F469736
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 618 | 256 | 612 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300025907|Ga0207645_10672470|Ga0207645_106724702 |
| Length | 105 |
| Sequence | LDLEELTHLSSLEKCSHKPLMENKEIIEKIHSFLVEEFEVEPEKIVPEANLKETLGLDSLDYIDLVVVIESNFAFKVKPEDFTDIATFQDFCDYVISRVNSKELV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090002 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 146 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 149 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 156 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 157 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 164 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 165 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 174 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 178 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 236 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 238 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 239 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 244 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 245 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 246 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 247 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 248 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 249 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 250 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 251 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 252 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 253 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 255 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 256 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0.49 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.18 |
| Nodule | 0 |
| Rhizoplane | 2.1 |
| Rhizosphere | 86.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNA_F7QKVOU01BIBUY | 2088090002 | Bacteria | 507 |
| 2 | MBSR1b_contig_1436207 | 2162886012 | Bacteria | 1379 |
| 3 | JGI24740J21852_10080703 | 3300001979 | Bacteria | 853 |
| 4 | JGI24737J22298_10000148 | 3300001990 | Bacteria | 21941 |
| 5 | JGI24735J21928_10000020 | 3300002067 | Bacteria | 108706 |
| 6 | rootH1_10000337 | 3300003316 | Bacteria | 26455 |
| 7 | rootH1_10000337 | 3300003323 | Bacteria | 8315 |
| 8 | rootH1_10021873 | 3300003316 | Bacteria | 26221 |
| 9 | rootH2_10001223 | 3300003320 | Bacteria | 131149 |
| 10 | rootH2_10003246 | 3300003320 | Bacteria | 168239 |
| 11 | rootH2_10340990 | 3300003320 | Bacteria | 1547 |
| 12 | rootL2_10021639 | 3300003322 | Bacteria | 6506 |
| 13 | rootL2_10023564 | 3300003322 | Bacteria | 9230 |
| 14 | rootL2_10033367 | 3300003322 | Bacteria | 8550 |
| 15 | rootH1_10002599 | 3300003316 | Bacteria | 7117 |
| 16 | rootH1_10002599 | 3300003323 | Bacteria | 52591 |
| 17 | rootH1_10027970 | 3300003323 | Bacteria | 2715 |
| 18 | rootH1_10029269 | 3300003323 | Bacteria | 5270 |
| 19 | rootH1_10052813 | 3300003323 | Bacteria | 3790 |
| 20 | rootH1_10100022 | 3300003323 | Bacteria | 1243 |
| 21 | Ga0065165_1007023 | 3300005262 | Bacteria | 5676 |
| 22 | Ga0065714_10003718 | 3300005288 | Bacteria | 9007 |
| 23 | Ga0065714_10076271 | 3300005288 | Bacteria | 2811 |
| 24 | Ga0065714_10263545 | 3300005288 | Bacteria | 752 |
| 25 | Ga0065714_10400664 | 3300005288 | Bacteria | 584 |
| 26 | Ga0065704_10302631 | 3300005289 | Bacteria | 882 |
| 27 | Ga0065707_10255691 | 3300005295 | Bacteria | 1112 |
| 28 | Ga0070658_10104568 | 3300005327 | Bacteria | 2342 |
| 29 | Ga0070658_10367116 | 3300005327 | Bacteria | 1234 |
| 30 | Ga0070676_10000231 | 3300005328 | Bacteria | 23863 |
| 31 | Ga0070676_10743144 | 3300005328 | Unclassified | 720 |
| 32 | Ga0068869_100002049 | 3300005334 | Bacteria | 12106 |
| 33 | Ga0068869_100157523 | 3300005334 | Bacteria | 1766 |
| 34 | Ga0068869_100366804 | 3300005334 | Bacteria | 1177 |
| 35 | Ga0068869_100557167 | 3300005334 | Bacteria | 964 |
| 36 | Ga0068869_101151799 | 3300005334 | Bacteria | 680 |
| 37 | Ga0070666_10000078 | 3300005335 | Bacteria | 69922 |
| 38 | Ga0070666_10980979 | 3300005335 | Unclassified | 626 |
| 39 | Ga0068868_100008072 | 3300005338 | Bacteria | 7529 |
| 40 | Ga0068868_100028945 | 3300005338 | Bacteria | 4240 |
| 41 | Ga0068868_100106199 | 3300005338 | Bacteria | 2277 |
| 42 | Ga0068868_100249591 | 3300005338 | Bacteria | 1493 |
| 43 | Ga0068868_100816863 | 3300005338 | Bacteria | 842 |
| 44 | Ga0068868_101398951 | 3300005338 | Unclassified | 652 |
| 45 | Ga0070689_100521400 | 3300005340 | Bacteria | 1020 |
| 46 | Ga0070687_100862824 | 3300005343 | Bacteria | 646 |
| 47 | Ga0070661_100578755 | 3300005344 | Bacteria | 906 |
| 48 | Ga0070661_101268405 | 3300005344 | Bacteria | 617 |
| 49 | Ga0070661_101559674 | 3300005344 | Bacteria | 558 |
| 50 | Ga0070668_100081121 | 3300005347 | Bacteria | 2543 |
| 51 | Ga0070668_100633423 | 3300005347 | Bacteria | 938 |
| 52 | Ga0070668_101051238 | 3300005347 | Bacteria | 733 |
| 53 | Ga0070675_100175229 | 3300005354 | Bacteria | 1852 |
| 54 | Ga0070675_100192214 | 3300005354 | Bacteria | 1769 |
| 55 | Ga0070675_101036663 | 3300005354 | Bacteria | 754 |
| 56 | Ga0070671_100061553 | 3300005355 | Bacteria | 3126 |
| 57 | Ga0070671_100134878 | 3300005355 | Bacteria | 2081 |
| 58 | Ga0070671_100143560 | 3300005355 | Bacteria | 2015 |
| 59 | Ga0070671_100149624 | 3300005355 | Bacteria | 1971 |
| 60 | Ga0070674_100282843 | 3300005356 | Bacteria | 1315 |
| 61 | Ga0070674_101264134 | 3300005356 | Bacteria | 657 |
| 62 | Ga0070673_100018285 | 3300005364 | Bacteria | 5002 |
| 63 | Ga0070673_100062741 | 3300005364 | Bacteria | 2954 |
| 64 | Ga0070673_100073158 | 3300005364 | Bacteria | 2758 |
| 65 | Ga0070673_100493944 | 3300005364 | Bacteria | 1106 |
| 66 | Ga0070673_102281815 | 3300005364 | Bacteria | 514 |
| 67 | Ga0070688_100057899 | 3300005365 | Bacteria | 2438 |
| 68 | Ga0070688_101316324 | 3300005365 | Bacteria | 583 |
| 69 | Ga0070688_101739910 | 3300005365 | Bacteria | 511 |
| 70 | Ga0070667_100011803 | 3300005367 | Bacteria | 7222 |
| 71 | Ga0070667_100026421 | 3300005367 | Bacteria | 4829 |
| 72 | Ga0070667_100087311 | 3300005367 | Bacteria | 2677 |
| 73 | Ga0070667_100743791 | 3300005367 | Bacteria | 909 |
| 74 | Ga0070667_100822763 | 3300005367 | Bacteria | 863 |
| 75 | Ga0070667_101514261 | 3300005367 | Bacteria | 630 |
| 76 | Ga0070700_100141012 | 3300005441 | Bacteria | 1638 |
| 77 | Ga0070700_100148338 | 3300005441 | Bacteria | 1601 |
| 78 | Ga0070663_100364896 | 3300005455 | Unclassified | 1172 |
| 79 | Ga0070663_100673765 | 3300005455 | Bacteria | 877 |
| 80 | Ga0070678_100189429 | 3300005456 | Bacteria | 1690 |
| 81 | Ga0070678_100393105 | 3300005456 | Unclassified | 1203 |
| 82 | Ga0070678_100789775 | 3300005456 | Bacteria | 861 |
| 83 | Ga0070662_100331851 | 3300005457 | Unclassified | 1243 |
| 84 | Ga0068867_100000586 | 3300005459 | Bacteria | 24122 |
| 85 | Ga0068867_100180724 | 3300005459 | Bacteria | 1677 |
| 86 | Ga0068867_100590481 | 3300005459 | Bacteria | 967 |
| 87 | Ga0068867_101964633 | 3300005459 | Bacteria | 552 |
| 88 | Ga0070685_10013986 | 3300005466 | Bacteria | 4246 |
| 89 | Ga0070685_10800480 | 3300005466 | Bacteria | 695 |
| 90 | Ga0070685_10821806 | 3300005466 | Bacteria | 686 |
| 91 | Ga0070685_11113106 | 3300005466 | Bacteria | 597 |
| 92 | Ga0070679_100147590 | 3300005530 | Unclassified | 2329 |
| 93 | Ga0068853_100007787 | 3300005539 | Bacteria | 8592 |
| 94 | Ga0068853_100013770 | 3300005539 | Bacteria | 6608 |
| 95 | Ga0068853_100091439 | 3300005539 | Bacteria | 2676 |
| 96 | Ga0068853_100163124 | 3300005539 | Bacteria | 2012 |
| 97 | Ga0070672_100102064 | 3300005543 | Bacteria | 2328 |
| 98 | Ga0070672_100223214 | 3300005543 | Bacteria | 1581 |
| 99 | Ga0070672_100261544 | 3300005543 | Unclassified | 1459 |
| 100 | Ga0070672_100330760 | 3300005543 | Bacteria | 1296 |
| 101 | Ga0070672_100801359 | 3300005543 | Bacteria | 829 |
| 102 | Ga0070665_101761329 | 3300005548 | Unclassified | 626 |
| 103 | Ga0068855_100053370 | 3300005563 | Bacteria | 4756 |
| 104 | Ga0068855_100061731 | 3300005563 | Bacteria | 4378 |
| 105 | Ga0068857_100059756 | 3300005577 | Bacteria | 3387 |
| 106 | Ga0068857_101986428 | 3300005577 | Unclassified | 570 |
| 107 | Ga0068854_100130757 | 3300005578 | Bacteria | 1916 |
| 108 | Ga0068854_100293820 | 3300005578 | Bacteria | 1312 |
| 109 | Ga0068854_100421874 | 3300005578 | Bacteria | 1108 |
| 110 | Ga0068856_100003542 | 3300005614 | Bacteria | 15720 |
| 111 | Ga0068856_100010896 | 3300005614 | Bacteria | 8825 |
| 112 | Ga0068856_101259362 | 3300005614 | Archaea | 755 |
| 113 | Ga0068856_101888544 | 3300005614 | Bacteria | 608 |
| 114 | Ga0068852_100000614 | 3300005616 | Bacteria | 23382 |
| 115 | Ga0068852_100002267 | 3300005616 | Bacteria | 13207 |
| 116 | Ga0068852_100693104 | 3300005616 | Bacteria | 1028 |
| 117 | Ga0068852_101397974 | 3300005616 | Bacteria | 722 |
| 118 | Ga0068852_102302514 | 3300005616 | Bacteria | 560 |
| 119 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 120 | Ga0068859_100018877 | 3300005617 | Bacteria | 6929 |
| 121 | Ga0068859_100081374 | 3300005617 | Bacteria | 3281 |
| 122 | Ga0068859_100204161 | 3300005617 | Bacteria | 2061 |
| 123 | Ga0068859_100336376 | 3300005617 | Bacteria | 1604 |
| 124 | Ga0068859_101044336 | 3300005617 | Bacteria | 898 |
| 125 | Ga0068864_100003917 | 3300005618 | Bacteria | 12262 |
| 126 | Ga0068864_100167138 | 3300005618 | Bacteria | 2003 |
| 127 | Ga0068864_100308683 | 3300005618 | Bacteria | 1483 |
| 128 | Ga0068864_101851077 | 3300005618 | Bacteria | 609 |
| 129 | Ga0068866_10001781 | 3300005718 | Bacteria | 9071 |
| 130 | Ga0068866_10173086 | 3300005718 | Unclassified | 1269 |
| 131 | Ga0068861_101452453 | 3300005719 | Bacteria | 671 |
| 132 | Ga0068861_102162576 | 3300005719 | Bacteria | 557 |
| 133 | Ga0068851_10028995 | 3300005834 | Bacteria | 2737 |
| 134 | Ga0068851_10082916 | 3300005834 | Bacteria | 1677 |
| 135 | Ga0068851_10099533 | 3300005834 | Bacteria | 1541 |
| 136 | Ga0068851_10578827 | 3300005834 | Bacteria | 681 |
| 137 | Ga0068863_100006890 | 3300005841 | Bacteria | 11136 |
| 138 | Ga0068863_100265284 | 3300005841 | Bacteria | 1661 |
| 139 | Ga0068863_100441702 | 3300005841 | Bacteria | 1276 |
| 140 | Ga0068863_101311389 | 3300005841 | Unclassified | 731 |
| 141 | Ga0068863_101565280 | 3300005841 | Bacteria | 668 |
| 142 | Ga0068863_102043464 | 3300005841 | Bacteria | 583 |
| 143 | Ga0068858_100002816 | 3300005842 | Bacteria | 17485 |
| 144 | Ga0068858_101406486 | 3300005842 | Bacteria | 687 |
| 145 | Ga0068860_100002009 | 3300005843 | Bacteria | 21464 |
| 146 | Ga0068860_100007756 | 3300005843 | Bacteria | 10722 |
| 147 | Ga0068860_100016973 | 3300005843 | Bacteria | 7095 |
| 148 | Ga0068860_100704279 | 3300005843 | Bacteria | 1020 |
| 149 | Ga0068860_101019895 | 3300005843 | Bacteria | 846 |
| 150 | Ga0068860_102051766 | 3300005843 | Unclassified | 593 |
| 151 | Ga0068862_100133101 | 3300005844 | Bacteria | 2201 |
| 152 | Ga0068862_101787858 | 3300005844 | Bacteria | 624 |
| 153 | Ga0075369_10341444 | 3300006186 | Bacteria | 702 |
| 154 | Ga0075366_10000091 | 3300006195 | Bacteria | 36066 |
| 155 | Ga0075366_10092113 | 3300006195 | Bacteria | 1816 |
| 156 | Ga0075366_10558183 | 3300006195 | Bacteria | 709 |
| 157 | Ga0097621_100000777 | 3300006237 | Bacteria | 22354 |
| 158 | Ga0097621_100001974 | 3300006237 | Bacteria | 13971 |
| 159 | Ga0097621_100143444 | 3300006237 | Bacteria | 2043 |
| 160 | Ga0097621_100738492 | 3300006237 | Bacteria | 908 |
| 161 | Ga0097621_100894428 | 3300006237 | Unclassified | 827 |
| 162 | Ga0097621_101036554 | 3300006237 | Bacteria | 768 |
| 163 | Ga0075370_10596015 | 3300006353 | Bacteria | 669 |
| 164 | Ga0068871_100000154 | 3300006358 | Bacteria | 45466 |
| 165 | Ga0068871_100074646 | 3300006358 | Bacteria | 2798 |
| 166 | Ga0068871_100180249 | 3300006358 | Bacteria | 1815 |
| 167 | Ga0068871_101179246 | 3300006358 | Bacteria | 718 |
| 168 | Ga0068871_101388425 | 3300006358 | Bacteria | 662 |
| 169 | Ga0068871_101849478 | 3300006358 | Bacteria | 574 |
| 170 | Ga0075430_100128116 | 3300006846 | Bacteria | 2116 |
| 171 | Ga0075431_100915216 | 3300006847 | Bacteria | 846 |
| 172 | Ga0068865_100000172 | 3300006881 | Bacteria | 35866 |
| 173 | Ga0068865_100182295 | 3300006881 | Bacteria | 1618 |
| 174 | Ga0068865_100253168 | 3300006881 | Bacteria | 1391 |
| 175 | Ga0068865_101536913 | 3300006881 | Unclassified | 597 |
| 176 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 177 | Ga0097620_100018877 | 3300006931 | Bacteria | 6929 |
| 178 | Ga0097620_100081377 | 3300006931 | Bacteria | 3281 |
| 179 | Ga0097620_100204160 | 3300006931 | Bacteria | 2061 |
| 180 | Ga0097620_100336379 | 3300006931 | Bacteria | 1604 |
| 181 | Ga0097620_101044479 | 3300006931 | Bacteria | 898 |
| 182 | Ga0105240_11649717 | 3300009093 | Bacteria | 670 |
| 183 | Ga0105240_11863377 | 3300009093 | Bacteria | 626 |
| 184 | Ga0105240_12443212 | 3300009093 | Bacteria | 541 |
| 185 | Ga0111539_10018476 | 3300009094 | Bacteria | 8635 |
| 186 | Ga0111539_10024964 | 3300009094 | Bacteria | 7325 |
| 187 | Ga0111539_10342300 | 3300009094 | Bacteria | 1741 |
| 188 | Ga0111539_11216489 | 3300009094 | Bacteria | 875 |
| 189 | Ga0111539_11365601 | 3300009094 | Bacteria | 822 |
| 190 | Ga0105245_10504692 | 3300009098 | Bacteria | 1226 |
| 191 | Ga0105245_10714983 | 3300009098 | Bacteria | 1036 |
| 192 | Ga0105247_10001017 | 3300009101 | Bacteria | 21132 |
| 193 | Ga0105247_10402581 | 3300009101 | Bacteria | 976 |
| 194 | Ga0105247_10823230 | 3300009101 | Unclassified | 710 |
| 195 | Ga0105243_10207292 | 3300009148 | Bacteria | 1723 |
| 196 | Ga0105243_10618732 | 3300009148 | Bacteria | 1045 |
| 197 | Ga0105243_12410793 | 3300009148 | Bacteria | 565 |
| 198 | Ga0105241_10000847 | 3300009174 | Bacteria | 23164 |
| 199 | Ga0105241_10013980 | 3300009174 | Bacteria | 5886 |
| 200 | Ga0105241_10374406 | 3300009174 | Bacteria | 1242 |
| 201 | Ga0105241_12369509 | 3300009174 | Bacteria | 529 |
| 202 | Ga0105242_10020115 | 3300009176 | Bacteria | 5232 |
| 203 | Ga0105242_10083586 | 3300009176 | Bacteria | 2674 |
| 204 | Ga0105242_10104661 | 3300009176 | Unclassified | 2403 |
| 205 | Ga0105242_10784764 | 3300009176 | Bacteria | 941 |
| 206 | Ga0105242_12137198 | 3300009176 | Unclassified | 604 |
| 207 | Ga0105242_12147183 | 3300009176 | Bacteria | 603 |
| 208 | Ga0105248_10497438 | 3300009177 | Bacteria | 1374 |
| 209 | Ga0105237_10001395 | 3300009545 | Bacteria | 31908 |
| 210 | Ga0105237_10001455 | 3300009545 | Bacteria | 31241 |
| 211 | Ga0105237_10466611 | 3300009545 | Bacteria | 1269 |
| 212 | Ga0105237_12399183 | 3300009545 | Bacteria | 538 |
| 213 | Ga0105237_12767060 | 3300009545 | Bacteria | 502 |
| 214 | Ga0105238_10596424 | 3300009551 | Unclassified | 1112 |
| 215 | Ga0105238_11200254 | 3300009551 | Bacteria | 783 |
| 216 | Ga0105238_11568767 | 3300009551 | Bacteria | 688 |
| 217 | Ga0105249_10005639 | 3300009553 | Bacteria | 10832 |
| 218 | Ga0105249_10687441 | 3300009553 | Bacteria | 1082 |
| 219 | Ga0105249_11752232 | 3300009553 | Bacteria | 694 |
| 220 | Ga0105249_12597274 | 3300009553 | Bacteria | 579 |
| 221 | Ga0105249_12642204 | 3300009553 | Unclassified | 574 |
| 222 | Ga0105239_10054410 | 3300010375 | Bacteria | 4390 |
| 223 | Ga0105239_10064333 | 3300010375 | Bacteria | 4026 |
| 224 | Ga0105239_10160641 | 3300010375 | Bacteria | 2510 |
| 225 | Ga0105239_10176462 | 3300010375 | Bacteria | 2390 |
| 226 | Ga0105239_10513044 | 3300010375 | Bacteria | 1363 |
| 227 | Ga0105239_11841067 | 3300010375 | Bacteria | 702 |
| 228 | Ga0105246_10087476 | 3300011119 | Bacteria | 2237 |
| 229 | Ga0105246_10291745 | 3300011119 | Bacteria | 1313 |
| 230 | Ga0157371_10042159 | 3300013102 | Bacteria | 3254 |
| 231 | Ga0157370_10231082 | 3300013104 | Bacteria | 1712 |
| 232 | Ga0157370_10399185 | 3300013104 | Unclassified | 1266 |
| 233 | Ga0157370_10914332 | 3300013104 | Bacteria | 796 |
| 234 | Ga0157370_11278688 | 3300013104 | Bacteria | 661 |
| 235 | Ga0157369_10185088 | 3300013105 | Bacteria | 2190 |
| 236 | Ga0157374_10000849 | 3300013296 | Bacteria | 26704 |
| 237 | Ga0157374_10131243 | 3300013296 | Bacteria | 2425 |
| 238 | Ga0157374_10211921 | 3300013296 | Bacteria | 1899 |
| 239 | Ga0157374_10294586 | 3300013296 | Bacteria | 1604 |
| 240 | Ga0157374_10388546 | 3300013296 | Bacteria | 1391 |
| 241 | Ga0157374_11134958 | 3300013296 | Bacteria | 802 |
| 242 | Ga0157374_11256376 | 3300013296 | Bacteria | 762 |
| 243 | Ga0157378_10007598 | 3300013297 | Bacteria | 9463 |
| 244 | Ga0157378_10038908 | 3300013297 | Bacteria | 4217 |
| 245 | Ga0157378_10080319 | 3300013297 | Bacteria | 2946 |
| 246 | Ga0157378_10158378 | 3300013297 | Bacteria | 2116 |
| 247 | Ga0157378_10617202 | 3300013297 | Bacteria | 1097 |
| 248 | Ga0157378_11732384 | 3300013297 | Bacteria | 672 |
| 249 | Ga0157378_12878957 | 3300013297 | Bacteria | 533 |
| 250 | Ga0157378_13032038 | 3300013297 | Bacteria | 521 |
| 251 | Ga0163162_10000361 | 3300013306 | Bacteria | 41263 |
| 252 | Ga0163162_10000568 | 3300013306 | Bacteria | 34113 |
| 253 | Ga0163162_10061419 | 3300013306 | Bacteria | 3796 |
| 254 | Ga0163162_10065676 | 3300013306 | Bacteria | 3676 |
| 255 | Ga0163162_10172866 | 3300013306 | Bacteria | 2285 |
| 256 | Ga0163162_10456307 | 3300013306 | Bacteria | 1410 |
| 257 | Ga0163162_10593971 | 3300013306 | Bacteria | 1234 |
| 258 | Ga0163162_10775708 | 3300013306 | Unclassified | 1077 |
| 259 | Ga0163162_11239030 | 3300013306 | Unclassified | 847 |
| 260 | Ga0163162_11905804 | 3300013306 | Bacteria | 680 |
| 261 | Ga0157372_10001279 | 3300013307 | Bacteria | 27221 |
| 262 | Ga0157372_10027329 | 3300013307 | Bacteria | 6213 |
| 263 | Ga0157372_11032845 | 3300013307 | Bacteria | 952 |
| 264 | Ga0157375_10003003 | 3300013308 | Bacteria | 14649 |
| 265 | Ga0157375_10239294 | 3300013308 | Bacteria | 1975 |
| 266 | Ga0157375_10309110 | 3300013308 | Bacteria | 1745 |
| 267 | Ga0157375_10364905 | 3300013308 | Bacteria | 1610 |
| 268 | Ga0157375_10416474 | 3300013308 | Bacteria | 1510 |
| 269 | Ga0157375_11184975 | 3300013308 | Bacteria | 896 |
| 270 | Ga0157375_11283565 | 3300013308 | Bacteria | 860 |
| 271 | Ga0157375_13342079 | 3300013308 | Bacteria | 535 |
| 272 | Ga0163163_10086565 | 3300014325 | Bacteria | 3143 |
| 273 | Ga0163163_10098735 | 3300014325 | Bacteria | 2941 |
| 274 | Ga0163163_10623390 | 3300014325 | Bacteria | 1142 |
| 275 | Ga0163163_10831385 | 3300014325 | Bacteria | 987 |
| 276 | Ga0163163_11095282 | 3300014325 | Unclassified | 859 |
| 277 | Ga0163163_12098616 | 3300014325 | Bacteria | 625 |
| 278 | Ga0163163_12139922 | 3300014325 | Bacteria | 619 |
| 279 | Ga0157380_10000046 | 3300014326 | Bacteria | 73022 |
| 280 | Ga0157380_10009471 | 3300014326 | Bacteria | 6980 |
| 281 | Ga0157380_10021434 | 3300014326 | Bacteria | 4846 |
| 282 | Ga0157380_10591603 | 3300014326 | Bacteria | 1096 |
| 283 | Ga0157380_10794307 | 3300014326 | Bacteria | 963 |
| 284 | Ga0157380_12417229 | 3300014326 | Bacteria | 591 |
| 285 | Ga0157380_13310532 | 3300014326 | Bacteria | 515 |
| 286 | Ga0157377_10540315 | 3300014745 | Unclassified | 821 |
| 287 | Ga0157377_10561183 | 3300014745 | Bacteria | 808 |
| 288 | Ga0157377_10759002 | 3300014745 | Bacteria | 711 |
| 289 | Ga0157379_10123204 | 3300014968 | Bacteria | 2333 |
| 290 | Ga0157379_10245139 | 3300014968 | Bacteria | 1625 |
| 291 | Ga0157379_11535403 | 3300014968 | Bacteria | 649 |
| 292 | Ga0157379_12131652 | 3300014968 | Bacteria | 556 |
| 293 | Ga0157376_10082731 | 3300014969 | Unclassified | 2759 |
| 294 | Ga0157376_10319822 | 3300014969 | Unclassified | 1475 |
| 295 | Ga0157376_11329550 | 3300014969 | Bacteria | 749 |
| 296 | Ga0157376_12037201 | 3300014969 | Bacteria | 612 |
| 297 | Ga0163161_10222185 | 3300017792 | Bacteria | 1463 |
| 298 | Ga0163161_11763991 | 3300017792 | Bacteria | 549 |
| 299 | Ga0206351_10503684 | 3300020077 | Bacteria | 1872 |
| 300 | Ga0209258_128797 | 3300025242 | Bacteria | 527 |
| 301 | Ga0209026_1000226 | 3300025250 | Bacteria | 77076 |
| 302 | Ga0207656_10018556 | 3300025321 | Bacteria | 2741 |
| 303 | Ga0207656_10018811 | 3300025321 | Bacteria | 2724 |
| 304 | Ga0207656_10400381 | 3300025321 | Bacteria | 690 |
| 305 | Ga0207656_10593079 | 3300025321 | Bacteria | 566 |
| 306 | Ga0207682_10191800 | 3300025893 | Bacteria | 937 |
| 307 | Ga0207682_10205562 | 3300025893 | Bacteria | 907 |
| 308 | Ga0207682_10541329 | 3300025893 | Unclassified | 551 |
| 309 | Ga0207642_10254681 | 3300025899 | Unclassified | 998 |
| 310 | Ga0207710_10021990 | 3300025900 | Bacteria | 2735 |
| 311 | Ga0207710_10222228 | 3300025900 | Bacteria | 938 |
| 312 | Ga0207688_10815651 | 3300025901 | Unclassified | 591 |
| 313 | Ga0207680_10000102 | 3300025903 | Bacteria | 39308 |
| 314 | Ga0207680_11196778 | 3300025903 | Unclassified | 542 |
| 315 | Ga0207647_10028556 | 3300025904 | Bacteria | 3621 |
| 316 | Ga0207647_10247553 | 3300025904 | Bacteria | 1023 |
| 317 | Ga0207647_10430505 | 3300025904 | Bacteria | 741 |
| 318 | Ga0207645_10000146 | 3300025907 | Bacteria | 55323 |
| 319 | Ga0207645_10627096 | 3300025907 | Bacteria | 730 |
| 320 | Ga0207645_10672470 | 3300025907 | Unclassified | 703 |
| 321 | Ga0207705_10373636 | 3300025909 | Bacteria | 1101 |
| 322 | Ga0207654_10010768 | 3300025911 | Bacteria | 4657 |
| 323 | Ga0207654_10023238 | 3300025911 | Bacteria | 3318 |
| 324 | Ga0207654_10968169 | 3300025911 | Bacteria | 618 |
| 325 | Ga0207695_11317652 | 3300025913 | Bacteria | 602 |
| 326 | Ga0207671_10007457 | 3300025914 | Bacteria | 9492 |
| 327 | Ga0207671_10194657 | 3300025914 | Unclassified | 1582 |
| 328 | Ga0207649_11069273 | 3300025920 | Bacteria | 636 |
| 329 | Ga0207649_11118181 | 3300025920 | Bacteria | 622 |
| 330 | Ga0207649_11356511 | 3300025920 | Bacteria | 563 |
| 331 | Ga0207652_11064618 | 3300025921 | Unclassified | 709 |
| 332 | Ga0207681_10505150 | 3300025923 | Bacteria | 990 |
| 333 | Ga0207681_10658458 | 3300025923 | Bacteria | 869 |
| 334 | Ga0207694_10009457 | 3300025924 | Bacteria | 7347 |
| 335 | Ga0207650_10036252 | 3300025925 | Bacteria | 3587 |
| 336 | Ga0207650_10087490 | 3300025925 | Bacteria | 2374 |
| 337 | Ga0207650_10292844 | 3300025925 | Bacteria | 1328 |
| 338 | Ga0207650_11394195 | 3300025925 | Bacteria | 596 |
| 339 | Ga0207650_11538583 | 3300025925 | Bacteria | 565 |
| 340 | Ga0207659_10107535 | 3300025926 | Bacteria | 2114 |
| 341 | Ga0207659_10820061 | 3300025926 | Bacteria | 799 |
| 342 | Ga0207687_10534911 | 3300025927 | Bacteria | 981 |
| 343 | Ga0207687_10919561 | 3300025927 | Bacteria | 749 |
| 344 | Ga0207644_10021819 | 3300025931 | Bacteria | 4367 |
| 345 | Ga0207644_10043479 | 3300025931 | Bacteria | 3188 |
| 346 | Ga0207644_10086484 | 3300025931 | Bacteria | 2328 |
| 347 | Ga0207706_10226838 | 3300025933 | Bacteria | 1635 |
| 348 | Ga0207686_10097460 | 3300025934 | Bacteria | 1956 |
| 349 | Ga0207686_10188577 | 3300025934 | Bacteria | 1468 |
| 350 | Ga0207686_10329227 | 3300025934 | Unclassified | 1144 |
| 351 | Ga0207709_10218997 | 3300025935 | Bacteria | 1371 |
| 352 | Ga0207669_11463752 | 3300025937 | Bacteria | 582 |
| 353 | Ga0207704_10000205 | 3300025938 | Bacteria | 30268 |
| 354 | Ga0207704_10131108 | 3300025938 | Bacteria | 1736 |
| 355 | Ga0207704_11356321 | 3300025938 | Bacteria | 609 |
| 356 | Ga0207691_10120725 | 3300025940 | Bacteria | 2323 |
| 357 | Ga0207691_10128331 | 3300025940 | Unclassified | 2242 |
| 358 | Ga0207691_10178850 | 3300025940 | Bacteria | 1854 |
| 359 | Ga0207691_10286780 | 3300025940 | Bacteria | 1416 |
| 360 | Ga0207689_10003994 | 3300025942 | Bacteria | 13420 |
| 361 | Ga0207689_10205674 | 3300025942 | Unclassified | 1626 |
| 362 | Ga0207679_10738451 | 3300025945 | Bacteria | 895 |
| 363 | Ga0207679_11225023 | 3300025945 | Bacteria | 689 |
| 364 | Ga0207667_10070023 | 3300025949 | Bacteria | 3651 |
| 365 | Ga0207667_10438577 | 3300025949 | Bacteria | 1328 |
| 366 | Ga0207667_11250387 | 3300025949 | Bacteria | 720 |
| 367 | Ga0207651_10042253 | 3300025960 | Bacteria | 3033 |
| 368 | Ga0207651_10214971 | 3300025960 | Unclassified | 1550 |
| 369 | Ga0207651_10663007 | 3300025960 | Bacteria | 916 |
| 370 | Ga0207651_12028967 | 3300025960 | Bacteria | 517 |
| 371 | Ga0207712_10001952 | 3300025961 | Bacteria | 13536 |
| 372 | Ga0207712_10101960 | 3300025961 | Bacteria | 2135 |
| 373 | Ga0207712_10247582 | 3300025961 | Bacteria | 1439 |
| 374 | Ga0207712_11651169 | 3300025961 | Unclassified | 574 |
| 375 | Ga0207668_10147319 | 3300025972 | Bacteria | 1818 |
| 376 | Ga0207668_10252846 | 3300025972 | Bacteria | 1432 |
| 377 | Ga0207668_11459364 | 3300025972 | Bacteria | 617 |
| 378 | Ga0207640_10264593 | 3300025981 | Bacteria | 1342 |
| 379 | Ga0207658_10024854 | 3300025986 | Bacteria | 4191 |
| 380 | Ga0207658_10059050 | 3300025986 | Bacteria | 2857 |
| 381 | Ga0207658_10075189 | 3300025986 | Bacteria | 2569 |
| 382 | Ga0207658_10473783 | 3300025986 | Unclassified | 1112 |
| 383 | Ga0207658_11194764 | 3300025986 | Bacteria | 695 |
| 384 | Ga0207677_10002126 | 3300026023 | Bacteria | 10402 |
| 385 | Ga0207677_10043214 | 3300026023 | Bacteria | 2994 |
| 386 | Ga0207677_10192782 | 3300026023 | Bacteria | 1613 |
| 387 | Ga0207677_11224845 | 3300026023 | Bacteria | 688 |
| 388 | Ga0207703_10004081 | 3300026035 | Bacteria | 12045 |
| 389 | Ga0207703_11324738 | 3300026035 | Bacteria | 693 |
| 390 | Ga0207703_12169099 | 3300026035 | Bacteria | 532 |
| 391 | Ga0207639_10009956 | 3300026041 | Bacteria | 6569 |
| 392 | Ga0207639_10034913 | 3300026041 | Unclassified | 3720 |
| 393 | Ga0207639_10064192 | 3300026041 | Bacteria | 2846 |
| 394 | Ga0207639_10152291 | 3300026041 | Bacteria | 1938 |
| 395 | Ga0207639_10207681 | 3300026041 | Bacteria | 1684 |
| 396 | Ga0207639_11126736 | 3300026041 | Bacteria | 736 |
| 397 | Ga0207678_10747799 | 3300026067 | Unclassified | 862 |
| 398 | Ga0207708_10153497 | 3300026075 | Bacteria | 1815 |
| 399 | Ga0207702_10024888 | 3300026078 | Bacteria | 4967 |
| 400 | Ga0207702_10029754 | 3300026078 | Bacteria | 4546 |
| 401 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 402 | Ga0207641_10012810 | 3300026088 | Bacteria | 6875 |
| 403 | Ga0207641_10801050 | 3300026088 | Unclassified | 932 |
| 404 | Ga0207641_11301333 | 3300026088 | Bacteria | 727 |
| 405 | Ga0207648_10000747 | 3300026089 | Bacteria | 36518 |
| 406 | Ga0207648_10047974 | 3300026089 | Bacteria | 3741 |
| 407 | Ga0207648_10223369 | 3300026089 | Bacteria | 1674 |
| 408 | Ga0207648_11614730 | 3300026089 | Unclassified | 609 |
| 409 | Ga0207648_12066969 | 3300026089 | Bacteria | 531 |
| 410 | Ga0207676_10002059 | 3300026095 | Bacteria | 14593 |
| 411 | Ga0207676_10262176 | 3300026095 | Bacteria | 1561 |
| 412 | Ga0207676_10842640 | 3300026095 | Bacteria | 896 |
| 413 | Ga0207676_10963491 | 3300026095 | Unclassified | 839 |
| 414 | Ga0207676_11342469 | 3300026095 | Bacteria | 710 |
| 415 | Ga0207674_10314308 | 3300026116 | Bacteria | 1516 |
| 416 | Ga0207674_10913472 | 3300026116 | Bacteria | 846 |
| 417 | Ga0207675_100731756 | 3300026118 | Bacteria | 1000 |
| 418 | Ga0207675_100774128 | 3300026118 | Bacteria | 972 |
| 419 | Ga0207683_10006913 | 3300026121 | Bacteria | 9712 |
| 420 | Ga0207683_10168572 | 3300026121 | Bacteria | 1982 |
| 421 | Ga0207683_10211041 | 3300026121 | Bacteria | 1767 |
| 422 | Ga0207683_10967059 | 3300026121 | Bacteria | 791 |
| 423 | Ga0207698_10003892 | 3300026142 | Bacteria | 9039 |
| 424 | Ga0207698_10021755 | 3300026142 | Unclassified | 4442 |
| 425 | Ga0207698_10895928 | 3300026142 | Bacteria | 894 |
| 426 | Ga0207698_11523284 | 3300026142 | Bacteria | 684 |
| 427 | Ga0207698_11840514 | 3300026142 | Unclassified | 620 |
| 428 | Ga0209968_1040181 | 3300027526 | Bacteria | 799 |
| 429 | Ga0209966_1026011 | 3300027695 | Bacteria | 1164 |
| 430 | Ga0207428_10019792 | 3300027907 | Bacteria | 5733 |
| 431 | Ga0207428_10611661 | 3300027907 | Bacteria | 784 |
| 432 | Ga0268265_10475192 | 3300028380 | Bacteria | 1173 |
| 433 | Ga0268265_10504424 | 3300028380 | Bacteria | 1141 |
| 434 | Ga0268265_12062726 | 3300028380 | Bacteria | 577 |
| 435 | Ga0268264_10001199 | 3300028381 | Bacteria | 25035 |
| 436 | Ga0268264_10002153 | 3300028381 | Bacteria | 17563 |
| 437 | Ga0268264_10003263 | 3300028381 | Bacteria | 14030 |
| 438 | Ga0268264_11297099 | 3300028381 | Bacteria | 738 |
| 439 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 440 | Ga0307515_10000031 | 3300028794 | Bacteria | 358648 |
| 441 | Ga0307515_10000667 | 3300028794 | Bacteria | 79135 |
| 442 | Ga0307515_10000790 | 3300028794 | Bacteria | 72891 |
| 443 | Ga0307515_10461049 | 3300028794 | Bacteria | 885 |
| 444 | Ga0307513_10254115 | 3300031456 | Bacteria | 1552 |
| 445 | Ga0307513_10356067 | 3300031456 | Bacteria | 1210 |
| 446 | Ga0307513_10732073 | 3300031456 | Bacteria | 695 |
| 447 | Ga0307509_10278917 | 3300031507 | Bacteria | 1434 |
| 448 | Ga0307509_10399904 | 3300031507 | Bacteria | 1081 |
| 449 | Ga0307408_100077086 | 3300031548 | Bacteria | 2482 |
| 450 | Ga0307514_10051268 | 3300031649 | Bacteria | 3199 |
| 451 | Ga0307514_10415306 | 3300031649 | Bacteria | 679 |
| 452 | Ga0307516_10307902 | 3300031730 | Bacteria | 1258 |
| 453 | Ga0307516_10453204 | 3300031730 | Bacteria | 939 |
| 454 | Ga0307413_10164185 | 3300031824 | Bacteria | 1564 |
| 455 | Ga0307410_11427670 | 3300031852 | Bacteria | 608 |
| 456 | Ga0307412_11616238 | 3300031911 | Unclassified | 592 |
| 457 | Ga0307416_102413489 | 3300032002 | Bacteria | 625 |
| 458 | Ga0307414_10141912 | 3300032004 | Unclassified | 1882 |
| 459 | Ga0307411_12057236 | 3300032005 | Bacteria | 534 |
| 460 | Ga0307507_10000144 | 3300033179 | Bacteria | 123842 |
| 461 | Ga0373945_0533537 | 3300035116 | Bacteria | 525 |
| 462 | Ga0395899_0037668 | 3300037312 | Bacteria | 3625 |
| 463 | Ga0395900_0027720 | 3300037418 | Bacteria | 5803 |
| 464 | Ga0395898_0827926 | 3300037466 | Bacteria | 865 |
| 465 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 466 | Ga0395905_0000049 | 3300037471 | Bacteria | 230719 |
| 467 | Ga0395905_0001249 | 3300037471 | Bacteria | 31492 |
| 468 | Ga0395901_0003386 | 3300038443 | Bacteria | 16061 |
| 469 | Ga0439436_0143721 | 3300041404 | Unclassified | 671 |
| 470 | Ga0439453_0178518 | 3300041408 | Bacteria | 517 |
| 471 | Ga0451787_422665 | 3300041441 | Unclassified | 523 |
| 472 | Ga0451789_0303625 | 3300041443 | Bacteria | 1449 |
| 473 | Ga0451791_0797082 | 3300041451 | Bacteria | 546 |
| 474 | Ga0451793_0259997 | 3300041452 | Bacteria | 2004 |
| 475 | Ga0451793_0929927 | 3300041452 | Bacteria | 789 |
| 476 | Ga0451797_0007636 | 3300041453 | Bacteria | 515 |
| 477 | Ga0451800_0613430 | 3300041459 | Unclassified | 511 |
| 478 | Ga0451800_0742141 | 3300041459 | Unclassified | 602 |
| 479 | Ga0451802_0652972 | 3300041460 | Bacteria | 509 |
| 480 | Ga0451802_1007957 | 3300041460 | Bacteria | 674 |
| 481 | Ga0451802_1093250 | 3300041460 | Bacteria | 823 |
| 482 | Ga0451807_0874893 | 3300041486 | Unclassified | 670 |
| 483 | Ga0451849_0096302 | 3300041505 | Bacteria | 561 |
| 484 | Ga0451849_0521996 | 3300041505 | Unclassified | 1395 |
| 485 | Ga0451849_1063937 | 3300041505 | Bacteria | 534 |
| 486 | Ga0451851_0284543 | 3300041507 | Bacteria | 906 |
| 487 | Ga0451851_1334134 | 3300041507 | Unclassified | 740 |
| 488 | Ga0451853_0724937 | 3300041512 | Unclassified | 525 |
| 489 | Ga0451853_0791209 | 3300041512 | Bacteria | 634 |
| 490 | Ga0451853_1889411 | 3300041512 | Bacteria | 656 |
| 491 | Ga0451853_2398176 | 3300041512 | Bacteria | 544 |
| 492 | Ga0466966_0066002 | 3300044684 | Unclassified | 2275 |
| 493 | Ga0466964_0085184 | 3300044706 | Bacteria | 1364 |
| 494 | Ga0453684_0748735 | 3300044712 | Bacteria | 1058 |
| 495 | Ga0466967_1979102 | 3300045976 | Bacteria | 579 |
| 496 | Ga0495592_0478108 | 3300046454 | Bacteria | 776 |
| 497 | Ga0495592_0775841 | 3300046454 | Bacteria | 571 |
| 498 | Ga0495629_0121363 | 3300046459 | Bacteria | 1821 |
| 499 | Ga0495629_0879716 | 3300046459 | Bacteria | 588 |
| 500 | Ga0495638_0247841 | 3300046460 | Bacteria | 983 |
| 501 | Ga0495651_0180197 | 3300046462 | Bacteria | 1496 |
| 502 | Ga0495651_0759170 | 3300046462 | Bacteria | 601 |
| 503 | Ga0495650_0000095 | 3300046471 | Bacteria | 218020 |
| 504 | Ga0495585_0000057 | 3300046492 | Bacteria | 113069 |
| 505 | Ga0495585_0002733 | 3300046492 | Bacteria | 12319 |
| 506 | Ga0495585_0011600 | 3300046492 | Bacteria | 5211 |
| 507 | Ga0495583_0005597 | 3300046506 | Bacteria | 8469 |
| 508 | Ga0495583_0381052 | 3300046506 | Bacteria | 555 |
| 509 | Ga0495606_0000009 | 3300046507 | Bacteria | 306313 |
| 510 | Ga0495606_0191418 | 3300046507 | Bacteria | 1172 |
| 511 | Ga0495608_0076564 | 3300046511 | Bacteria | 2179 |
| 512 | Ga0495610_0000867 | 3300046512 | Bacteria | 28278 |
| 513 | Ga0495610_0260541 | 3300046512 | Bacteria | 683 |
| 514 | Ga0495610_0306604 | 3300046512 | Bacteria | 610 |
| 515 | Ga0495616_0000733 | 3300046513 | Bacteria | 24135 |
| 516 | Ga0495618_0670649 | 3300046514 | Bacteria | 612 |
| 517 | Ga0495628_0076588 | 3300046516 | Bacteria | 2603 |
| 518 | Ga0495628_1161392 | 3300046516 | Bacteria | 525 |
| 519 | Ga0495631_0120747 | 3300046518 | Bacteria | 1127 |
| 520 | Ga0495631_0120947 | 3300046518 | Bacteria | 1126 |
| 521 | Ga0495637_0117271 | 3300046520 | Bacteria | 1027 |
| 522 | Ga0495637_0135435 | 3300046520 | Bacteria | 938 |
| 523 | Ga0495648_0003800 | 3300046524 | Bacteria | 13122 |
| 524 | Ga0495648_0036248 | 3300046524 | Bacteria | 3185 |
| 525 | Ga0495648_0057079 | 3300046524 | Bacteria | 2344 |
| 526 | Ga0495663_0196072 | 3300046525 | Bacteria | 703 |
| 527 | Ga0495652_0304302 | 3300046529 | Bacteria | 1158 |
| 528 | Ga0495652_0368867 | 3300046529 | Bacteria | 1024 |
| 529 | Ga0495654_0078110 | 3300046530 | Bacteria | 1557 |
| 530 | Ga0495654_0242893 | 3300046530 | Bacteria | 753 |
| 531 | Ga0495598_0178109 | 3300046537 | Bacteria | 757 |
| 532 | Ga0495609_0015217 | 3300046538 | Bacteria | 3603 |
| 533 | Ga0495609_0018877 | 3300046538 | Bacteria | 3193 |
| 534 | Ga0495609_0037794 | 3300046538 | Bacteria | 2177 |
| 535 | Ga0495621_0063398 | 3300046539 | Bacteria | 1347 |
| 536 | Ga0495622_0008647 | 3300046557 | Bacteria | 4718 |
| 537 | Ga0495622_0037148 | 3300046557 | Bacteria | 2269 |
| 538 | Ga0495622_0220672 | 3300046557 | Bacteria | 840 |
| 539 | Ga0495633_0000275 | 3300046558 | Bacteria | 60032 |
| 540 | Ga0495633_0003968 | 3300046558 | Bacteria | 9609 |
| 541 | Ga0495668_0000017 | 3300046616 | Bacteria | 434025 |
| 542 | Ga0495668_0198463 | 3300046616 | Bacteria | 1099 |
| 543 | Ga0495625_0000007 | 3300046660 | Bacteria | 565749 |
| 544 | Ga0495625_0000435 | 3300046660 | Bacteria | 62758 |
| 545 | Ga0495625_0001213 | 3300046660 | Bacteria | 32692 |
| 546 | Ga0495625_0040215 | 3300046660 | Bacteria | 3412 |
| 547 | Ga0495661_0000576 | 3300046665 | Bacteria | 38166 |
| 548 | Ga0495588_0102322 | 3300046674 | Bacteria | 1506 |
| 549 | Ga0495658_0025386 | 3300046683 | Bacteria | 3167 |
| 550 | Ga0495658_0044823 | 3300046683 | Bacteria | 2479 |
| 551 | Ga0495670_0151582 | 3300046691 | Bacteria | 1216 |
| 552 | Ga0495670_0844602 | 3300046691 | Bacteria | 500 |
| 553 | Ga0495671_0027550 | 3300046692 | Bacteria | 2934 |
| 554 | Ga0495649_0000007 | 3300046694 | Bacteria | 518037 |
| 555 | Ga0495600_0219554 | 3300046809 | Bacteria | 1216 |
| 556 | Ga0495600_0686852 | 3300046809 | Bacteria | 617 |
| 557 | Ga0495660_0020251 | 3300046810 | Bacteria | 3812 |
| 558 | Ga0495660_0102272 | 3300046810 | Bacteria | 1473 |
| 559 | Ga0495636_0120574 | 3300047318 | Bacteria | 1160 |
| 560 | Ga0495672_0037564 | 3300047320 | Bacteria | 2962 |
| 561 | Ga0495676_0441869 | 3300047321 | Bacteria | 859 |
| 562 | Ga0495683_0082685 | 3300047323 | Bacteria | 1564 |
| 563 | Ga0495687_000440 | 3300047443 | Bacteria | 51285 |
| 564 | Ga0495687_036112 | 3300047443 | Bacteria | 2214 |
| 565 | Ga0495677_0447931 | 3300047445 | Bacteria | 511 |
| 566 | Ga0495679_160294 | 3300047446 | Bacteria | 601 |
| 567 | Ga0495673_0029094 | 3300047469 | Bacteria | 2611 |
| 568 | Ga0495686_0031274 | 3300047472 | Bacteria | 3453 |
| 569 | Ga0495686_0619986 | 3300047472 | Bacteria | 558 |
| 570 | Ga0495602_0879454 | 3300048088 | Bacteria | 597 |
| 571 | Ga0495614_0019267 | 3300048089 | Bacteria | 2953 |
| 572 | Ga0495626_0117421 | 3300048091 | Bacteria | 1147 |
| 573 | Ga0496110_1333775 | 3300048913 | Bacteria | 627 |
| 574 | Ga0495682_0052571 | 3300049460 | Bacteria | 1480 |
| 575 | Ga0501322_012301 | 3300049538 | Bacteria | 679 |
| 576 | Ga0501323_019456 | 3300049539 | Bacteria | 885 |
| 577 | Ga0501032_0107271 | 3300049569 | Bacteria | 1850 |
| 578 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 579 | Ga0501036_0564675 | 3300049572 | Bacteria | 945 |
| 580 | Ga0501037_0424039 | 3300049573 | Bacteria | 910 |
| 581 | Ga0501047_0430720 | 3300049581 | Bacteria | 1150 |
| 582 | Ga0501202_061324 | 3300049652 | Unclassified | 851 |
| 583 | Ga0501236_001209 | 3300049670 | Bacteria | 2928 |
| 584 | Ga0501264_002656 | 3300049761 | Bacteria | 1647 |
| 585 | nmdc:mga0k408_490_c1 | 3300050493 | Bacteria | 21695 |
| 586 | nmdc:mga0k408_5994_c1 | 3300050493 | Bacteria | 6487 |
| 587 | nmdc:mga0k408_656162_c1 | 3300050493 | Bacteria | 617 |
| 588 | nmdc:mga07m45_548033_c1 | 3300050496 | Bacteria | 669 |
| 589 | nmdc:mga0qj67_50936_c1 | 3300050509 | Bacteria | 3273 |
| 590 | nmdc:mga06r32_983902_c1 | 3300050510 | Bacteria | 797 |
| 591 | nmdc:mga08y16_22038_c1 | 3300050511 | Bacteria | 6727 |
| 592 | nmdc:mga08y16_22108_c1 | 3300050511 | Bacteria | 6714 |
| 593 | nmdc:mga08y16_284540_c1 | 3300050511 | Bacteria | 1705 |
| 594 | nmdc:mga0sz30_160790_c1 | 3300050516 | Bacteria | 995 |
| 595 | Ga0500646_0143247 | 3300053090 | Bacteria | 786 |
| 596 | Ga0500646_0289881 | 3300053090 | Bacteria | 585 |
| 597 | Ga0500646_0292639 | 3300053090 | Bacteria | 582 |
| 598 | Ga0500562_086968 | 3300053108 | Bacteria | 847 |
| 599 | Ga0500594_0210115 | 3300053118 | Bacteria | 641 |
| 600 | Ga0500618_000033 | 3300053125 | Bacteria | 121886 |
| 601 | Ga0500618_033636 | 3300053125 | Bacteria | 1195 |
| 602 | Ga0500655_031304 | 3300053133 | Bacteria | 1025 |
| 603 | Ga0500658_0250366 | 3300053134 | Bacteria | 814 |
| 604 | Ga0500561_0168618 | 3300053137 | Bacteria | 686 |
| 605 | Ga0500604_0001406 | 3300053151 | Bacteria | 6702 |
| 606 | Ga0500622_0000012 | 3300053156 | Bacteria | 383183 |
| 607 | Ga0500622_0000030 | 3300053156 | Bacteria | 208734 |
| 608 | Ga0500622_0012337 | 3300053156 | Bacteria | 4627 |
| 609 | Ga0500627_0066865 | 3300053158 | Bacteria | 1588 |
| 610 | Ga0500634_0124452 | 3300053161 | Bacteria | 1249 |
| 611 | Ga0500567_259717 | 3300053723 | Bacteria | 505 |
| 612 | Ga0500661_003220 | 3300055283 | Bacteria | 3074 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_11216489 | Ga0111539_112164892 | 82 |
| 2 | 3300009553 | Ga0105249_11752232 | Ga0105249_117522321 | 82 |
| 3 | 3300013308 | Ga0157375_10416474 | Ga0157375_104164742 | 82 |
| 4 | 3300014325 | Ga0163163_10831385 | Ga0163163_108313852 | 82 |
| 5 | 3300003316 | rootH1_10000337 | rootH1_100003375 | 83 |
| 6 | 3300003316 | rootH1_10021873 | rootH1_100218732 | 83 |
| 7 | 3300003320 | rootH2_10003246 | rootH2_10003246131 | 83 |
| 8 | 3300003322 | rootL2_10023564 | rootL2_100235643 | 83 |
| 9 | 3300003322 | rootL2_10033367 | rootL2_100333675 | 83 |
| 10 | 3300003323 | rootH1_10002599 | rootH1_1000259925 | 83 |
| 11 | 3300003323 | rootH1_10029269 | rootH1_100292696 | 83 |
| 12 | 3300003323 | rootH1_10052813 | rootH1_100528132 | 83 |
| 13 | 3300003323 | rootH1_10100022 | rootH1_101000221 | 83 |
| 14 | 3300005262 | Ga0065165_1007023 | Ga0065165_10070235 | 83 |
| 15 | 3300006195 | Ga0075366_10558183 | Ga0075366_105581832 | 83 |
| 16 | 3300006846 | Ga0075430_100128116 | Ga0075430_1001281161 | 83 |
| 17 | 3300006847 | Ga0075431_100915216 | Ga0075431_1009152161 | 83 |
| 18 | 3300009094 | Ga0111539_10018476 | Ga0111539_100184767 | 83 |
| 19 | 3300009094 | Ga0111539_10024964 | Ga0111539_100249646 | 83 |
| 20 | 3300010375 | Ga0105239_11841067 | Ga0105239_118410672 | 83 |
| 21 | 3300013297 | Ga0157378_12878957 | Ga0157378_128789571 | 83 |
| 22 | 3300014326 | Ga0157380_10021434 | Ga0157380_100214343 | 83 |
| 23 | 3300026118 | Ga0207675_100774128 | Ga0207675_1007741282 | 83 |
| 24 | 3300027526 | Ga0209968_1040181 | Ga0209968_10401812 | 83 |
| 25 | 3300027695 | Ga0209966_1026011 | Ga0209966_10260112 | 83 |
| 26 | 3300027907 | Ga0207428_10019792 | Ga0207428_100197923 | 83 |
| 27 | 3300027907 | Ga0207428_10611661 | Ga0207428_106116611 | 83 |
| 28 | 3300028794 | Ga0307515_10461049 | Ga0307515_104610492 | 83 |
| 29 | 3300031456 | Ga0307513_10254115 | Ga0307513_102541152 | 83 |
| 30 | 3300031456 | Ga0307513_10732073 | Ga0307513_107320732 | 83 |
| 31 | 3300031507 | Ga0307509_10399904 | Ga0307509_103999042 | 83 |
| 32 | 3300031548 | Ga0307408_100077086 | Ga0307408_1000770863 | 83 |
| 33 | 3300031730 | Ga0307516_10307902 | Ga0307516_103079022 | 83 |
| 34 | 3300031730 | Ga0307516_10453204 | Ga0307516_104532041 | 83 |
| 35 | 3300031824 | Ga0307413_10164185 | Ga0307413_101641852 | 83 |
| 36 | 3300031852 | Ga0307410_11427670 | Ga0307410_114276702 | 83 |
| 37 | 3300032002 | Ga0307416_102413489 | Ga0307416_1024134891 | 83 |
| 38 | 3300032005 | Ga0307411_12057236 | Ga0307411_120572362 | 83 |
| 39 | 3300041404 | Ga0439436_0143721 | Ga0439436_0143721_193_450 | 83 |
| 40 | 3300041408 | Ga0439453_0178518 | Ga0439453_0178518_164_421 | 83 |
| 41 | 3300041441 | Ga0451787_422665 | Ga0451787_422665_84_341 | 83 |
| 42 | 3300041453 | Ga0451797_0007636 | Ga0451797_0007636_28_285 | 83 |
| 43 | 3300041459 | Ga0451800_0613430 | Ga0451800_0613430_152_409 | 83 |
| 44 | 3300041459 | Ga0451800_0742141 | Ga0451800_0742141_288_551 | 83 |
| 45 | 3300041460 | Ga0451802_1007957 | Ga0451802_1007957_44_301 | 83 |
| 46 | 3300041460 | Ga0451802_1093250 | Ga0451802_1093250_547_807 | 83 |
| 47 | 3300041486 | Ga0451807_0874893 | Ga0451807_0874893_231_488 | 83 |
| 48 | 3300041505 | Ga0451849_0521996 | Ga0451849_0521996_999_1256 | 83 |
| 49 | 3300041507 | Ga0451851_1334134 | Ga0451851_1334134_397_654 | 83 |
| 50 | 3300041512 | Ga0451853_0724937 | Ga0451853_0724937_47_304 | 83 |
| 51 | 3300041512 | Ga0451853_2398176 | Ga0451853_2398176_125_391 | 83 |
| 52 | 3300044706 | Ga0466964_0085184 | Ga0466964_0085184_412_669 | 83 |
| 53 | 3300045976 | Ga0466967_1979102 | Ga0466967_1979102_66_323 | 83 |
| 54 | 3300049539 | Ga0501323_019456 | Ga0501323_019456_562_834 | 83 |
| 55 | 3300049652 | Ga0501202_061324 | Ga0501202_061324_150_422 | 83 |
| 56 | 3300049670 | Ga0501236_001209 | Ga0501236_001209_966_1238 | 83 |
| 57 | 3300049761 | Ga0501264_002656 | Ga0501264_002656_473_745 | 83 |
| 58 | 3300050509 | nmdc:mga0qj67_50936_c1 | nmdc:mga0qj67_50936_c1_1316_1573 | 83 |
| 59 | 3300050510 | nmdc:mga06r32_983902_c1 | nmdc:mga06r32_983902_c1_354_611 | 83 |
| 60 | 3300050511 | nmdc:mga08y16_22038_c1 | nmdc:mga08y16_22038_c1_3834_4091 | 83 |
| 61 | 3300050511 | nmdc:mga08y16_22108_c1 | nmdc:mga08y16_22108_c1_2935_3192 | 83 |
| 62 | 3300053108 | Ga0500562_086968 | Ga0500562_086968_281_538 | 83 |
| 63 | 3300053133 | Ga0500655_031304 | Ga0500655_031304_538_795 | 83 |
| 64 | 3300053134 | Ga0500658_0250366 | Ga0500658_0250366_438_692 | 83 |
| 65 | 3300053151 | Ga0500604_0001406 | Ga0500604_0001406_5840_6112 | 83 |
| 66 | 3300053156 | Ga0500622_0000012 | Ga0500622_0000012_4506_4778 | 83 |
| 67 | 3300053156 | Ga0500622_0000030 | Ga0500622_0000030_4476_4733 | 83 |
| 68 | 3300053156 | Ga0500622_0012337 | Ga0500622_0012337_2548_2820 | 83 |
| 69 | 3300053158 | Ga0500627_0066865 | Ga0500627_0066865_16_273 | 83 |
| 70 | 3300003320 | rootH2_10001223 | rootH2_10001223122 | 84 |
| 71 | 3300005344 | Ga0070661_100578755 | Ga0070661_1005787552 | 84 |
| 72 | 3300005614 | Ga0068856_100010896 | Ga0068856_1000108962 | 84 |
| 73 | 3300006353 | Ga0075370_10596015 | Ga0075370_105960152 | 84 |
| 74 | 3300014326 | Ga0157380_10000046 | Ga0157380_1000004645 | 84 |
| 75 | 3300025250 | Ga0209026_1000226 | Ga0209026_100022632 | 84 |
| 76 | 3300025920 | Ga0207649_11356511 | Ga0207649_113565111 | 84 |
| 77 | 3300026078 | Ga0207702_10029754 | Ga0207702_100297547 | 84 |
| 78 | 3300031649 | Ga0307514_10051268 | Ga0307514_100512683 | 84 |
| 79 | 3300044712 | Ga0453684_0748735 | Ga0453684_0748735_225_479 | 84 |
| 80 | 3300046616 | Ga0495668_0198463 | Ga0495668_0198463_74_328 | 84 |
| 81 | 3300050496 | nmdc:mga07m45_548033_c1 | nmdc:mga07m45_548033_c1_228_482 | 84 |
| 82 | 2088090002 | CNA_F7QKVOU01BIBUY | CNA_00870220 | 85 |
| 83 | 2162886012 | MBSR1b_contig_1436207 | MBSR1b_0079.00005080 | 85 |
| 84 | 3300001979 | JGI24740J21852_10080703 | JGI24740J21852_100807032 | 85 |
| 85 | 3300001990 | JGI24737J22298_10000148 | JGI24737J22298_100001482 | 85 |
| 86 | 3300002067 | JGI24735J21928_10000020 | JGI24735J21928_1000002058 | 85 |
| 87 | 3300003320 | rootH2_10340990 | rootH2_103409902 | 85 |
| 88 | 3300003322 | rootL2_10021639 | rootL2_100216393 | 85 |
| 89 | 3300003323 | rootH1_10027970 | rootH1_100279703 | 85 |
| 90 | 3300005288 | Ga0065714_10003718 | Ga0065714_100037189 | 85 |
| 91 | 3300005288 | Ga0065714_10076271 | Ga0065714_100762713 | 85 |
| 92 | 3300005288 | Ga0065714_10263545 | Ga0065714_102635452 | 85 |
| 93 | 3300005288 | Ga0065714_10400664 | Ga0065714_104006642 | 85 |
| 94 | 3300005289 | Ga0065704_10302631 | Ga0065704_103026312 | 85 |
| 95 | 3300005295 | Ga0065707_10255691 | Ga0065707_102556912 | 85 |
| 96 | 3300005327 | Ga0070658_10104568 | Ga0070658_101045683 | 85 |
| 97 | 3300005327 | Ga0070658_10367116 | Ga0070658_103671162 | 85 |
| 98 | 3300005328 | Ga0070676_10000231 | Ga0070676_1000023117 | 85 |
| 99 | 3300005328 | Ga0070676_10743144 | Ga0070676_107431442 | 85 |
| 100 | 3300005334 | Ga0068869_100002049 | Ga0068869_1000020497 | 85 |
| 101 | 3300005334 | Ga0068869_100157523 | Ga0068869_1001575232 | 85 |
| 102 | 3300005334 | Ga0068869_100366804 | Ga0068869_1003668042 | 85 |
| 103 | 3300005334 | Ga0068869_100557167 | Ga0068869_1005571672 | 85 |
| 104 | 3300005334 | Ga0068869_101151799 | Ga0068869_1011517992 | 85 |
| 105 | 3300005335 | Ga0070666_10000078 | Ga0070666_1000007824 | 85 |
| 106 | 3300005335 | Ga0070666_10980979 | Ga0070666_109809792 | 85 |
| 107 | 3300005338 | Ga0068868_100008072 | Ga0068868_1000080724 | 85 |
| 108 | 3300005338 | Ga0068868_100028945 | Ga0068868_1000289455 | 85 |
| 109 | 3300005338 | Ga0068868_100106199 | Ga0068868_1001061993 | 85 |
| 110 | 3300005338 | Ga0068868_100249591 | Ga0068868_1002495912 | 85 |
| 111 | 3300005338 | Ga0068868_100816863 | Ga0068868_1008168631 | 85 |
| 112 | 3300005338 | Ga0068868_101398951 | Ga0068868_1013989512 | 85 |
| 113 | 3300005340 | Ga0070689_100521400 | Ga0070689_1005214002 | 85 |
| 114 | 3300005343 | Ga0070687_100862824 | Ga0070687_1008628242 | 85 |
| 115 | 3300005344 | Ga0070661_101268405 | Ga0070661_1012684052 | 85 |
| 116 | 3300005344 | Ga0070661_101559674 | Ga0070661_1015596741 | 85 |
| 117 | 3300005347 | Ga0070668_100081121 | Ga0070668_1000811212 | 85 |
| 118 | 3300005347 | Ga0070668_100633423 | Ga0070668_1006334232 | 85 |
| 119 | 3300005347 | Ga0070668_101051238 | Ga0070668_1010512382 | 85 |
| 120 | 3300005354 | Ga0070675_100175229 | Ga0070675_1001752291 | 85 |
| 121 | 3300005354 | Ga0070675_100192214 | Ga0070675_1001922142 | 85 |
| 122 | 3300005354 | Ga0070675_101036663 | Ga0070675_1010366631 | 85 |
| 123 | 3300005355 | Ga0070671_100061553 | Ga0070671_1000615535 | 85 |
| 124 | 3300005355 | Ga0070671_100134878 | Ga0070671_1001348782 | 85 |
| 125 | 3300005355 | Ga0070671_100143560 | Ga0070671_1001435602 | 85 |
| 126 | 3300005355 | Ga0070671_100149624 | Ga0070671_1001496242 | 85 |
| 127 | 3300005356 | Ga0070674_100282843 | Ga0070674_1002828432 | 85 |
| 128 | 3300005356 | Ga0070674_101264134 | Ga0070674_1012641341 | 85 |
| 129 | 3300005364 | Ga0070673_100018285 | Ga0070673_1000182854 | 85 |
| 130 | 3300005364 | Ga0070673_100062741 | Ga0070673_1000627412 | 85 |
| 131 | 3300005364 | Ga0070673_100073158 | Ga0070673_1000731583 | 85 |
| 132 | 3300005364 | Ga0070673_100493944 | Ga0070673_1004939442 | 85 |
| 133 | 3300005364 | Ga0070673_102281815 | Ga0070673_1022818152 | 85 |
| 134 | 3300005365 | Ga0070688_100057899 | Ga0070688_1000578994 | 85 |
| 135 | 3300005365 | Ga0070688_101316324 | Ga0070688_1013163241 | 85 |
| 136 | 3300005365 | Ga0070688_101739910 | Ga0070688_1017399102 | 85 |
| 137 | 3300005367 | Ga0070667_100011803 | Ga0070667_1000118032 | 85 |
| 138 | 3300005367 | Ga0070667_100026421 | Ga0070667_1000264213 | 85 |
| 139 | 3300005367 | Ga0070667_100087311 | Ga0070667_1000873111 | 85 |
| 140 | 3300005367 | Ga0070667_100743791 | Ga0070667_1007437912 | 85 |
| 141 | 3300005367 | Ga0070667_100822763 | Ga0070667_1008227632 | 85 |
| 142 | 3300005367 | Ga0070667_101514261 | Ga0070667_1015142611 | 85 |
| 143 | 3300005441 | Ga0070700_100141012 | Ga0070700_1001410122 | 85 |
| 144 | 3300005441 | Ga0070700_100148338 | Ga0070700_1001483382 | 85 |
| 145 | 3300005455 | Ga0070663_100364896 | Ga0070663_1003648962 | 85 |
| 146 | 3300005455 | Ga0070663_100673765 | Ga0070663_1006737652 | 85 |
| 147 | 3300005456 | Ga0070678_100189429 | Ga0070678_1001894293 | 85 |
| 148 | 3300005456 | Ga0070678_100393105 | Ga0070678_1003931052 | 85 |
| 149 | 3300005456 | Ga0070678_100789775 | Ga0070678_1007897752 | 85 |
| 150 | 3300005457 | Ga0070662_100331851 | Ga0070662_1003318512 | 85 |
| 151 | 3300005459 | Ga0068867_100000586 | Ga0068867_10000058619 | 85 |
| 152 | 3300005459 | Ga0068867_100180724 | Ga0068867_1001807243 | 85 |
| 153 | 3300005459 | Ga0068867_100590481 | Ga0068867_1005904812 | 85 |
| 154 | 3300005459 | Ga0068867_101964633 | Ga0068867_1019646331 | 85 |
| 155 | 3300005466 | Ga0070685_10013986 | Ga0070685_100139862 | 85 |
| 156 | 3300005466 | Ga0070685_10800480 | Ga0070685_108004801 | 85 |
| 157 | 3300005466 | Ga0070685_10821806 | Ga0070685_108218061 | 85 |
| 158 | 3300005466 | Ga0070685_11113106 | Ga0070685_111131061 | 85 |
| 159 | 3300005530 | Ga0070679_100147590 | Ga0070679_1001475902 | 85 |
| 160 | 3300005539 | Ga0068853_100007787 | Ga0068853_1000077879 | 85 |
| 161 | 3300005539 | Ga0068853_100013770 | Ga0068853_1000137709 | 85 |
| 162 | 3300005539 | Ga0068853_100091439 | Ga0068853_1000914394 | 85 |
| 163 | 3300005539 | Ga0068853_100163124 | Ga0068853_1001631243 | 85 |
| 164 | 3300005543 | Ga0070672_100102064 | Ga0070672_1001020642 | 85 |
| 165 | 3300005543 | Ga0070672_100223214 | Ga0070672_1002232142 | 85 |
| 166 | 3300005543 | Ga0070672_100261544 | Ga0070672_1002615442 | 85 |
| 167 | 3300005543 | Ga0070672_100330760 | Ga0070672_1003307601 | 85 |
| 168 | 3300005543 | Ga0070672_100801359 | Ga0070672_1008013592 | 85 |
| 169 | 3300005548 | Ga0070665_101761329 | Ga0070665_1017613291 | 85 |
| 170 | 3300005563 | Ga0068855_100053370 | Ga0068855_1000533703 | 85 |
| 171 | 3300005563 | Ga0068855_100061731 | Ga0068855_1000617313 | 85 |
| 172 | 3300005577 | Ga0068857_100059756 | Ga0068857_1000597562 | 85 |
| 173 | 3300005577 | Ga0068857_101986428 | Ga0068857_1019864281 | 85 |
| 174 | 3300005578 | Ga0068854_100130757 | Ga0068854_1001307572 | 85 |
| 175 | 3300005578 | Ga0068854_100293820 | Ga0068854_1002938202 | 85 |
| 176 | 3300005578 | Ga0068854_100421874 | Ga0068854_1004218742 | 85 |
| 177 | 3300005614 | Ga0068856_100003542 | Ga0068856_10000354219 | 85 |
| 178 | 3300005614 | Ga0068856_101259362 | Ga0068856_1012593622 | 85 |
| 179 | 3300005614 | Ga0068856_101888544 | Ga0068856_1018885442 | 85 |
| 180 | 3300005616 | Ga0068852_100000614 | Ga0068852_1000006149 | 85 |
| 181 | 3300005616 | Ga0068852_100002267 | Ga0068852_1000022674 | 85 |
| 182 | 3300005616 | Ga0068852_100693104 | Ga0068852_1006931042 | 85 |
| 183 | 3300005616 | Ga0068852_101397974 | Ga0068852_1013979741 | 85 |
| 184 | 3300005616 | Ga0068852_102302514 | Ga0068852_1023025141 | 85 |
| 185 | 3300005617 | Ga0068859_100000003 | Ga0068859_100000003260 | 85 |
| 186 | 3300005617 | Ga0068859_100018877 | Ga0068859_1000188771 | 85 |
| 187 | 3300005617 | Ga0068859_100081374 | Ga0068859_1000813743 | 85 |
| 188 | 3300005617 | Ga0068859_100204161 | Ga0068859_1002041612 | 85 |
| 189 | 3300005617 | Ga0068859_100336376 | Ga0068859_1003363763 | 85 |
| 190 | 3300005617 | Ga0068859_101044336 | Ga0068859_1010443362 | 85 |
| 191 | 3300005618 | Ga0068864_100003917 | Ga0068864_1000039174 | 85 |
| 192 | 3300005618 | Ga0068864_100167138 | Ga0068864_1001671382 | 85 |
| 193 | 3300005618 | Ga0068864_100308683 | Ga0068864_1003086832 | 85 |
| 194 | 3300005618 | Ga0068864_101851077 | Ga0068864_1018510772 | 85 |
| 195 | 3300005718 | Ga0068866_10001781 | Ga0068866_100017816 | 85 |
| 196 | 3300005718 | Ga0068866_10173086 | Ga0068866_101730861 | 85 |
| 197 | 3300005719 | Ga0068861_101452453 | Ga0068861_1014524532 | 85 |
| 198 | 3300005719 | Ga0068861_102162576 | Ga0068861_1021625762 | 85 |
| 199 | 3300005834 | Ga0068851_10028995 | Ga0068851_100289952 | 85 |
| 200 | 3300005834 | Ga0068851_10082916 | Ga0068851_100829162 | 85 |
| 201 | 3300005834 | Ga0068851_10099533 | Ga0068851_100995332 | 85 |
| 202 | 3300005834 | Ga0068851_10578827 | Ga0068851_105788272 | 85 |
| 203 | 3300005841 | Ga0068863_100006890 | Ga0068863_1000068908 | 85 |
| 204 | 3300005841 | Ga0068863_100265284 | Ga0068863_1002652842 | 85 |
| 205 | 3300005841 | Ga0068863_100441702 | Ga0068863_1004417022 | 85 |
| 206 | 3300005841 | Ga0068863_101311389 | Ga0068863_1013113892 | 85 |
| 207 | 3300005841 | Ga0068863_101565280 | Ga0068863_1015652802 | 85 |
| 208 | 3300005841 | Ga0068863_102043464 | Ga0068863_1020434642 | 85 |
| 209 | 3300005842 | Ga0068858_100002816 | Ga0068858_1000028162 | 85 |
| 210 | 3300005842 | Ga0068858_101406486 | Ga0068858_1014064862 | 85 |
| 211 | 3300005843 | Ga0068860_100002009 | Ga0068860_1000020099 | 85 |
| 212 | 3300005843 | Ga0068860_100007756 | Ga0068860_10000775611 | 85 |
| 213 | 3300005843 | Ga0068860_100016973 | Ga0068860_1000169735 | 85 |
| 214 | 3300005843 | Ga0068860_100704279 | Ga0068860_1007042791 | 85 |
| 215 | 3300005843 | Ga0068860_101019895 | Ga0068860_1010198952 | 85 |
| 216 | 3300005843 | Ga0068860_102051766 | Ga0068860_1020517662 | 85 |
| 217 | 3300005844 | Ga0068862_100133101 | Ga0068862_1001331012 | 85 |
| 218 | 3300005844 | Ga0068862_101787858 | Ga0068862_1017878581 | 85 |
| 219 | 3300006186 | Ga0075369_10341444 | Ga0075369_103414442 | 85 |
| 220 | 3300006195 | Ga0075366_10000091 | Ga0075366_1000009116 | 85 |
| 221 | 3300006195 | Ga0075366_10000091 | Ga0075366_1000009128 | 85 |
| 222 | 3300006195 | Ga0075366_10092113 | Ga0075366_100921132 | 85 |
| 223 | 3300006237 | Ga0097621_100000777 | Ga0097621_1000007776 | 85 |
| 224 | 3300006237 | Ga0097621_100001974 | Ga0097621_10000197418 | 85 |
| 225 | 3300006237 | Ga0097621_100143444 | Ga0097621_1001434442 | 85 |
| 226 | 3300006237 | Ga0097621_100738492 | Ga0097621_1007384922 | 85 |
| 227 | 3300006237 | Ga0097621_100894428 | Ga0097621_1008944282 | 85 |
| 228 | 3300006237 | Ga0097621_101036554 | Ga0097621_1010365541 | 85 |
| 229 | 3300006358 | Ga0068871_100000154 | Ga0068871_10000015421 | 85 |
| 230 | 3300006358 | Ga0068871_100074646 | Ga0068871_1000746465 | 85 |
| 231 | 3300006358 | Ga0068871_100180249 | Ga0068871_1001802492 | 85 |
| 232 | 3300006358 | Ga0068871_101179246 | Ga0068871_1011792462 | 85 |
| 233 | 3300006358 | Ga0068871_101388425 | Ga0068871_1013884251 | 85 |
| 234 | 3300006358 | Ga0068871_101849478 | Ga0068871_1018494782 | 85 |
| 235 | 3300006881 | Ga0068865_100000172 | Ga0068865_10000017220 | 85 |
| 236 | 3300006881 | Ga0068865_100182295 | Ga0068865_1001822952 | 85 |
| 237 | 3300006881 | Ga0068865_100253168 | Ga0068865_1002531682 | 85 |
| 238 | 3300006881 | Ga0068865_101536913 | Ga0068865_1015369132 | 85 |
| 239 | 3300006931 | Ga0097620_100000003 | Ga0097620_100000003260 | 85 |
| 240 | 3300006931 | Ga0097620_100018877 | Ga0097620_1000188771 | 85 |
| 241 | 3300006931 | Ga0097620_100081377 | Ga0097620_1000813773 | 85 |
| 242 | 3300006931 | Ga0097620_100204160 | Ga0097620_1002041602 | 85 |
| 243 | 3300006931 | Ga0097620_100336379 | Ga0097620_1003363793 | 85 |
| 244 | 3300006931 | Ga0097620_101044479 | Ga0097620_1010444792 | 85 |
| 245 | 3300009093 | Ga0105240_11649717 | Ga0105240_116497172 | 85 |
| 246 | 3300009093 | Ga0105240_11863377 | Ga0105240_118633772 | 85 |
| 247 | 3300009093 | Ga0105240_12443212 | Ga0105240_124432122 | 85 |
| 248 | 3300009094 | Ga0111539_10342300 | Ga0111539_103423002 | 85 |
| 249 | 3300009094 | Ga0111539_11365601 | Ga0111539_113656012 | 85 |
| 250 | 3300009098 | Ga0105245_10504692 | Ga0105245_105046922 | 85 |
| 251 | 3300009098 | Ga0105245_10714983 | Ga0105245_107149832 | 85 |
| 252 | 3300009101 | Ga0105247_10001017 | Ga0105247_1000101716 | 85 |
| 253 | 3300009101 | Ga0105247_10402581 | Ga0105247_104025812 | 85 |
| 254 | 3300009101 | Ga0105247_10823230 | Ga0105247_108232302 | 85 |
| 255 | 3300009148 | Ga0105243_10207292 | Ga0105243_102072922 | 85 |
| 256 | 3300009148 | Ga0105243_10618732 | Ga0105243_106187322 | 85 |
| 257 | 3300009148 | Ga0105243_12410793 | Ga0105243_124107931 | 85 |
| 258 | 3300009174 | Ga0105241_10000847 | Ga0105241_1000084727 | 85 |
| 259 | 3300009174 | Ga0105241_10013980 | Ga0105241_100139808 | 85 |
| 260 | 3300009174 | Ga0105241_10374406 | Ga0105241_103744062 | 85 |
| 261 | 3300009174 | Ga0105241_12369509 | Ga0105241_123695092 | 85 |
| 262 | 3300009176 | Ga0105242_10020115 | Ga0105242_100201154 | 85 |
| 263 | 3300009176 | Ga0105242_10083586 | Ga0105242_100835862 | 85 |
| 264 | 3300009176 | Ga0105242_10104661 | Ga0105242_101046613 | 85 |
| 265 | 3300009176 | Ga0105242_10784764 | Ga0105242_107847642 | 85 |
| 266 | 3300009176 | Ga0105242_12137198 | Ga0105242_121371981 | 85 |
| 267 | 3300009176 | Ga0105242_12147183 | Ga0105242_121471832 | 85 |
| 268 | 3300009177 | Ga0105248_10497438 | Ga0105248_104974382 | 85 |
| 269 | 3300009545 | Ga0105237_10001395 | Ga0105237_1000139533 | 85 |
| 270 | 3300009545 | Ga0105237_10001455 | Ga0105237_1000145524 | 85 |
| 271 | 3300009545 | Ga0105237_10466611 | Ga0105237_104666112 | 85 |
| 272 | 3300009545 | Ga0105237_12399183 | Ga0105237_123991831 | 85 |
| 273 | 3300009545 | Ga0105237_12767060 | Ga0105237_127670601 | 85 |
| 274 | 3300009551 | Ga0105238_10596424 | Ga0105238_105964242 | 85 |
| 275 | 3300009551 | Ga0105238_11200254 | Ga0105238_112002542 | 85 |
| 276 | 3300009551 | Ga0105238_11568767 | Ga0105238_115687672 | 85 |
| 277 | 3300009553 | Ga0105249_10005639 | Ga0105249_100056398 | 85 |
| 278 | 3300009553 | Ga0105249_10687441 | Ga0105249_106874412 | 85 |
| 279 | 3300009553 | Ga0105249_12597274 | Ga0105249_125972741 | 85 |
| 280 | 3300009553 | Ga0105249_12642204 | Ga0105249_126422041 | 85 |
| 281 | 3300010375 | Ga0105239_10054410 | Ga0105239_100544102 | 85 |
| 282 | 3300010375 | Ga0105239_10064333 | Ga0105239_100643332 | 85 |
| 283 | 3300010375 | Ga0105239_10160641 | Ga0105239_101606413 | 85 |
| 284 | 3300010375 | Ga0105239_10176462 | Ga0105239_101764624 | 85 |
| 285 | 3300010375 | Ga0105239_10513044 | Ga0105239_105130442 | 85 |
| 286 | 3300011119 | Ga0105246_10087476 | Ga0105246_100874763 | 85 |
| 287 | 3300011119 | Ga0105246_10291745 | Ga0105246_102917452 | 85 |
| 288 | 3300013102 | Ga0157371_10042159 | Ga0157371_100421593 | 85 |
| 289 | 3300013104 | Ga0157370_10231082 | Ga0157370_102310822 | 85 |
| 290 | 3300013104 | Ga0157370_10399185 | Ga0157370_103991852 | 85 |
| 291 | 3300013104 | Ga0157370_10914332 | Ga0157370_109143322 | 85 |
| 292 | 3300013104 | Ga0157370_11278688 | Ga0157370_112786882 | 85 |
| 293 | 3300013105 | Ga0157369_10185088 | Ga0157369_101850882 | 85 |
| 294 | 3300013296 | Ga0157374_10000849 | Ga0157374_1000084917 | 85 |
| 295 | 3300013296 | Ga0157374_10131243 | Ga0157374_101312432 | 85 |
| 296 | 3300013296 | Ga0157374_10211921 | Ga0157374_102119212 | 85 |
| 297 | 3300013296 | Ga0157374_10294586 | Ga0157374_102945862 | 85 |
| 298 | 3300013296 | Ga0157374_10388546 | Ga0157374_103885462 | 85 |
| 299 | 3300013296 | Ga0157374_11134958 | Ga0157374_111349581 | 85 |
| 300 | 3300013296 | Ga0157374_11256376 | Ga0157374_112563762 | 85 |
| 301 | 3300013297 | Ga0157378_10007598 | Ga0157378_100075982 | 85 |
| 302 | 3300013297 | Ga0157378_10038908 | Ga0157378_100389082 | 85 |
| 303 | 3300013297 | Ga0157378_10080319 | Ga0157378_100803191 | 85 |
| 304 | 3300013297 | Ga0157378_10158378 | Ga0157378_101583782 | 85 |
| 305 | 3300013297 | Ga0157378_10617202 | Ga0157378_106172022 | 85 |
| 306 | 3300013297 | Ga0157378_11732384 | Ga0157378_117323841 | 85 |
| 307 | 3300013297 | Ga0157378_13032038 | Ga0157378_130320381 | 85 |
| 308 | 3300013306 | Ga0163162_10000361 | Ga0163162_100003612 | 85 |
| 309 | 3300013306 | Ga0163162_10000568 | Ga0163162_100005684 | 85 |
| 310 | 3300013306 | Ga0163162_10061419 | Ga0163162_100614192 | 85 |
| 311 | 3300013306 | Ga0163162_10065676 | Ga0163162_100656762 | 85 |
| 312 | 3300013306 | Ga0163162_10172866 | Ga0163162_101728663 | 85 |
| 313 | 3300013306 | Ga0163162_10456307 | Ga0163162_104563072 | 85 |
| 314 | 3300013306 | Ga0163162_10593971 | Ga0163162_105939712 | 85 |
| 315 | 3300013306 | Ga0163162_10775708 | Ga0163162_107757082 | 85 |
| 316 | 3300013306 | Ga0163162_11239030 | Ga0163162_112390302 | 85 |
| 317 | 3300013306 | Ga0163162_11905804 | Ga0163162_119058041 | 85 |
| 318 | 3300013307 | Ga0157372_10001279 | Ga0157372_100012793 | 85 |
| 319 | 3300013307 | Ga0157372_10027329 | Ga0157372_100273298 | 85 |
| 320 | 3300013307 | Ga0157372_11032845 | Ga0157372_110328452 | 85 |
| 321 | 3300013308 | Ga0157375_10003003 | Ga0157375_1000300312 | 85 |
| 322 | 3300013308 | Ga0157375_10239294 | Ga0157375_102392941 | 85 |
| 323 | 3300013308 | Ga0157375_10309110 | Ga0157375_103091103 | 85 |
| 324 | 3300013308 | Ga0157375_10364905 | Ga0157375_103649052 | 85 |
| 325 | 3300013308 | Ga0157375_11184975 | Ga0157375_111849752 | 85 |
| 326 | 3300013308 | Ga0157375_11283565 | Ga0157375_112835652 | 85 |
| 327 | 3300013308 | Ga0157375_13342079 | Ga0157375_133420791 | 85 |
| 328 | 3300014325 | Ga0163163_10086565 | Ga0163163_100865651 | 85 |
| 329 | 3300014325 | Ga0163163_10098735 | Ga0163163_100987352 | 85 |
| 330 | 3300014325 | Ga0163163_10623390 | Ga0163163_106233902 | 85 |
| 331 | 3300014325 | Ga0163163_11095282 | Ga0163163_110952822 | 85 |
| 332 | 3300014325 | Ga0163163_12098616 | Ga0163163_120986161 | 85 |
| 333 | 3300014325 | Ga0163163_12139922 | Ga0163163_121399222 | 85 |
| 334 | 3300014326 | Ga0157380_10009471 | Ga0157380_100094716 | 85 |
| 335 | 3300014326 | Ga0157380_10591603 | Ga0157380_105916032 | 85 |
| 336 | 3300014326 | Ga0157380_10794307 | Ga0157380_107943072 | 85 |
| 337 | 3300014326 | Ga0157380_12417229 | Ga0157380_124172292 | 85 |
| 338 | 3300014326 | Ga0157380_13310532 | Ga0157380_133105322 | 85 |
| 339 | 3300014745 | Ga0157377_10540315 | Ga0157377_105403151 | 85 |
| 340 | 3300014745 | Ga0157377_10561183 | Ga0157377_105611832 | 85 |
| 341 | 3300014745 | Ga0157377_10759002 | Ga0157377_107590021 | 85 |
| 342 | 3300014968 | Ga0157379_10123204 | Ga0157379_101232042 | 85 |
| 343 | 3300014968 | Ga0157379_10245139 | Ga0157379_102451392 | 85 |
| 344 | 3300014968 | Ga0157379_11535403 | Ga0157379_115354031 | 85 |
| 345 | 3300014968 | Ga0157379_12131652 | Ga0157379_121316522 | 85 |
| 346 | 3300014969 | Ga0157376_10082731 | Ga0157376_100827313 | 85 |
| 347 | 3300014969 | Ga0157376_10319822 | Ga0157376_103198223 | 85 |
| 348 | 3300014969 | Ga0157376_11329550 | Ga0157376_113295502 | 85 |
| 349 | 3300014969 | Ga0157376_12037201 | Ga0157376_120372012 | 85 |
| 350 | 3300017792 | Ga0163161_10222185 | Ga0163161_102221852 | 85 |
| 351 | 3300017792 | Ga0163161_11763991 | Ga0163161_117639912 | 85 |
| 352 | 3300020077 | Ga0206351_10503684 | Ga0206351_105036842 | 85 |
| 353 | 3300025242 | Ga0209258_128797 | Ga0209258_1287972 | 85 |
| 354 | 3300025321 | Ga0207656_10018556 | Ga0207656_100185562 | 85 |
| 355 | 3300025321 | Ga0207656_10018811 | Ga0207656_100188112 | 85 |
| 356 | 3300025321 | Ga0207656_10400381 | Ga0207656_104003811 | 85 |
| 357 | 3300025321 | Ga0207656_10593079 | Ga0207656_105930792 | 85 |
| 358 | 3300025893 | Ga0207682_10191800 | Ga0207682_101918001 | 85 |
| 359 | 3300025893 | Ga0207682_10205562 | Ga0207682_102055622 | 85 |
| 360 | 3300025893 | Ga0207682_10541329 | Ga0207682_105413291 | 85 |
| 361 | 3300025899 | Ga0207642_10254681 | Ga0207642_102546812 | 85 |
| 362 | 3300025900 | Ga0207710_10021990 | Ga0207710_100219903 | 85 |
| 363 | 3300025900 | Ga0207710_10222228 | Ga0207710_102222282 | 85 |
| 364 | 3300025901 | Ga0207688_10815651 | Ga0207688_108156512 | 85 |
| 365 | 3300025903 | Ga0207680_10000102 | Ga0207680_1000010242 | 85 |
| 366 | 3300025903 | Ga0207680_11196778 | Ga0207680_111967782 | 85 |
| 367 | 3300025904 | Ga0207647_10028556 | Ga0207647_100285562 | 85 |
| 368 | 3300025904 | Ga0207647_10247553 | Ga0207647_102475531 | 85 |
| 369 | 3300025904 | Ga0207647_10430505 | Ga0207647_104305052 | 85 |
| 370 | 3300025907 | Ga0207645_10000146 | Ga0207645_1000014627 | 85 |
| 371 | 3300025907 | Ga0207645_10627096 | Ga0207645_106270962 | 85 |
| 372 | 3300025907 | Ga0207645_10672470 | Ga0207645_106724702 | 85 |
| 373 | 3300025909 | Ga0207705_10373636 | Ga0207705_103736362 | 85 |
| 374 | 3300025911 | Ga0207654_10010768 | Ga0207654_100107685 | 85 |
| 375 | 3300025911 | Ga0207654_10023238 | Ga0207654_100232382 | 85 |
| 376 | 3300025911 | Ga0207654_10968169 | Ga0207654_109681691 | 85 |
| 377 | 3300025913 | Ga0207695_11317652 | Ga0207695_113176522 | 85 |
| 378 | 3300025914 | Ga0207671_10007457 | Ga0207671_100074575 | 85 |
| 379 | 3300025914 | Ga0207671_10194657 | Ga0207671_101946572 | 85 |
| 380 | 3300025920 | Ga0207649_11069273 | Ga0207649_110692732 | 85 |
| 381 | 3300025920 | Ga0207649_11118181 | Ga0207649_111181812 | 85 |
| 382 | 3300025921 | Ga0207652_11064618 | Ga0207652_110646182 | 85 |
| 383 | 3300025923 | Ga0207681_10505150 | Ga0207681_105051502 | 85 |
| 384 | 3300025923 | Ga0207681_10658458 | Ga0207681_106584582 | 85 |
| 385 | 3300025924 | Ga0207694_10009457 | Ga0207694_100094572 | 85 |
| 386 | 3300025925 | Ga0207650_10036252 | Ga0207650_100362523 | 85 |
| 387 | 3300025925 | Ga0207650_10087490 | Ga0207650_100874902 | 85 |
| 388 | 3300025925 | Ga0207650_10292844 | Ga0207650_102928442 | 85 |
| 389 | 3300025925 | Ga0207650_11394195 | Ga0207650_113941952 | 85 |
| 390 | 3300025925 | Ga0207650_11538583 | Ga0207650_115385831 | 85 |
| 391 | 3300025926 | Ga0207659_10107535 | Ga0207659_101075354 | 85 |
| 392 | 3300025926 | Ga0207659_10820061 | Ga0207659_108200612 | 85 |
| 393 | 3300025927 | Ga0207687_10534911 | Ga0207687_105349112 | 85 |
| 394 | 3300025927 | Ga0207687_10919561 | Ga0207687_109195611 | 85 |
| 395 | 3300025931 | Ga0207644_10021819 | Ga0207644_100218196 | 85 |
| 396 | 3300025931 | Ga0207644_10043479 | Ga0207644_100434794 | 85 |
| 397 | 3300025931 | Ga0207644_10086484 | Ga0207644_100864843 | 85 |
| 398 | 3300025933 | Ga0207706_10226838 | Ga0207706_102268383 | 85 |
| 399 | 3300025934 | Ga0207686_10097460 | Ga0207686_100974602 | 85 |
| 400 | 3300025934 | Ga0207686_10188577 | Ga0207686_101885772 | 85 |
| 401 | 3300025934 | Ga0207686_10329227 | Ga0207686_103292272 | 85 |
| 402 | 3300025935 | Ga0207709_10218997 | Ga0207709_102189972 | 85 |
| 403 | 3300025937 | Ga0207669_11463752 | Ga0207669_114637522 | 85 |
| 404 | 3300025938 | Ga0207704_10000205 | Ga0207704_1000020510 | 85 |
| 405 | 3300025938 | Ga0207704_10131108 | Ga0207704_101311082 | 85 |
| 406 | 3300025938 | Ga0207704_11356321 | Ga0207704_113563211 | 85 |
| 407 | 3300025940 | Ga0207691_10120725 | Ga0207691_101207253 | 85 |
| 408 | 3300025940 | Ga0207691_10128331 | Ga0207691_101283313 | 85 |
| 409 | 3300025940 | Ga0207691_10178850 | Ga0207691_101788502 | 85 |
| 410 | 3300025940 | Ga0207691_10286780 | Ga0207691_102867802 | 85 |
| 411 | 3300025942 | Ga0207689_10003994 | Ga0207689_1000399413 | 85 |
| 412 | 3300025942 | Ga0207689_10205674 | Ga0207689_102056742 | 85 |
| 413 | 3300025945 | Ga0207679_10738451 | Ga0207679_107384512 | 85 |
| 414 | 3300025945 | Ga0207679_11225023 | Ga0207679_112250232 | 85 |
| 415 | 3300025949 | Ga0207667_10070023 | Ga0207667_100700232 | 85 |
| 416 | 3300025949 | Ga0207667_10438577 | Ga0207667_104385772 | 85 |
| 417 | 3300025949 | Ga0207667_11250387 | Ga0207667_112503872 | 85 |
| 418 | 3300025960 | Ga0207651_10042253 | Ga0207651_100422533 | 85 |
| 419 | 3300025960 | Ga0207651_10214971 | Ga0207651_102149713 | 85 |
| 420 | 3300025960 | Ga0207651_10663007 | Ga0207651_106630072 | 85 |
| 421 | 3300025960 | Ga0207651_12028967 | Ga0207651_120289672 | 85 |
| 422 | 3300025961 | Ga0207712_10001952 | Ga0207712_100019524 | 85 |
| 423 | 3300025961 | Ga0207712_10101960 | Ga0207712_101019604 | 85 |
| 424 | 3300025961 | Ga0207712_10247582 | Ga0207712_102475821 | 85 |
| 425 | 3300025961 | Ga0207712_11651169 | Ga0207712_116511691 | 85 |
| 426 | 3300025972 | Ga0207668_10147319 | Ga0207668_101473192 | 85 |
| 427 | 3300025972 | Ga0207668_10252846 | Ga0207668_102528462 | 85 |
| 428 | 3300025972 | Ga0207668_11459364 | Ga0207668_114593642 | 85 |
| 429 | 3300025981 | Ga0207640_10264593 | Ga0207640_102645932 | 85 |
| 430 | 3300025986 | Ga0207658_10024854 | Ga0207658_100248544 | 85 |
| 431 | 3300025986 | Ga0207658_10059050 | Ga0207658_100590504 | 85 |
| 432 | 3300025986 | Ga0207658_10075189 | Ga0207658_100751892 | 85 |
| 433 | 3300025986 | Ga0207658_10473783 | Ga0207658_104737832 | 85 |
| 434 | 3300025986 | Ga0207658_11194764 | Ga0207658_111947642 | 85 |
| 435 | 3300026023 | Ga0207677_10002126 | Ga0207677_100021266 | 85 |
| 436 | 3300026023 | Ga0207677_10043214 | Ga0207677_100432143 | 85 |
| 437 | 3300026023 | Ga0207677_10192782 | Ga0207677_101927821 | 85 |
| 438 | 3300026023 | Ga0207677_11224845 | Ga0207677_112248451 | 85 |
| 439 | 3300026035 | Ga0207703_10004081 | Ga0207703_1000408112 | 85 |
| 440 | 3300026035 | Ga0207703_11324738 | Ga0207703_113247381 | 85 |
| 441 | 3300026035 | Ga0207703_12169099 | Ga0207703_121690991 | 85 |
| 442 | 3300026041 | Ga0207639_10009956 | Ga0207639_100099562 | 85 |
| 443 | 3300026041 | Ga0207639_10034913 | Ga0207639_100349133 | 85 |
| 444 | 3300026041 | Ga0207639_10064192 | Ga0207639_100641922 | 85 |
| 445 | 3300026041 | Ga0207639_10152291 | Ga0207639_101522913 | 85 |
| 446 | 3300026041 | Ga0207639_10207681 | Ga0207639_102076812 | 85 |
| 447 | 3300026041 | Ga0207639_11126736 | Ga0207639_111267361 | 85 |
| 448 | 3300026067 | Ga0207678_10747799 | Ga0207678_107477992 | 85 |
| 449 | 3300026075 | Ga0207708_10153497 | Ga0207708_101534972 | 85 |
| 450 | 3300026078 | Ga0207702_10024888 | Ga0207702_100248887 | 85 |
| 451 | 3300026088 | Ga0207641_10000015 | Ga0207641_10000015262 | 85 |
| 452 | 3300026088 | Ga0207641_10012810 | Ga0207641_100128104 | 85 |
| 453 | 3300026088 | Ga0207641_10801050 | Ga0207641_108010502 | 85 |
| 454 | 3300026088 | Ga0207641_11301333 | Ga0207641_113013332 | 85 |
| 455 | 3300026089 | Ga0207648_10000747 | Ga0207648_1000074727 | 85 |
| 456 | 3300026089 | Ga0207648_10047974 | Ga0207648_100479744 | 85 |
| 457 | 3300026089 | Ga0207648_10223369 | Ga0207648_102233692 | 85 |
| 458 | 3300026089 | Ga0207648_11614730 | Ga0207648_116147302 | 85 |
| 459 | 3300026089 | Ga0207648_12066969 | Ga0207648_120669692 | 85 |
| 460 | 3300026095 | Ga0207676_10002059 | Ga0207676_100020595 | 85 |
| 461 | 3300026095 | Ga0207676_10262176 | Ga0207676_102621763 | 85 |
| 462 | 3300026095 | Ga0207676_10842640 | Ga0207676_108426402 | 85 |
| 463 | 3300026095 | Ga0207676_10963491 | Ga0207676_109634911 | 85 |
| 464 | 3300026095 | Ga0207676_11342469 | Ga0207676_113424692 | 85 |
| 465 | 3300026116 | Ga0207674_10314308 | Ga0207674_103143082 | 85 |
| 466 | 3300026116 | Ga0207674_10913472 | Ga0207674_109134722 | 85 |
| 467 | 3300026118 | Ga0207675_100731756 | Ga0207675_1007317562 | 85 |
| 468 | 3300026121 | Ga0207683_10006913 | Ga0207683_100069136 | 85 |
| 469 | 3300026121 | Ga0207683_10168572 | Ga0207683_101685722 | 85 |
| 470 | 3300026121 | Ga0207683_10211041 | Ga0207683_102110412 | 85 |
| 471 | 3300026121 | Ga0207683_10967059 | Ga0207683_109670591 | 85 |
| 472 | 3300026142 | Ga0207698_10003892 | Ga0207698_100038927 | 85 |
| 473 | 3300026142 | Ga0207698_10021755 | Ga0207698_100217553 | 85 |
| 474 | 3300026142 | Ga0207698_10895928 | Ga0207698_108959282 | 85 |
| 475 | 3300026142 | Ga0207698_11523284 | Ga0207698_115232842 | 85 |
| 476 | 3300026142 | Ga0207698_11840514 | Ga0207698_118405141 | 85 |
| 477 | 3300028380 | Ga0268265_10475192 | Ga0268265_104751922 | 85 |
| 478 | 3300028380 | Ga0268265_10504424 | Ga0268265_105044242 | 85 |
| 479 | 3300028380 | Ga0268265_12062726 | Ga0268265_120627262 | 85 |
| 480 | 3300028381 | Ga0268264_10001199 | Ga0268264_100011997 | 85 |
| 481 | 3300028381 | Ga0268264_10002153 | Ga0268264_100021532 | 85 |
| 482 | 3300028381 | Ga0268264_10003263 | Ga0268264_1000326312 | 85 |
| 483 | 3300028381 | Ga0268264_11297099 | Ga0268264_112970992 | 85 |
| 484 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012369 | 85 |
| 485 | 3300028794 | Ga0307515_10000031 | Ga0307515_10000031137 | 85 |
| 486 | 3300028794 | Ga0307515_10000667 | Ga0307515_1000066718 | 85 |
| 487 | 3300028794 | Ga0307515_10000790 | Ga0307515_1000079043 | 85 |
| 488 | 3300028794 | Ga0307515_10000790 | Ga0307515_1000079056 | 85 |
| 489 | 3300031456 | Ga0307513_10356067 | Ga0307513_103560672 | 85 |
| 490 | 3300031507 | Ga0307509_10278917 | Ga0307509_102789172 | 85 |
| 491 | 3300031649 | Ga0307514_10415306 | Ga0307514_104153061 | 85 |
| 492 | 3300031911 | Ga0307412_11616238 | Ga0307412_116162382 | 85 |
| 493 | 3300032004 | Ga0307414_10141912 | Ga0307414_101419122 | 85 |
| 494 | 3300033179 | Ga0307507_10000144 | Ga0307507_1000014460 | 85 |
| 495 | 3300033179 | Ga0307507_10000144 | Ga0307507_1000014472 | 85 |
| 496 | 3300035116 | Ga0373945_0533537 | Ga0373945_0533537_226_483 | 85 |
| 497 | 3300037312 | Ga0395899_0037668 | Ga0395899_0037668_3288_3545 | 85 |
| 498 | 3300037418 | Ga0395900_0027720 | Ga0395900_0027720_3685_3942 | 85 |
| 499 | 3300037466 | Ga0395898_0827926 | Ga0395898_0827926_533_790 | 85 |
| 500 | 3300037471 | Ga0395905_0000003 | Ga0395905_0000003_546701_546958 | 85 |
| 501 | 3300037471 | Ga0395905_0000049 | Ga0395905_0000049_104144_104407 | 85 |
| 502 | 3300037471 | Ga0395905_0001249 | Ga0395905_0001249_30206_30463 | 85 |
| 503 | 3300038443 | Ga0395901_0003386 | Ga0395901_0003386_7625_7882 | 85 |
| 504 | 3300041443 | Ga0451789_0303625 | Ga0451789_0303625_1077_1334 | 85 |
| 505 | 3300041451 | Ga0451791_0797082 | Ga0451791_0797082_123_380 | 85 |
| 506 | 3300041452 | Ga0451793_0259997 | Ga0451793_0259997_558_815 | 85 |
| 507 | 3300041452 | Ga0451793_0929927 | Ga0451793_0929927_351_608 | 85 |
| 508 | 3300041460 | Ga0451802_0652972 | Ga0451802_0652972_99_356 | 85 |
| 509 | 3300041505 | Ga0451849_0096302 | Ga0451849_0096302_203_460 | 85 |
| 510 | 3300041505 | Ga0451849_1063937 | Ga0451849_1063937_37_294 | 85 |
| 511 | 3300041507 | Ga0451851_0284543 | Ga0451851_0284543_290_547 | 85 |
| 512 | 3300041512 | Ga0451853_0791209 | Ga0451853_0791209_104_361 | 85 |
| 513 | 3300041512 | Ga0451853_1889411 | Ga0451853_1889411_72_329 | 85 |
| 514 | 3300044684 | Ga0466966_0066002 | Ga0466966_0066002_1761_2018 | 85 |
| 515 | 3300046454 | Ga0495592_0478108 | Ga0495592_0478108_26_283 | 85 |
| 516 | 3300046454 | Ga0495592_0775841 | Ga0495592_0775841_287_544 | 85 |
| 517 | 3300046459 | Ga0495629_0121363 | Ga0495629_0121363_170_427 | 85 |
| 518 | 3300046459 | Ga0495629_0879716 | Ga0495629_0879716_186_443 | 85 |
| 519 | 3300046460 | Ga0495638_0247841 | Ga0495638_0247841_706_963 | 85 |
| 520 | 3300046462 | Ga0495651_0180197 | Ga0495651_0180197_534_791 | 85 |
| 521 | 3300046462 | Ga0495651_0759170 | Ga0495651_0759170_245_502 | 85 |
| 522 | 3300046471 | Ga0495650_0000095 | Ga0495650_0000095_23176_23433 | 85 |
| 523 | 3300046492 | Ga0495585_0000057 | Ga0495585_0000057_36385_36642 | 85 |
| 524 | 3300046492 | Ga0495585_0002733 | Ga0495585_0002733_2806_3063 | 85 |
| 525 | 3300046492 | Ga0495585_0011600 | Ga0495585_0011600_77_334 | 85 |
| 526 | 3300046506 | Ga0495583_0005597 | Ga0495583_0005597_5775_6032 | 85 |
| 527 | 3300046506 | Ga0495583_0381052 | Ga0495583_0381052_91_348 | 85 |
| 528 | 3300046507 | Ga0495606_0000009 | Ga0495606_0000009_237590_237847 | 85 |
| 529 | 3300046507 | Ga0495606_0191418 | Ga0495606_0191418_380_637 | 85 |
| 530 | 3300046511 | Ga0495608_0076564 | Ga0495608_0076564_1110_1367 | 85 |
| 531 | 3300046512 | Ga0495610_0000867 | Ga0495610_0000867_23736_23993 | 85 |
| 532 | 3300046512 | Ga0495610_0260541 | Ga0495610_0260541_41_298 | 85 |
| 533 | 3300046512 | Ga0495610_0306604 | Ga0495610_0306604_300_557 | 85 |
| 534 | 3300046513 | Ga0495616_0000733 | Ga0495616_0000733_301_558 | 85 |
| 535 | 3300046514 | Ga0495618_0670649 | Ga0495618_0670649_259_516 | 85 |
| 536 | 3300046516 | Ga0495628_0076588 | Ga0495628_0076588_2025_2282 | 85 |
| 537 | 3300046516 | Ga0495628_1161392 | Ga0495628_1161392_66_323 | 85 |
| 538 | 3300046518 | Ga0495631_0120747 | Ga0495631_0120747_246_503 | 85 |
| 539 | 3300046518 | Ga0495631_0120947 | Ga0495631_0120947_851_1108 | 85 |
| 540 | 3300046520 | Ga0495637_0117271 | Ga0495637_0117271_736_993 | 85 |
| 541 | 3300046520 | Ga0495637_0135435 | Ga0495637_0135435_221_478 | 85 |
| 542 | 3300046524 | Ga0495648_0003800 | Ga0495648_0003800_7849_8106 | 85 |
| 543 | 3300046524 | Ga0495648_0036248 | Ga0495648_0036248_651_908 | 85 |
| 544 | 3300046524 | Ga0495648_0057079 | Ga0495648_0057079_1932_2189 | 85 |
| 545 | 3300046525 | Ga0495663_0196072 | Ga0495663_0196072_347_604 | 85 |
| 546 | 3300046529 | Ga0495652_0304302 | Ga0495652_0304302_399_656 | 85 |
| 547 | 3300046529 | Ga0495652_0368867 | Ga0495652_0368867_385_642 | 85 |
| 548 | 3300046530 | Ga0495654_0078110 | Ga0495654_0078110_219_476 | 85 |
| 549 | 3300046530 | Ga0495654_0242893 | Ga0495654_0242893_298_555 | 85 |
| 550 | 3300046537 | Ga0495598_0178109 | Ga0495598_0178109_189_449 | 85 |
| 551 | 3300046538 | Ga0495609_0015217 | Ga0495609_0015217_1530_1787 | 85 |
| 552 | 3300046538 | Ga0495609_0018877 | Ga0495609_0018877_731_988 | 85 |
| 553 | 3300046538 | Ga0495609_0037794 | Ga0495609_0037794_72_329 | 85 |
| 554 | 3300046539 | Ga0495621_0063398 | Ga0495621_0063398_381_638 | 85 |
| 555 | 3300046557 | Ga0495622_0008647 | Ga0495622_0008647_1449_1706 | 85 |
| 556 | 3300046557 | Ga0495622_0037148 | Ga0495622_0037148_1810_2067 | 85 |
| 557 | 3300046557 | Ga0495622_0220672 | Ga0495622_0220672_139_396 | 85 |
| 558 | 3300046558 | Ga0495633_0000275 | Ga0495633_0000275_42925_43182 | 85 |
| 559 | 3300046558 | Ga0495633_0000275 | Ga0495633_0000275_52347_52604 | 85 |
| 560 | 3300046558 | Ga0495633_0003968 | Ga0495633_0003968_9002_9259 | 85 |
| 561 | 3300046616 | Ga0495668_0000017 | Ga0495668_0000017_247933_248190 | 85 |
| 562 | 3300046616 | Ga0495668_0000017 | Ga0495668_0000017_257172_257429 | 85 |
| 563 | 3300046660 | Ga0495625_0000007 | Ga0495625_0000007_107634_107891 | 85 |
| 564 | 3300046660 | Ga0495625_0000435 | Ga0495625_0000435_29659_29916 | 85 |
| 565 | 3300046660 | Ga0495625_0000435 | Ga0495625_0000435_39232_39489 | 85 |
| 566 | 3300046660 | Ga0495625_0001213 | Ga0495625_0001213_17391_17648 | 85 |
| 567 | 3300046660 | Ga0495625_0001213 | Ga0495625_0001213_7998_8255 | 85 |
| 568 | 3300046660 | Ga0495625_0040215 | Ga0495625_0040215_2492_2749 | 85 |
| 569 | 3300046665 | Ga0495661_0000576 | Ga0495661_0000576_26285_26542 | 85 |
| 570 | 3300046674 | Ga0495588_0102322 | Ga0495588_0102322_225_482 | 85 |
| 571 | 3300046683 | Ga0495658_0025386 | Ga0495658_0025386_2113_2370 | 85 |
| 572 | 3300046683 | Ga0495658_0044823 | Ga0495658_0044823_245_502 | 85 |
| 573 | 3300046691 | Ga0495670_0151582 | Ga0495670_0151582_827_1084 | 85 |
| 574 | 3300046691 | Ga0495670_0844602 | Ga0495670_0844602_141_398 | 85 |
| 575 | 3300046692 | Ga0495671_0027550 | Ga0495671_0027550_2533_2790 | 85 |
| 576 | 3300046694 | Ga0495649_0000007 | Ga0495649_0000007_327527_327784 | 85 |
| 577 | 3300046809 | Ga0495600_0219554 | Ga0495600_0219554_248_505 | 85 |
| 578 | 3300046809 | Ga0495600_0686852 | Ga0495600_0686852_91_348 | 85 |
| 579 | 3300046810 | Ga0495660_0020251 | Ga0495660_0020251_2079_2336 | 85 |
| 580 | 3300046810 | Ga0495660_0102272 | Ga0495660_0102272_425_682 | 85 |
| 581 | 3300047318 | Ga0495636_0120574 | Ga0495636_0120574_418_675 | 85 |
| 582 | 3300047320 | Ga0495672_0037564 | Ga0495672_0037564_728_985 | 85 |
| 583 | 3300047321 | Ga0495676_0441869 | Ga0495676_0441869_567_824 | 85 |
| 584 | 3300047323 | Ga0495683_0082685 | Ga0495683_0082685_487_744 | 85 |
| 585 | 3300047443 | Ga0495687_000440 | Ga0495687_000440_2583_2840 | 85 |
| 586 | 3300047443 | Ga0495687_036112 | Ga0495687_036112_227_484 | 85 |
| 587 | 3300047445 | Ga0495677_0447931 | Ga0495677_0447931_26_283 | 85 |
| 588 | 3300047446 | Ga0495679_160294 | Ga0495679_160294_48_305 | 85 |
| 589 | 3300047469 | Ga0495673_0029094 | Ga0495673_0029094_318_575 | 85 |
| 590 | 3300047472 | Ga0495686_0031274 | Ga0495686_0031274_1509_1766 | 85 |
| 591 | 3300047472 | Ga0495686_0619986 | Ga0495686_0619986_220_477 | 85 |
| 592 | 3300048088 | Ga0495602_0879454 | Ga0495602_0879454_189_446 | 85 |
| 593 | 3300048089 | Ga0495614_0019267 | Ga0495614_0019267_26_283 | 85 |
| 594 | 3300048091 | Ga0495626_0117421 | Ga0495626_0117421_555_812 | 85 |
| 595 | 3300048913 | Ga0496110_1333775 | Ga0496110_1333775_45_302 | 85 |
| 596 | 3300049460 | Ga0495682_0052571 | Ga0495682_0052571_524_781 | 85 |
| 597 | 3300049538 | Ga0501322_012301 | Ga0501322_012301_260_517 | 85 |
| 598 | 3300049569 | Ga0501032_0107271 | Ga0501032_0107271_1285_1545 | 85 |
| 599 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_173570_173827 | 85 |
| 600 | 3300049572 | Ga0501036_0564675 | Ga0501036_0564675_210_470 | 85 |
| 601 | 3300049573 | Ga0501037_0424039 | Ga0501037_0424039_222_482 | 85 |
| 602 | 3300049581 | Ga0501047_0430720 | Ga0501047_0430720_62_322 | 85 |
| 603 | 3300050493 | nmdc:mga0k408_490_c1 | nmdc:mga0k408_490_c1_8643_8900 | 85 |
| 604 | 3300050493 | nmdc:mga0k408_5994_c1 | nmdc:mga0k408_5994_c1_577_834 | 85 |
| 605 | 3300050493 | nmdc:mga0k408_656162_c1 | nmdc:mga0k408_656162_c1_164_421 | 85 |
| 606 | 3300050511 | nmdc:mga08y16_284540_c1 | nmdc:mga08y16_284540_c1_999_1256 | 85 |
| 607 | 3300050516 | nmdc:mga0sz30_160790_c1 | nmdc:mga0sz30_160790_c1_200_457 | 85 |
| 608 | 3300053090 | Ga0500646_0143247 | Ga0500646_0143247_417_674 | 85 |
| 609 | 3300053090 | Ga0500646_0289881 | Ga0500646_0289881_193_450 | 85 |
| 610 | 3300053090 | Ga0500646_0292639 | Ga0500646_0292639_202_459 | 85 |
| 611 | 3300053118 | Ga0500594_0210115 | Ga0500594_0210115_270_527 | 85 |
| 612 | 3300053125 | Ga0500618_000033 | Ga0500618_000033_100531_100788 | 85 |
| 613 | 3300053125 | Ga0500618_000033 | Ga0500618_000033_85511_85768 | 85 |
| 614 | 3300053125 | Ga0500618_033636 | Ga0500618_033636_434_691 | 85 |
| 615 | 3300053137 | Ga0500561_0168618 | Ga0500561_0168618_408_665 | 85 |
| 616 | 3300053161 | Ga0500634_0124452 | Ga0500634_0124452_893_1150 | 85 |
| 617 | 3300053723 | Ga0500567_259717 | Ga0500567_259717_24_281 | 85 |
| 618 | 3300055283 | Ga0500661_003220 | Ga0500661_003220_1154_1411 | 85 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f80-assembly1.cif.gz_F | holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) | 0.8765 | 5 | 75 |
| 8odw-assembly1.cif.gz_A | crystal structure of lbma ox-acp didomain in complex with nadp and ethyl glycinate from the lobatamide pks (gynuella sunshinyii) | 0.8749 | 3 | 85 |
| 1f80-assembly1.cif.gz_D | holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) | 0.8677 | 4 | 75 |
| 2fac-assembly1.cif.gz_A | crystal structure of e. coli hexanoyl-acp | 0.8631 | 6 | 77 |
| 8jfh-assembly1.cif.gz_E | crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery | 0.8618 | 4 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VIC9_329_406_1.10.1200.10 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9051 | 3 | 81 | 1.10.1200.10 |
| af_P9WQF1_4_84_1.10.1200.10 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.8855 | 2 | 81 | 1.10.1200.10 |
| 1f80F00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.8765 | 5 | 75 | 1.10.1200.10 |
| af_G5ECV9_328_405_1.10.1200.10 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.8764 | 3 | 76 | 1.10.1200.10 |
| 1f80D00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.8677 | 4 | 75 | 1.10.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R8DVQ6-F1-model_v4 | Acyl carrier protein (ACP) | 0.9917 | 3 | 79 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 |
| AF-A0A3D3CVK0-F1-model_v4 | Acyl carrier protein | 0.9864 | 1 | 80 |
|
| AF-A0A512RL56-F1-model_v4 | Acyl carrier protein (ACP) | 0.9769 | 1 | 85 |
GO:0000036
GO:0005737 |
| AF-A0A1T5P029-F1-model_v4 | Acyl carrier protein | 0.9767 | 1 | 85 |
GO:0000035
GO:0000036 |
| AF-A0A3D2HNG3-F1-model_v4 | deleted | 0.9764 | 1 | 82 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar