_101388425 Ga0068871_1013884251 85
234 3300006358 Ga0068871_101849478 Ga0068871_1018494782 85
235 3300006881 Ga0068865_100000172 Ga0068865_10000017220 85
236 3300006881 Ga0068865_100182295 Ga0068865_1001822952 85
237 3300006881 Ga0068865_100253168 Ga0068865_1002531682 85
238 3300006881 Ga0068865_101536913 Ga0068865_1015369132 85
239 3300006931 Ga0097620_100000003 Ga0097620_100000003260 85
240 3300006931 Ga0097620_100018877 Ga0097620_1000188771 85
241 3300006931 Ga0097620_100081377 Ga0097620_1000813773 85
242 3300006931 Ga0097620_100204160 Ga0097620_1002041602 85
243 3300006931 Ga0097620_100336379 Ga0097620_1003363793 85
244 3300006931 Ga0097620_101044479 Ga0097620_1010444792 85
245 3300009093 Ga0105240_11649717 Ga0105240_116497172 85
246 3300009093 Ga0105240_11863377 Ga0105240_118633772 85
247 3300009093 Ga0105240_12443212 Ga0105240_124432122 85
248 3300009094 Ga0111539_10342300 Ga0111539_103423002 85
249 3300009094 Ga0111539_11365601 Ga0111539_113656012 85
250 3300009098 Ga0105245_10504692 Ga0105245_105046922 85
251 3300009098 Ga0105245_10714983 Ga0105245_107149832 85
252 3300009101 Ga0105247_10001017 Ga0105247_1000101716 85
253 3300009101 Ga0105247_10402581 Ga0105247_104025812 85
254 3300009101 Ga0105247_10823230 Ga0105247_108232302 85
255 3300009148 Ga0105243_10207292 Ga0105243_102072922 85
256 3300009148 Ga0105243_10618732 Ga0105243_106187322 85
257 3300009148 Ga0105243_12410793 Ga0105243_124107931 85
258 3300009174 Ga0105241_10000847 Ga0105241_1000084727 85
259 3300009174 Ga0105241_10013980 Ga0105241_100139808 85
260 3300009174 Ga0105241_10374406 Ga0105241_103744062 85
261 3300009174 Ga0105241_12369509 Ga0105241_123695092 85
262 3300009176 Ga0105242_10020115 Ga0105242_100201154 85
263 3300009176 Ga0105242_10083586 Ga0105242_100835862 85
264 3300009176 Ga0105242_10104661 Ga0105242_101046613 85
265 3300009176 Ga0105242_10784764 Ga0105242_107847642 85
266 3300009176 Ga0105242_12137198 Ga0105242_121371981 85
267 3300009176 Ga0105242_12147183 Ga0105242_121471832 85
268 3300009177 Ga0105248_10497438 Ga0105248_104974382 85
269 3300009545 Ga0105237_10001395 Ga0105237_1000139533 85
270 3300009545 Ga0105237_10001455 Ga0105237_1000145524 85
271 3300009545 Ga0105237_10466611 Ga0105237_104666112 85
272 3300009545 Ga0105237_12399183 Ga0105237_123991831 85
273 3300009545 Ga0105237_12767060 Ga0105237_127670601 85
274 3300009551 Ga0105238_10596424 Ga0105238_105964242 85
275 3300009551 Ga0105238_11200254 Ga0105238_112002542 85
276 3300009551 Ga0105238_11568767 Ga0105238_115687672 85
277 3300009553 Ga0105249_10005639 Ga0105249_100056398 85
278 3300009553 Ga0105249_10687441 Ga0105249_106874412 85
279 3300009553 Ga0105249_12597274 Ga0105249_125972741 85
280 3300009553 Ga0105249_12642204 Ga0105249_126422041 85
281 3300010375 Ga0105239_10054410 Ga0105239_100544102 85
282 3300010375 Ga0105239_10064333 Ga0105239_100643332 85
283 3300010375 Ga0105239_10160641 Ga0105239_101606413 85
284 3300010375 Ga0105239_10176462 Ga0105239_101764624 85
285 3300010375 Ga0105239_10513044 Ga0105239_105130442 85
286 3300011119 Ga0105246_10087476 Ga0105246_100874763 85
287 3300011119 Ga0105246_10291745 Ga0105246_102917452 85
288 3300013102 Ga0157371_10042159 Ga0157371_100421593 85
289 3300013104 Ga0157370_10231082 Ga0157370_102310822 85
290 3300013104 Ga0157370_10399185 Ga0157370_103991852 85
291 3300013104 Ga0157370_10914332 Ga0157370_109143322 85
292 3300013104 Ga0157370_11278688 Ga0157370_112786882 85
293 3300013105 Ga0157369_10185088 Ga0157369_101850882 85
294 3300013296 Ga0157374_10000849 Ga0157374_1000084917 85
295 3300013296 Ga0157374_10131243 Ga0157374_101312432 85
296 3300013296 Ga0157374_10211921 Ga0157374_102119212 85
297 3300013296 Ga0157374_10294586 Ga0157374_102945862 85
298 3300013296 Ga0157374_10388546 Ga0157374_103885462 85
299 3300013296 Ga0157374_11134958 Ga0157374_111349581 85
300 3300013296 Ga0157374_11256376 Ga0157374_112563762 85
301 3300013297 Ga0157378_10007598 Ga0157378_100075982 85
302 3300013297 Ga0157378_10038908 Ga0157378_100389082 85
303 3300013297 Ga0157378_10080319 Ga0157378_100803191 85
304 3300013297 Ga0157378_10158378 Ga0157378_101583782 85
305 3300013297 Ga0157378_10617202 Ga0157378_106172022 85
306 3300013297 Ga0157378_11732384 Ga0157378_117323841 85
307 3300013297 Ga0157378_13032038 Ga0157378_130320381 85
308 3300013306 Ga0163162_10000361 Ga0163162_100003612 85
309 3300013306 Ga0163162_10000568 Ga0163162_100005684 85
310 3300013306 Ga0163162_10061419 Ga0163162_100614192 85
311 3300013306 Ga0163162_10065676 Ga0163162_100656762 85
312 3300013306 Ga0163162_10172866 Ga0163162_101728663 85
313 3300013306 Ga0163162_10456307 Ga0163162_104563072 85
314 3300013306 Ga0163162_10593971 Ga0163162_105939712 85
315 3300013306 Ga0163162_10775708 Ga0163162_107757082 85
316 3300013306 Ga0163162_11239030 Ga0163162_112390302 85
317 3300013306 Ga0163162_11905804 Ga0163162_119058041 85
318 3300013307 Ga0157372_10001279 Ga0157372_100012793 85
319 3300013307 Ga0157372_10027329 Ga0157372_100273298 85
320 3300013307 Ga0157372_11032845 Ga0157372_110328452 85
321 3300013308 Ga0157375_10003003 Ga0157375_1000300312 85
322 3300013308 Ga0157375_10239294 Ga0157375_102392941 85
323 3300013308 Ga0157375_10309110 Ga0157375_103091103 85
324 3300013308 Ga0157375_10364905 Ga0157375_103649052 85
325 3300013308 Ga0157375_11184975 Ga0157375_111849752 85
326 3300013308 Ga0157375_11283565 Ga0157375_112835652 85
327 3300013308 Ga0157375_13342079 Ga0157375_133420791 85
328 3300014325 Ga0163163_10086565 Ga0163163_100865651 85
329 3300014325 Ga0163163_10098735 Ga0163163_100987352 85
330 3300014325 Ga0163163_10623390 Ga0163163_106233902 85
331 3300014325 Ga0163163_11095282 Ga0163163_110952822 85
332 3300014325 Ga0163163_12098616 Ga0163163_120986161 85
333 3300014325 Ga0163163_12139922 Ga0163163_121399222 85
334 3300014326 Ga0157380_10009471 Ga0157380_100094716 85
335 3300014326 Ga0157380_10591603 Ga0157380_105916032 85
336 3300014326 Ga0157380_10794307 Ga0157380_107943072 85
337 3300014326 Ga0157380_12417229 Ga0157380_124172292 85
338 3300014326 Ga0157380_13310532 Ga0157380_133105322 85
339 3300014745 Ga0157377_10540315 Ga0157377_105403151 85
340 3300014745 Ga0157377_10561183 Ga0157377_105611832 85
341 3300014745 Ga0157377_10759002 Ga0157377_107590021 85
342 3300014968 Ga0157379_10123204 Ga0157379_101232042 85
343 3300014968 Ga0157379_10245139 Ga0157379_102451392 85
344 3300014968 Ga0157379_11535403 Ga0157379_115354031 85
345 3300014968 Ga0157379_12131652 Ga0157379_121316522 85
346 3300014969 Ga0157376_10082731 Ga0157376_100827313 85
347 3300014969 Ga0157376_10319822 Ga0157376_103198223 85
348 3300014969 Ga0157376_11329550 Ga0157376_113295502 85
349 3300014969 Ga0157376_12037201 Ga0157376_120372012 85
350 3300017792 Ga0163161_10222185 Ga0163161_102221852 85
351 3300017792 Ga0163161_11763991 Ga0163161_117639912 85
352 3300020077 Ga0206351_10503684 Ga0206351_105036842 85
353 3300025242 Ga0209258_128797 Ga0209258_1287972 85
354 3300025321 Ga0207656_10018556 Ga0207656_100185562 85
355 3300025321 Ga0207656_10018811 Ga0207656_100188112 85
356 3300025321 Ga0207656_10400381 Ga0207656_104003811 85
357 3300025321 Ga0207656_10593079 Ga0207656_105930792 85
358 3300025893 Ga0207682_10191800 Ga0207682_101918001 85
359 3300025893 Ga0207682_10205562 Ga0207682_102055622 85
360 3300025893 Ga0207682_10541329 Ga0207682_105413291 85
361 3300025899 Ga0207642_10254681 Ga0207642_102546812 85
362 3300025900 Ga0207710_10021990 Ga0207710_100219903 85
363 3300025900 Ga0207710_10222228 Ga0207710_102222282 85
364 3300025901 Ga0207688_10815651 Ga0207688_108156512 85
365 3300025903 Ga0207680_10000102 Ga0207680_1000010242 85
366 3300025903 Ga0207680_11196778 Ga0207680_111967782 85
367 3300025904 Ga0207647_10028556 Ga0207647_100285562 85
368 3300025904 Ga0207647_10247553 Ga0207647_102475531 85
369 3300025904 Ga0207647_10430505 Ga0207647_104305052 85
370 3300025907 Ga0207645_10000146 Ga0207645_1000014627 85
371 3300025907 Ga0207645_10627096 Ga0207645_106270962 85
372 3300025907 Ga0207645_10672470 Ga0207645_106724702 85
373 3300025909 Ga0207705_10373636 Ga0207705_103736362 85
374 3300025911 Ga0207654_10010768 Ga0207654_100107685 85
375 3300025911 Ga0207654_10023238 Ga0207654_100232382 85
376 3300025911 Ga0207654_10968169 Ga0207654_109681691 85
377 3300025913 Ga0207695_11317652 Ga0207695_113176522 85
378 3300025914 Ga0207671_10007457 Ga0207671_100074575 85
379 3300025914 Ga0207671_10194657 Ga0207671_101946572 85
380 3300025920 Ga0207649_11069273 Ga0207649_110692732 85
381 3300025920 Ga0207649_11118181 Ga0207649_111181812 85
382 3300025921 Ga0207652_11064618 Ga0207652_110646182 85
383 3300025923 Ga0207681_10505150 Ga0207681_105051502 85
384 3300025923 Ga0207681_10658458 Ga0207681_106584582 85
385 3300025924 Ga0207694_10009457 Ga0207694_100094572 85
386 3300025925 Ga0207650_10036252 Ga0207650_100362523 85
387 3300025925 Ga0207650_10087490 Ga0207650_100874902 85
388 3300025925 Ga0207650_10292844 Ga0207650_102928442 85
389 3300025925 Ga0207650_11394195 Ga0207650_113941952 85
390 3300025925 Ga0207650_11538583 Ga0207650_115385831 85
391 3300025926 Ga0207659_10107535 Ga0207659_101075354 85
392 3300025926 Ga0207659_10820061 Ga0207659_108200612 85
393 3300025927 Ga0207687_10534911 Ga0207687_105349112 85
394 3300025927 Ga0207687_10919561 Ga0207687_109195611 85
395 3300025931 Ga0207644_10021819 Ga0207644_100218196 85
396 3300025931 Ga0207644_10043479 Ga0207644_100434794 85
397 3300025931 Ga0207644_10086484 Ga0207644_100864843 85
398 3300025933 Ga0207706_10226838 Ga0207706_102268383 85
399 3300025934 Ga0207686_10097460 Ga0207686_100974602 85
400 3300025934 Ga0207686_10188577 Ga0207686_101885772 85
401 3300025934 Ga0207686_10329227 Ga0207686_103292272 85
402 3300025935 Ga0207709_10218997 Ga0207709_102189972 85
403 3300025937 Ga0207669_11463752 Ga0207669_114637522 85
404 3300025938 Ga0207704_10000205 Ga0207704_1000020510 85
405 3300025938 Ga0207704_10131108 Ga0207704_101311082 85
406 3300025938 Ga0207704_11356321 Ga0207704_113563211 85
407 3300025940 Ga0207691_10120725 Ga0207691_101207253 85
408 3300025940 Ga0207691_10128331 Ga0207691_101283313 85
409 3300025940 Ga0207691_10178850 Ga0207691_101788502 85
410 3300025940 Ga0207691_10286780 Ga0207691_102867802 85
411 3300025942 Ga0207689_10003994 Ga0207689_1000399413 85
412 3300025942 Ga0207689_10205674 Ga0207689_102056742 85
413 3300025945 Ga0207679_10738451 Ga0207679_107384512 85
414 3300025945 Ga0207679_11225023 Ga0207679_112250232 85
415 3300025949 Ga0207667_10070023 Ga0207667_100700232 85
416 3300025949 Ga0207667_10438577 Ga0207667_104385772 85
417 3300025949 Ga0207667_11250387 Ga0207667_112503872 85
418 3300025960 Ga0207651_10042253 Ga0207651_100422533 85
419 3300025960 Ga0207651_10214971 Ga0207651_102149713 85
420 3300025960 Ga0207651_10663007 Ga0207651_106630072 85
421 3300025960 Ga0207651_12028967 Ga0207651_120289672 85
422 3300025961 Ga0207712_10001952 Ga0207712_100019524 85
423 3300025961 Ga0207712_10101960 Ga0207712_101019604 85
424 3300025961 Ga0207712_10247582 Ga0207712_102475821 85
425 3300025961 Ga0207712_11651169 Ga0207712_116511691 85
426 3300025972 Ga0207668_10147319 Ga0207668_101473192 85
427 3300025972 Ga0207668_10252846 Ga0207668_102528462 85
428 3300025972 Ga0207668_11459364 Ga0207668_114593642 85
429 3300025981 Ga0207640_10264593 Ga0207640_102645932 85
430 3300025986 Ga0207658_10024854 Ga0207658_100248544 85
431 3300025986 Ga0207658_10059050 Ga0207658_100590504 85
432 3300025986 Ga0207658_10075189 Ga0207658_100751892 85
433 3300025986 Ga0207658_10473783 Ga0207658_104737832 85
434 3300025986 Ga0207658_11194764 Ga0207658_111947642 85
435 3300026023 Ga0207677_10002126 Ga0207677_100021266 85
436 3300026023 Ga0207677_10043214 Ga0207677_100432143 85
437 3300026023 Ga0207677_10192782 Ga0207677_101927821 85
438 3300026023 Ga0207677_11224845 Ga0207677_112248451 85
439 3300026035 Ga0207703_10004081 Ga0207703_1000408112 85
440 3300026035 Ga0207703_11324738 Ga0207703_113247381 85
441 3300026035 Ga0207703_12169099 Ga0207703_121690991 85
442 3300026041 Ga0207639_10009956 Ga0207639_100099562 85
443 3300026041 Ga0207639_10034913 Ga0207639_100349133 85
444 3300026041 Ga0207639_10064192 Ga0207639_100641922 85
445 3300026041 Ga0207639_10152291 Ga0207639_101522913 85
446 3300026041 Ga0207639_10207681 Ga0207639_102076812 85
447 3300026041 Ga0207639_11126736 Ga0207639_111267361 85
448 3300026067 Ga0207678_10747799 Ga0207678_107477992 85
449 3300026075 Ga0207708_10153497 Ga0207708_101534972 85
450 3300026078 Ga0207702_10024888 Ga0207702_100248887 85
451 3300026088 Ga0207641_10000015 Ga0207641_10000015262 85
452 3300026088 Ga0207641_10012810 Ga0207641_100128104 85
453 3300026088 Ga0207641_10801050 Ga0207641_108010502 85
454 3300026088 Ga0207641_11301333 Ga0207641_113013332 85
455 3300026089 Ga0207648_10000747 Ga0207648_1000074727 85
456 3300026089 Ga0207648_10047974 Ga0207648_100479744 85
457 3300026089 Ga0207648_10223369 Ga0207648_102233692 85
458 3300026089 Ga0207648_11614730 Ga0207648_116147302 85
459 3300026089 Ga0207648_12066969 Ga0207648_120669692 85
460 3300026095 Ga0207676_10002059 Ga0207676_100020595 85
461 3300026095 Ga0207676_10262176 Ga0207676_102621763 85
462 3300026095 Ga0207676_10842640 Ga0207676_108426402 85
463 3300026095 Ga0207676_10963491 Ga0207676_109634911 85
464 3300026095 Ga0207676_11342469 Ga0207676_113424692 85
465 3300026116 Ga0207674_10314308 Ga0207674_103143082 85
466 3300026116 Ga0207674_10913472 Ga0207674_109134722 85
467 3300026118 Ga0207675_100731756 Ga0207675_1007317562 85
468 3300026121 Ga0207683_10006913 Ga0207683_100069136 85
469 3300026121 Ga0207683_10168572 Ga0207683_101685722 85
470 3300026121 Ga0207683_10211041 Ga0207683_102110412 85
471 3300026121 Ga0207683_10967059 Ga0207683_109670591 85
472 3300026142 Ga0207698_10003892 Ga0207698_100038927 85
473 3300026142 Ga0207698_10021755 Ga0207698_100217553 85
474 3300026142 Ga0207698_10895928 Ga0207698_108959282 85
475 3300026142 Ga0207698_11523284 Ga0207698_115232842 85
476 3300026142 Ga0207698_11840514 Ga0207698_118405141 85
477 3300028380 Ga0268265_10475192 Ga0268265_104751922 85
478 3300028380 Ga0268265_10504424 Ga0268265_105044242 85
479 3300028380 Ga0268265_12062726 Ga0268265_120627262 85
480 3300028381 Ga0268264_10001199 Ga0268264_100011997 85
481 3300028381 Ga0268264_10002153 Ga0268264_100021532 85
482 3300028381 Ga0268264_10003263 Ga0268264_1000326312 85
483 3300028381 Ga0268264_11297099 Ga0268264_112970992 85
484 3300028794 Ga0307515_10000001 Ga0307515_100000012369 85
485 3300028794 Ga0307515_10000031 Ga0307515_10000031137 85
486 3300028794 Ga0307515_10000667 Ga0307515_1000066718 85
487 3300028794 Ga0307515_10000790 Ga0307515_1000079043 85
488 3300028794 Ga0307515_10000790 Ga0307515_1000079056 85
489 3300031456 Ga0307513_10356067 Ga0307513_103560672 85
490 3300031507 Ga0307509_10278917 Ga0307509_102789172 85
491 3300031649 Ga0307514_10415306 Ga0307514_104153061 85
492 3300031911 Ga0307412_11616238 Ga0307412_116162382 85
493 3300032004 Ga0307414_10141912 Ga0307414_101419122 85
494 3300033179 Ga0307507_10000144 Ga0307507_1000014460 85
495 3300033179 Ga0307507_10000144 Ga0307507_1000014472 85
496 3300035116 Ga0373945_0533537 Ga0373945_0533537_226_483 85
497 3300037312 Ga0395899_0037668 Ga0395899_0037668_3288_3545 85
498 3300037418 Ga0395900_0027720 Ga0395900_0027720_3685_3942 85
499 3300037466 Ga0395898_0827926 Ga0395898_0827926_533_790 85
500 3300037471 Ga0395905_0000003 Ga0395905_0000003_546701_546958 85
501 3300037471 Ga0395905_0000049 Ga0395905_0000049_104144_104407 85
502 3300037471 Ga0395905_0001249 Ga0395905_0001249_30206_30463 85
503 3300038443 Ga0395901_0003386 Ga0395901_0003386_7625_7882 85
504 3300041443 Ga0451789_0303625 Ga0451789_0303625_1077_1334 85
505 3300041451 Ga0451791_0797082 Ga0451791_0797082_123_380 85
506 3300041452 Ga0451793_0259997 Ga0451793_0259997_558_815 85
507 3300041452 Ga0451793_0929927 Ga0451793_0929927_351_608 85
508 3300041460 Ga0451802_0652972 Ga0451802_0652972_99_356 85
509 3300041505 Ga0451849_0096302 Ga0451849_0096302_203_460 85
510 3300041505 Ga0451849_1063937 Ga0451849_1063937_37_294 85
511 3300041507 Ga0451851_0284543 Ga0451851_0284543_290_547 85
512 3300041512 Ga0451853_0791209 Ga0451853_0791209_104_361 85
513 3300041512 Ga0451853_1889411 Ga0451853_1889411_72_329 85
514 3300044684 Ga0466966_0066002 Ga0466966_0066002_1761_2018 85
515 3300046454 Ga0495592_0478108 Ga0495592_0478108_26_283 85
516 3300046454 Ga0495592_0775841 Ga0495592_0775841_287_544 85
517 3300046459 Ga0495629_0121363 Ga0495629_0121363_170_427 85
518 3300046459 Ga0495629_0879716 Ga0495629_0879716_186_443 85
519 3300046460 Ga0495638_0247841 Ga0495638_0247841_706_963 85
520 3300046462 Ga0495651_0180197 Ga0495651_0180197_534_791 85
521 3300046462 Ga0495651_0759170 Ga0495651_0759170_245_502 85
522 3300046471 Ga0495650_0000095 Ga0495650_0000095_23176_23433 85
523 3300046492 Ga0495585_0000057 Ga0495585_0000057_36385_36642 85
524 3300046492 Ga0495585_0002733 Ga0495585_0002733_2806_3063 85
525 3300046492 Ga0495585_0011600 Ga0495585_0011600_77_334 85
526 3300046506 Ga0495583_0005597 Ga0495583_0005597_5775_6032 85
527 3300046506 Ga0495583_0381052 Ga0495583_0381052_91_348 85
528 3300046507 Ga0495606_0000009 Ga0495606_0000009_237590_237847 85
529 3300046507 Ga0495606_0191418 Ga0495606_0191418_380_637 85
530 3300046511 Ga0495608_0076564 Ga0495608_0076564_1110_1367 85
531 3300046512 Ga0495610_0000867 Ga0495610_0000867_23736_23993 85
532 3300046512 Ga0495610_0260541 Ga0495610_0260541_41_298 85
533 3300046512 Ga0495610_0306604 Ga0495610_0306604_300_557 85
534 3300046513 Ga0495616_0000733 Ga0495616_0000733_301_558 85
535 3300046514 Ga0495618_0670649 Ga0495618_0670649_259_516 85
536 3300046516 Ga0495628_0076588 Ga0495628_0076588_2025_2282 85
537 3300046516 Ga0495628_1161392 Ga0495628_1161392_66_323 85
538 3300046518 Ga0495631_0120747 Ga0495631_0120747_246_503 85
539 3300046518 Ga0495631_0120947 Ga0495631_0120947_851_1108 85
540 3300046520 Ga0495637_0117271 Ga0495637_0117271_736_993 85
541 3300046520 Ga0495637_0135435 Ga0495637_0135435_221_478 85
542 3300046524 Ga0495648_0003800 Ga0495648_0003800_7849_8106 85
543 3300046524 Ga0495648_0036248 Ga0495648_0036248_651_908 85
544 3300046524 Ga0495648_0057079 Ga0495648_0057079_1932_2189 85
545 3300046525 Ga0495663_0196072 Ga0495663_0196072_347_604 85
546 3300046529 Ga0495652_0304302 Ga0495652_0304302_399_656 85
547 3300046529 Ga0495652_0368867 Ga0495652_0368867_385_642 85
548 3300046530 Ga0495654_0078110 Ga0495654_0078110_219_476 85
549 3300046530 Ga0495654_0242893 Ga0495654_0242893_298_555 85
550 3300046537 Ga0495598_0178109 Ga0495598_0178109_189_449 85
551 3300046538 Ga0495609_0015217 Ga0495609_0015217_1530_1787 85
552 3300046538 Ga0495609_0018877 Ga0495609_0018877_731_988 85
553 3300046538 Ga0495609_0037794 Ga0495609_0037794_72_329 85
554 3300046539 Ga0495621_0063398 Ga0495621_0063398_381_638 85
555 3300046557 Ga0495622_0008647 Ga0495622_0008647_1449_1706 85
556 3300046557 Ga0495622_0037148 Ga0495622_0037148_1810_2067 85
557 3300046557 Ga0495622_0220672 Ga0495622_0220672_139_396 85
558 3300046558 Ga0495633_0000275 Ga0495633_0000275_42925_43182 85
559 3300046558 Ga0495633_0000275 Ga0495633_0000275_52347_52604 85
560 3300046558 Ga0495633_0003968 Ga0495633_0003968_9002_9259 85
561 3300046616 Ga0495668_0000017 Ga0495668_0000017_247933_248190 85
562 3300046616 Ga0495668_0000017 Ga0495668_0000017_257172_257429 85
563 3300046660 Ga0495625_0000007 Ga0495625_0000007_107634_107891 85
564 3300046660 Ga0495625_0000435 Ga0495625_0000435_29659_29916 85
565 3300046660 Ga0495625_0000435 Ga0495625_0000435_39232_39489 85
566 3300046660 Ga0495625_0001213 Ga0495625_0001213_17391_17648 85
567 3300046660 Ga0495625_0001213 Ga0495625_0001213_7998_8255 85
568 3300046660 Ga0495625_0040215 Ga0495625_0040215_2492_2749 85
569 3300046665 Ga0495661_0000576 Ga0495661_0000576_26285_26542 85
570 3300046674 Ga0495588_0102322 Ga0495588_0102322_225_482 85
571 3300046683 Ga0495658_0025386 Ga0495658_0025386_2113_2370 85
572 3300046683 Ga0495658_0044823 Ga0495658_0044823_245_502 85
573 3300046691 Ga0495670_0151582 Ga0495670_0151582_827_1084 85
574 3300046691 Ga0495670_0844602 Ga0495670_0844602_141_398 85
575 3300046692 Ga0495671_0027550 Ga0495671_0027550_2533_2790 85
576 3300046694 Ga0495649_0000007 Ga0495649_0000007_327527_327784 85
577 3300046809 Ga0495600_0219554 Ga0495600_0219554_248_505 85
578 3300046809 Ga0495600_0686852 Ga0495600_0686852_91_348 85
579 3300046810 Ga0495660_0020251 Ga0495660_0020251_2079_2336 85
580 3300046810 Ga0495660_0102272 Ga0495660_0102272_425_682 85
581 3300047318 Ga0495636_0120574 Ga0495636_0120574_418_675 85
582 3300047320 Ga0495672_0037564 Ga0495672_0037564_728_985 85
583 3300047321 Ga0495676_0441869 Ga0495676_0441869_567_824 85
584 3300047323 Ga0495683_0082685 Ga0495683_0082685_487_744 85
585 3300047443 Ga0495687_000440 Ga0495687_000440_2583_2840 85
586 3300047443 Ga0495687_036112 Ga0495687_036112_227_484 85
587 3300047445 Ga0495677_0447931 Ga0495677_0447931_26_283 85
588 3300047446 Ga0495679_160294 Ga0495679_160294_48_305 85
589 3300047469 Ga0495673_0029094 Ga0495673_0029094_318_575 85
590 3300047472 Ga0495686_0031274 Ga0495686_0031274_1509_1766 85
591 3300047472 Ga0495686_0619986 Ga0495686_0619986_220_477 85
592 3300048088 Ga0495602_0879454 Ga0495602_0879454_189_446 85
593 3300048089 Ga0495614_0019267 Ga0495614_0019267_26_283 85
594 3300048091 Ga0495626_0117421 Ga0495626_0117421_555_812 85
595 3300048913 Ga0496110_1333775 Ga0496110_1333775_45_302 85
596 3300049460 Ga0495682_0052571 Ga0495682_0052571_524_781 85
597 3300049538 Ga0501322_012301 Ga0501322_012301_260_517 85
598 3300049569 Ga0501032_0107271 Ga0501032_0107271_1285_1545 85
599 3300049571 Ga0501034_0000002 Ga0501034_0000002_173570_173827 85
600 3300049572 Ga0501036_0564675 Ga0501036_0564675_210_470 85
601 3300049573 Ga0501037_0424039 Ga0501037_0424039_222_482 85
602 3300049581 Ga0501047_0430720 Ga0501047_0430720_62_322 85
603 3300050493 nmdc:mga0k408_490_c1 nmdc:mga0k408_490_c1_8643_8900 85
604 3300050493 nmdc:mga0k408_5994_c1 nmdc:mga0k408_5994_c1_577_834 85
605 3300050493 nmdc:mga0k408_656162_c1 nmdc:mga0k408_656162_c1_164_421 85
606 3300050511 nmdc:mga08y16_284540_c1 nmdc:mga08y16_284540_c1_999_1256 85
607 3300050516 nmdc:mga0sz30_160790_c1 nmdc:mga0sz30_160790_c1_200_457 85
608 3300053090 Ga0500646_0143247 Ga0500646_0143247_417_674 85
609 3300053090 Ga0500646_0289881 Ga0500646_0289881_193_450 85
610 3300053090 Ga0500646_0292639 Ga0500646_0292639_202_459 85
611 3300053118 Ga0500594_0210115 Ga0500594_0210115_270_527 85
612 3300053125 Ga0500618_000033 Ga0500618_000033_100531_100788 85
613 3300053125 Ga0500618_000033 Ga0500618_000033_85511_85768 85
614 3300053125 Ga0500618_033636 Ga0500618_033636_434_691 85
615 3300053137 Ga0500561_0168618 Ga0500561_0168618_408_665 85
616 3300053161 Ga0500634_0124452 Ga0500634_0124452_893_1150 85
617 3300053723 Ga0500567_259717 Ga0500567_259717_24_281 85
618 3300055283 Ga0500661_003220 Ga0500661_003220_1154_1411 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

28

95

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f80-assembly1.cif.gz_F holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.8765 5 75
8odw-assembly1.cif.gz_A crystal structure of lbma ox-acp didomain in complex with nadp and ethyl glycinate from the lobatamide pks (gynuella sunshinyii) 0.8749 3 85
1f80-assembly1.cif.gz_D holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.8677 4 75
2fac-assembly1.cif.gz_A crystal structure of e. coli hexanoyl-acp 0.8631 6 77
8jfh-assembly1.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery 0.8618 4 77
ID Description Score Start End Superfamily
af_Q9VIC9_329_406_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9051 3 81 1.10.1200.10
af_P9WQF1_4_84_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8855 2 81 1.10.1200.10
1f80F00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8765 5 75 1.10.1200.10
af_G5ECV9_328_405_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8764 3 76 1.10.1200.10
1f80D00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8677 4 75 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A4R8DVQ6-F1-model_v4 Acyl carrier protein (ACP) 0.9917 3 79 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-A0A3D3CVK0-F1-model_v4 Acyl carrier protein 0.9864 1 80
AF-A0A512RL56-F1-model_v4 Acyl carrier protein (ACP) 0.9769 1 85 GO:0000036
GO:0005737
AF-A0A1T5P029-F1-model_v4 Acyl carrier protein 0.9767 1 85 GO:0000035
GO:0000036
AF-A0A3D2HNG3-F1-model_v4 deleted 0.9764 1 82

Feature Viewer

pLDDT pTM Quality
88.72 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map