F469720
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 618 | 473 | 1236 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10000305|Ga0081455_1000030541 |
| Length | 294 |
| Sequence | MPRSSWKGYLKLSLVSCAVALYNASSSSERVSFNTLNRKTGNRLKQNMVDSVSGEPVDTADRVKGYQVSKGQYVMVEDTDLEALKIESTRMIEIETFVPQAEVDQIYLDSPYYLAPDDKVAEEAFAVIRDAMSRKKVVGIGRVVLNRRERMLMLEPRHNGMLATTLRYPYEVRQDAEYFADISEVKLPAEMLDIAQEIIGRKSGHFEPDKFADRYEEAVVSMLRAKQAGQTFAVPEAAAPANVVNIMDALRRSLEAEGTDAGAIRRPRAPSKKPAEAPAAAAETRKPKARKAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 36 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 106 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 115 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 121 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 122 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 123 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 124 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 125 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 126 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 127 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 128 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 129 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 130 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 131 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 132 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 133 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 134 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 135 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 138 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 139 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 140 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 168 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 169 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 170 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 171 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 172 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 173 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 174 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 175 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 176 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 177 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 178 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 196 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 200 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 203 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 204 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 205 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 206 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 207 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 208 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 209 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 212 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 213 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 215 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 216 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 217 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 219 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 220 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 221 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 222 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 223 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 224 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 225 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 228 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 229 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 230 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 231 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 232 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 233 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 234 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 235 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 236 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 237 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 238 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 239 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 240 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 241 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 242 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 243 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 244 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 245 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 246 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 247 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 248 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 249 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 250 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 251 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 252 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 253 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 254 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 255 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 256 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 257 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 258 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 259 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 260 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 261 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 262 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 263 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 264 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 265 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 266 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 267 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 268 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 269 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 270 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 271 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 272 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 273 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 274 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 275 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 276 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 277 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 278 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 279 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 280 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 281 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 282 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 283 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 284 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 285 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 286 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 287 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 288 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 289 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 290 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 291 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 292 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 293 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 294 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 295 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 296 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 297 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 298 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 299 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 300 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 301 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 302 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 303 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 304 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 305 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 306 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 307 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 308 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 309 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 310 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 311 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 312 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 313 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 314 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 315 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 316 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 317 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 318 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 319 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 320 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 321 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 322 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 323 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 324 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 325 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 326 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 327 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 328 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 329 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 330 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 331 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 332 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 333 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 334 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 335 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 336 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 337 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 338 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 339 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 340 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 341 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 342 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 343 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 344 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 345 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 346 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 347 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 348 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 349 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 350 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 351 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 352 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 353 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 354 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 355 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 356 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 357 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 358 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 359 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 360 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 361 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 362 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 363 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 364 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 365 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 366 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 367 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 368 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 369 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 370 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 371 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 372 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 373 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 374 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 375 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 376 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 377 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 378 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 379 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 380 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 381 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 382 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 383 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 384 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 385 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 386 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 387 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 388 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 389 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 390 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 391 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 392 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 393 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 394 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 395 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 396 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 397 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 398 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 399 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 400 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 401 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 402 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 403 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 404 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 405 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 406 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 407 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 408 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 409 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 410 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 411 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 412 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 413 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 414 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 415 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 416 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 417 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 418 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 419 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 420 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 421 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 422 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 423 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 424 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 425 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 426 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 427 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 428 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 429 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 430 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 431 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 432 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 433 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 434 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 435 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 436 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 437 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 438 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 439 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 440 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 441 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 442 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 443 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 444 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 445 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 446 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 447 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 448 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 449 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 450 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 451 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 452 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 453 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 454 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 455 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 456 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 457 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 458 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 459 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 460 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 461 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 462 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 463 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 464 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 465 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 466 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 467 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 468 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 469 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 470 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 471 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 472 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 473 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 58.9 |
| Metatranscriptomes | 0.32 |
| Isolates | 40.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.81 |
| Bulb | 0 |
| Endosphere | 14.89 |
| Nodule | 31.23 |
| Rhizoplane | 0.97 |
| Rhizosphere | 36.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10000305 | 3300005937 | Bacteria | 64685 |
| 2 | JGI25152J39213_1009888 | 3300002773 | Bacteria | 2224 |
| 3 | JGI25151J46595_10001032 | 3300003187 | Bacteria | 20828 |
| 4 | JGI25151J46595_10002384 | 3300003187 | Bacteria | 11394 |
| 5 | JGI25151J46595_10059739 | 3300003187 | Bacteria | 1225 |
| 6 | JGI25165J46597_1000159 | 3300003214 | Bacteria | 108186 |
| 7 | rootH2_10157225 | 3300003320 | Bacteria | 1450 |
| 8 | rootH1_10056806 | 3300003323 | Bacteria | 5914 |
| 9 | rootH1_10062594 | 3300003323 | Bacteria | 3322 |
| 10 | JGI25161J50226_1001088 | 3300003374 | Bacteria | 9152 |
| 11 | Ga0055542_1000644 | 3300003762 | Bacteria | 29152 |
| 12 | Ga0055529_1003184 | 3300003763 | Bacteria | 2816 |
| 13 | Ga0055526_1001823 | 3300003771 | Bacteria | 14732 |
| 14 | Ga0055524_1008749 | 3300003775 | Bacteria | 4181 |
| 15 | Ga0055536_1001554 | 3300003781 | Bacteria | 13762 |
| 16 | Ga0055536_1005522 | 3300003781 | Bacteria | 6156 |
| 17 | Ga0055530_10008550 | 3300003791 | Bacteria | 4078 |
| 18 | Ga0055540_1000439 | 3300003792 | Bacteria | 32821 |
| 19 | Ga0055531_10002843 | 3300003794 | Bacteria | 11322 |
| 20 | Ga0055531_10003010 | 3300003794 | Bacteria | 10939 |
| 21 | Ga0055531_10004825 | 3300003794 | Bacteria | 8047 |
| 22 | Ga0058692_1003121 | 3300003856 | Bacteria | 5258 |
| 23 | Ga0065165_1000672 | 3300005262 | Bacteria | 49172 |
| 24 | Ga0070670_100004393 | 3300005331 | Bacteria | 11803 |
| 25 | Ga0070680_100287278 | 3300005336 | Bacteria | 1394 |
| 26 | Ga0070668_100447171 | 3300005347 | Bacteria | 1110 |
| 27 | Ga0070669_100107443 | 3300005353 | Bacteria | 2114 |
| 28 | Ga0070675_100052208 | 3300005354 | Bacteria | 3361 |
| 29 | Ga0070674_100004459 | 3300005356 | Bacteria | 7986 |
| 30 | Ga0070673_100213381 | 3300005364 | Bacteria | 1668 |
| 31 | Ga0070688_100082867 | 3300005365 | Bacteria | 2080 |
| 32 | Ga0070700_100110022 | 3300005441 | Bacteria | 1830 |
| 33 | Ga0070681_10306735 | 3300005458 | Bacteria | 1497 |
| 34 | Ga0070665_100087236 | 3300005548 | Bacteria | 3125 |
| 35 | Ga0068856_100022618 | 3300005614 | Bacteria | 6112 |
| 36 | Ga0068861_100035625 | 3300005719 | Bacteria | 3688 |
| 37 | Ga0081455_10013447 | 3300005937 | Bacteria | 8087 |
| 38 | Ga0081540_1040237 | 3300005983 | Bacteria | 2438 |
| 39 | Ga0081539_10003002 | 3300005985 | Bacteria | 22025 |
| 40 | Ga0081539_10008935 | 3300005985 | Bacteria | 8543 |
| 41 | Ga0075363_100126081 | 3300006048 | Bacteria | 1433 |
| 42 | Ga0075364_10011001 | 3300006051 | Bacteria | 5488 |
| 43 | Ga0075362_10017145 | 3300006177 | Bacteria | 2979 |
| 44 | Ga0075362_10027328 | 3300006177 | Bacteria | 2442 |
| 45 | Ga0075367_10093846 | 3300006178 | Bacteria | 1828 |
| 46 | Ga0075367_10100202 | 3300006178 | Bacteria | 1770 |
| 47 | Ga0075369_10009799 | 3300006186 | Bacteria | 3733 |
| 48 | Ga0075369_10016020 | 3300006186 | Bacteria | 3017 |
| 49 | Ga0075369_10088593 | 3300006186 | Bacteria | 1379 |
| 50 | Ga0075366_10044392 | 3300006195 | Bacteria | 2634 |
| 51 | Ga0075370_10153140 | 3300006353 | Bacteria | 1351 |
| 52 | Ga0075428_100184505 | 3300006844 | Bacteria | 2257 |
| 53 | Ga0075430_100296739 | 3300006846 | Bacteria | 1337 |
| 54 | Ga0105240_10366343 | 3300009093 | Bacteria | 1631 |
| 55 | Ga0105240_10430927 | 3300009093 | Bacteria | 1479 |
| 56 | Ga0111539_10239744 | 3300009094 | Bacteria | 2111 |
| 57 | Ga0111539_10502227 | 3300009094 | Bacteria | 1413 |
| 58 | Ga0111539_10546791 | 3300009094 | Bacteria | 1349 |
| 59 | Ga0105247_10063908 | 3300009101 | Bacteria | 2286 |
| 60 | Ga0114129_10067744 | 3300009147 | Bacteria | 4977 |
| 61 | Ga0105243_10039078 | 3300009148 | Bacteria | 3698 |
| 62 | Ga0105243_10214195 | 3300009148 | Bacteria | 1698 |
| 63 | Ga0105237_10000038 | 3300009545 | Bacteria | 190707 |
| 64 | Ga0105237_10211574 | 3300009545 | Bacteria | 1939 |
| 65 | Ga0105237_10873642 | 3300009545 | Bacteria | 906 |
| 66 | Ga0105238_10243963 | 3300009551 | Bacteria | 1774 |
| 67 | Ga0105238_10274796 | 3300009551 | Bacteria | 1665 |
| 68 | Ga0105238_10311463 | 3300009551 | Bacteria | 1559 |
| 69 | Ga0105238_10342500 | 3300009551 | Bacteria | 1483 |
| 70 | Ga0105249_10330702 | 3300009553 | Bacteria | 1537 |
| 71 | Ga0105239_10000065 | 3300010375 | Bacteria | 151224 |
| 72 | Ga0105239_10002418 | 3300010375 | Bacteria | 23771 |
| 73 | Ga0105239_10455016 | 3300010375 | Bacteria | 1452 |
| 74 | Ga0105239_10590416 | 3300010375 | Bacteria | 1266 |
| 75 | Ga0157373_10001149 | 3300013100 | Bacteria | 20277 |
| 76 | Ga0157373_10028466 | 3300013100 | Bacteria | 4031 |
| 77 | Ga0157371_10005936 | 3300013102 | Bacteria | 10194 |
| 78 | Ga0157370_10000054 | 3300013104 | Bacteria | 118718 |
| 79 | Ga0157369_10103813 | 3300013105 | Bacteria | 3028 |
| 80 | Ga0157374_10558416 | 3300013296 | Bacteria | 1153 |
| 81 | Ga0163162_10646939 | 3300013306 | Bacteria | 1181 |
| 82 | Ga0157372_10169581 | 3300013307 | Bacteria | 2525 |
| 83 | Ga0163163_10260203 | 3300014325 | Bacteria | 1786 |
| 84 | Ga0157380_10004845 | 3300014326 | Bacteria | 9372 |
| 85 | Ga0182006_1043515 | 3300015261 | Bacteria | 1755 |
| 86 | Ga0182007_10011902 | 3300015262 | Bacteria | 3366 |
| 87 | Ga0209436_100157 | 3300025208 | Bacteria | 32790 |
| 88 | Ga0209437_100023 | 3300025233 | Bacteria | 614195 |
| 89 | Ga0209437_113631 | 3300025233 | Bacteria | 1157 |
| 90 | Ga0209677_100525 | 3300025253 | Bacteria | 21305 |
| 91 | Ga0209148_1000126 | 3300025254 | Bacteria | 181590 |
| 92 | Ga0209148_1007709 | 3300025254 | Bacteria | 2214 |
| 93 | Ga0209129_1000070 | 3300025258 | Bacteria | 212476 |
| 94 | Ga0209233_1000127 | 3300025261 | Bacteria | 213026 |
| 95 | Ga0209233_1000214 | 3300025261 | Bacteria | 108975 |
| 96 | Ga0209455_1000105 | 3300025272 | Bacteria | 199725 |
| 97 | Ga0209673_1036445 | 3300025273 | Bacteria | 1459 |
| 98 | Ga0209130_1000242 | 3300025284 | Bacteria | 69580 |
| 99 | Ga0209676_1001945 | 3300025292 | Bacteria | 16638 |
| 100 | Ga0209676_1025564 | 3300025292 | Bacteria | 1891 |
| 101 | Ga0209025_1000175 | 3300025294 | Bacteria | 158379 |
| 102 | Ga0209025_1000240 | 3300025294 | Bacteria | 128397 |
| 103 | Ga0209025_1001648 | 3300025294 | Bacteria | 27540 |
| 104 | Ga0209025_1002267 | 3300025294 | Bacteria | 21060 |
| 105 | Ga0209564_1000338 | 3300025295 | Bacteria | 90246 |
| 106 | Ga0209564_1000341 | 3300025295 | Bacteria | 89262 |
| 107 | Ga0209758_1030208 | 3300025297 | Bacteria | 2249 |
| 108 | Ga0209758_1042558 | 3300025297 | Bacteria | 1683 |
| 109 | Ga0209050_1012027 | 3300025298 | Bacteria | 4024 |
| 110 | Ga0209256_1000534 | 3300025299 | Bacteria | 55095 |
| 111 | Ga0209256_1000573 | 3300025299 | Bacteria | 52571 |
| 112 | Ga0207426_1000483 | 3300025302 | Bacteria | 60265 |
| 113 | Ga0207426_1022166 | 3300025302 | Bacteria | 2184 |
| 114 | Ga0209051_1000192 | 3300025303 | Bacteria | 108667 |
| 115 | Ga0209051_1020577 | 3300025303 | Bacteria | 2836 |
| 116 | Ga0209051_1020896 | 3300025303 | Bacteria | 2803 |
| 117 | Ga0209257_1000300 | 3300025304 | Bacteria | 108786 |
| 118 | Ga0209257_1002029 | 3300025304 | Bacteria | 21609 |
| 119 | Ga0209257_1005011 | 3300025304 | Bacteria | 9655 |
| 120 | Ga0207710_10073308 | 3300025900 | Bacteria | 1574 |
| 121 | Ga0207699_10055720 | 3300025906 | Bacteria | 2354 |
| 122 | Ga0207695_10206822 | 3300025913 | Bacteria | 1875 |
| 123 | Ga0207695_10266521 | 3300025913 | Bacteria | 1609 |
| 124 | Ga0207695_10284633 | 3300025913 | Bacteria | 1546 |
| 125 | Ga0207671_10000418 | 3300025914 | Bacteria | 58941 |
| 126 | Ga0207693_10208515 | 3300025915 | Bacteria | 1536 |
| 127 | Ga0207657_10023716 | 3300025919 | Bacteria | 5706 |
| 128 | Ga0207649_10388056 | 3300025920 | Bacteria | 1042 |
| 129 | Ga0207652_10366347 | 3300025921 | Bacteria | 1301 |
| 130 | Ga0207681_10066348 | 3300025923 | Bacteria | 2498 |
| 131 | Ga0207694_10067404 | 3300025924 | Bacteria | 2794 |
| 132 | Ga0207650_10007578 | 3300025925 | Bacteria | 7399 |
| 133 | Ga0207690_10269967 | 3300025932 | Bacteria | 1321 |
| 134 | Ga0207690_10564547 | 3300025932 | Bacteria | 926 |
| 135 | Ga0207706_10301134 | 3300025933 | Bacteria | 1397 |
| 136 | Ga0207670_10205294 | 3300025936 | Bacteria | 1499 |
| 137 | Ga0207669_10040098 | 3300025937 | Bacteria | 2713 |
| 138 | Ga0207704_10063642 | 3300025938 | Bacteria | 2300 |
| 139 | Ga0207691_10188663 | 3300025940 | Bacteria | 1799 |
| 140 | Ga0207679_10267230 | 3300025945 | Bacteria | 1461 |
| 141 | Ga0207712_10222037 | 3300025961 | Bacteria | 1511 |
| 142 | Ga0207640_10413754 | 3300025981 | Bacteria | 1101 |
| 143 | Ga0207678_10238766 | 3300026067 | Bacteria | 1556 |
| 144 | Ga0207702_10183324 | 3300026078 | Bacteria | 1929 |
| 145 | Ga0207674_10491400 | 3300026116 | Bacteria | 1186 |
| 146 | Ga0207674_10494513 | 3300026116 | Bacteria | 1182 |
| 147 | Ga0207675_100036936 | 3300026118 | Bacteria | 4557 |
| 148 | Ga0207675_100437391 | 3300026118 | Bacteria | 1294 |
| 149 | Ga0209371_1001722 | 3300027312 | Bacteria | 13838 |
| 150 | Ga0209371_1009909 | 3300027312 | Bacteria | 2985 |
| 151 | Ga0209282_1000093 | 3300027666 | Bacteria | 62036 |
| 152 | Ga0268256_1000785 | 3300030500 | Bacteria | 22910 |
| 153 | Ga0268256_1002551 | 3300030500 | Bacteria | 9130 |
| 154 | Ga0265331_10053692 | 3300031250 | Bacteria | 1921 |
| 155 | Ga0307410_10029864 | 3300031852 | Bacteria | 3476 |
| 156 | Ga0307406_10489217 | 3300031901 | Bacteria | 995 |
| 157 | Ga0307407_10003714 | 3300031903 | Bacteria | 6331 |
| 158 | Ga0307409_100002825 | 3300031995 | Bacteria | 9181 |
| 159 | Ga0307416_100265949 | 3300032002 | Bacteria | 1680 |
| 160 | Ga0307414_10072585 | 3300032004 | Bacteria | 2487 |
| 161 | Ga0307414_10152125 | 3300032004 | Bacteria | 1827 |
| 162 | Ga0307414_10353236 | 3300032004 | Bacteria | 1262 |
| 163 | Ga0307415_100176168 | 3300032126 | Bacteria | 1673 |
| 164 | Ga0373941_0009623 | 3300035115 | Unclassified | 2439 |
| 165 | Ga0395899_0002239 | 3300037312 | Bacteria | 15835 |
| 166 | Ga0395898_0004769 | 3300037466 | Bacteria | 14761 |
| 167 | Ga0395898_0284805 | 3300037466 | Bacteria | 1576 |
| 168 | Ga0395905_0000321 | 3300037471 | Bacteria | 69144 |
| 169 | Ga0395905_0068400 | 3300037471 | Bacteria | 3326 |
| 170 | Ga0395901_0011113 | 3300038443 | Bacteria | 9124 |
| 171 | Ga0395901_0404495 | 3300038443 | Bacteria | 1402 |
| 172 | Ga0436360_0886486 | 3300039438 | Bacteria | 1893 |
| 173 | Ga0436360_1098593 | 3300039438 | Bacteria | 8015 |
| 174 | Ga0436361_0694290 | 3300039447 | Bacteria | 14486 |
| 175 | Ga0439436_0000279 | 3300041404 | Bacteria | 12352 |
| 176 | Ga0439438_012958 | 3300041405 | Bacteria | 2535 |
| 177 | Ga0439466_0043540 | 3300041411 | Bacteria | 1491 |
| 178 | Ga0439465_0000751 | 3300041413 | Bacteria | 10045 |
| 179 | Ga0439465_0001030 | 3300041413 | Bacteria | 8866 |
| 180 | Ga0439465_0003064 | 3300041413 | Bacteria | 5469 |
| 181 | Ga0451837_0672962 | 3300041494 | Bacteria | 2659 |
| 182 | Ga0451839_0286878 | 3300041496 | Bacteria | 4241 |
| 183 | Ga0451841_0324813 | 3300041498 | Bacteria | 901 |
| 184 | Ga0451847_0135229 | 3300041503 | Bacteria | 3267 |
| 185 | Ga0451849_0802431 | 3300041505 | Bacteria | 3219 |
| 186 | Ga0451851_0116375 | 3300041507 | Bacteria | 2703 |
| 187 | Ga0439448_0075249 | 3300042005 | Bacteria | 1129 |
| 188 | Ga0439449_0081664 | 3300042007 | Bacteria | 1192 |
| 189 | Ga0439458_0022365 | 3300042157 | Bacteria | 1469 |
| 190 | Ga0439434_0012924 | 3300042435 | Bacteria | 2475 |
| 191 | Ga0466963_0040293 | 3300044694 | Bacteria | 3061 |
| 192 | Ga0466964_0030426 | 3300044706 | Bacteria | 2137 |
| 193 | Ga0466970_0000092 | 3300044765 | Bacteria | 38213 |
| 194 | Ga0466957_0046159 | 3300044842 | Bacteria | 2644 |
| 195 | Ga0466958_0007987 | 3300045836 | Bacteria | 5850 |
| 196 | Ga0466967_0140912 | 3300045976 | Bacteria | 2246 |
| 197 | Ga0495629_0086413 | 3300046459 | Bacteria | 2188 |
| 198 | Ga0495662_0024171 | 3300046476 | Bacteria | 2932 |
| 199 | Ga0495585_0059838 | 3300046492 | Bacteria | 2098 |
| 200 | Ga0495607_0044822 | 3300046501 | Bacteria | 2605 |
| 201 | Ga0495610_0000016 | 3300046512 | Bacteria | 373959 |
| 202 | Ga0495631_0025953 | 3300046518 | Bacteria | 2694 |
| 203 | Ga0495643_0024612 | 3300046522 | Bacteria | 3413 |
| 204 | Ga0495643_0026497 | 3300046522 | Bacteria | 3271 |
| 205 | Ga0495643_0087487 | 3300046522 | Bacteria | 1612 |
| 206 | Ga0495587_0123022 | 3300046536 | Bacteria | 1485 |
| 207 | Ga0495633_0000895 | 3300046558 | Bacteria | 25483 |
| 208 | Ga0495633_0012830 | 3300046558 | Bacteria | 4438 |
| 209 | Ga0495656_0025327 | 3300046615 | Bacteria | 2351 |
| 210 | Ga0495668_0004965 | 3300046616 | Bacteria | 9216 |
| 211 | Ga0495625_0000210 | 3300046660 | Bacteria | 93375 |
| 212 | Ga0495625_0007985 | 3300046660 | Bacteria | 9092 |
| 213 | Ga0495625_0165735 | 3300046660 | Bacteria | 1477 |
| 214 | Ga0495635_0203402 | 3300046663 | Bacteria | 1343 |
| 215 | Ga0495661_0107895 | 3300046665 | Bacteria | 1556 |
| 216 | Ga0495588_0122961 | 3300046674 | Bacteria | 1368 |
| 217 | Ga0495657_0123810 | 3300046675 | Bacteria | 1626 |
| 218 | Ga0495658_0302504 | 3300046683 | Bacteria | 1012 |
| 219 | Ga0495649_0000001 | 3300046694 | Bacteria | 1113839 |
| 220 | Ga0495600_0054695 | 3300046809 | Bacteria | 2607 |
| 221 | Ga0495600_0262563 | 3300046809 | Bacteria | 1096 |
| 222 | Ga0495660_0000673 | 3300046810 | Bacteria | 26298 |
| 223 | Ga0495660_0023648 | 3300046810 | Bacteria | 3505 |
| 224 | Ga0495604_0007159 | 3300047317 | Bacteria | 8835 |
| 225 | Ga0495681_0000507 | 3300047470 | Bacteria | 29753 |
| 226 | Ga0495681_0094207 | 3300047470 | Bacteria | 1318 |
| 227 | Ga0495686_0000895 | 3300047472 | Bacteria | 37513 |
| 228 | Ga0495686_0002749 | 3300047472 | Bacteria | 16076 |
| 229 | Ga0495686_0003551 | 3300047472 | Bacteria | 13417 |
| 230 | Ga0495686_0015440 | 3300047472 | Bacteria | 5213 |
| 231 | Ga0496109_0244347 | 3300048912 | Bacteria | 1690 |
| 232 | Ga0496109_0404302 | 3300048912 | Bacteria | 1290 |
| 233 | Ga0496110_0401827 | 3300048913 | Bacteria | 1249 |
| 234 | Ga0496116_0000247 | 3300048919 | Bacteria | 98384 |
| 235 | Ga0496116_0003190 | 3300048919 | Bacteria | 16402 |
| 236 | Ga0496116_0006733 | 3300048919 | Bacteria | 10346 |
| 237 | Ga0496116_0018236 | 3300048919 | Bacteria | 5418 |
| 238 | Ga0496116_0048266 | 3300048919 | Bacteria | 2858 |
| 239 | Ga0496117_0000105 | 3300048920 | Bacteria | 188970 |
| 240 | Ga0496117_0001492 | 3300048920 | Bacteria | 33537 |
| 241 | Ga0496118_0000168 | 3300048921 | Bacteria | 118938 |
| 242 | Ga0496118_0002150 | 3300048921 | Bacteria | 27498 |
| 243 | Ga0496118_0035272 | 3300048921 | Bacteria | 4065 |
| 244 | Ga0496118_0043064 | 3300048921 | Bacteria | 3554 |
| 245 | Ga0496118_0053946 | 3300048921 | Bacteria | 3050 |
| 246 | Ga0496119_0000443 | 3300048922 | Bacteria | 56795 |
| 247 | Ga0496119_0000887 | 3300048922 | Bacteria | 39179 |
| 248 | Ga0496119_0003427 | 3300048922 | Bacteria | 16468 |
| 249 | Ga0496120_0000818 | 3300048923 | Bacteria | 44506 |
| 250 | Ga0496120_0029492 | 3300048923 | Bacteria | 3348 |
| 251 | Ga0496120_0086412 | 3300048923 | Bacteria | 1686 |
| 252 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 253 | Ga0496121_0018333 | 3300048924 | Bacteria | 7064 |
| 254 | Ga0496121_0073906 | 3300048924 | Bacteria | 2729 |
| 255 | Ga0496121_0127272 | 3300048924 | Bacteria | 1913 |
| 256 | Ga0496122_0001241 | 3300048925 | Bacteria | 43048 |
| 257 | Ga0496122_0002116 | 3300048925 | Bacteria | 29353 |
| 258 | Ga0496122_0057250 | 3300048925 | Bacteria | 2897 |
| 259 | Ga0496122_0063057 | 3300048925 | Bacteria | 2708 |
| 260 | Ga0496122_0103503 | 3300048925 | Bacteria | 1894 |
| 261 | Ga0496122_0112205 | 3300048925 | Bacteria | 1786 |
| 262 | Ga0496123_0001704 | 3300048926 | Bacteria | 29372 |
| 263 | Ga0496123_0076032 | 3300048926 | Bacteria | 2069 |
| 264 | Ga0496123_0131321 | 3300048926 | Unclassified | 1386 |
| 265 | Ga0496123_0242544 | 3300048926 | Bacteria | 894 |
| 266 | Ga0496124_0000091 | 3300048927 | Bacteria | 189706 |
| 267 | Ga0496124_0000254 | 3300048927 | Bacteria | 103551 |
| 268 | Ga0496124_0002483 | 3300048927 | Bacteria | 24047 |
| 269 | Ga0496124_0031267 | 3300048927 | Bacteria | 4714 |
| 270 | Ga0496124_0035183 | 3300048927 | Bacteria | 4384 |
| 271 | Ga0496124_0068831 | 3300048927 | Bacteria | 2940 |
| 272 | Ga0496125_0000034 | 3300048928 | Bacteria | 348231 |
| 273 | Ga0496125_0005508 | 3300048928 | Bacteria | 14035 |
| 274 | Ga0496125_0211900 | 3300048928 | Bacteria | 1257 |
| 275 | Ga0496126_0026321 | 3300048929 | Bacteria | 5579 |
| 276 | Ga0496126_0042165 | 3300048929 | Bacteria | 4216 |
| 277 | Ga0496126_0098573 | 3300048929 | Bacteria | 2560 |
| 278 | Ga0496126_0377732 | 3300048929 | Bacteria | 1154 |
| 279 | Ga0501032_0008593 | 3300049569 | Bacteria | 7442 |
| 280 | Ga0501032_0019882 | 3300049569 | Bacteria | 4688 |
| 281 | Ga0501032_0031140 | 3300049569 | Bacteria | 3658 |
| 282 | Ga0501033_0000350 | 3300049570 | Bacteria | 43920 |
| 283 | Ga0501033_0004563 | 3300049570 | Bacteria | 11091 |
| 284 | Ga0501034_0000109 | 3300049571 | Bacteria | 151550 |
| 285 | Ga0501034_0021544 | 3300049571 | Bacteria | 6567 |
| 286 | Ga0501034_0039043 | 3300049571 | Bacteria | 4809 |
| 287 | Ga0501034_0050108 | 3300049571 | Bacteria | 4212 |
| 288 | Ga0501034_0117395 | 3300049571 | Bacteria | 2648 |
| 289 | Ga0501036_0196698 | 3300049572 | Bacteria | 1696 |
| 290 | Ga0501037_0000193 | 3300049573 | Bacteria | 56422 |
| 291 | Ga0501037_0234790 | 3300049573 | Bacteria | 1287 |
| 292 | Ga0501037_0285631 | 3300049573 | Bacteria | 1149 |
| 293 | Ga0501038_0001744 | 3300049574 | Bacteria | 20218 |
| 294 | Ga0501038_0183214 | 3300049574 | Bacteria | 1688 |
| 295 | Ga0501039_0039516 | 3300049575 | Bacteria | 3644 |
| 296 | Ga0501039_0201911 | 3300049575 | Bacteria | 1563 |
| 297 | Ga0501041_0056638 | 3300049577 | Bacteria | 2396 |
| 298 | Ga0501043_0000861 | 3300049579 | Bacteria | 26900 |
| 299 | Ga0501043_0018589 | 3300049579 | Bacteria | 5453 |
| 300 | Ga0501043_0058567 | 3300049579 | Bacteria | 3024 |
| 301 | Ga0501047_0092662 | 3300049581 | Bacteria | 2900 |
| 302 | Ga0501068_0003917 | 3300049584 | Bacteria | 8095 |
| 303 | Ga0501068_0093202 | 3300049584 | Bacteria | 1860 |
| 304 | Ga0501069_0000193 | 3300049585 | Bacteria | 26900 |
| 305 | Ga0501069_0353946 | 3300049585 | Bacteria | 866 |
| 306 | Ga0501070_0023506 | 3300049586 | Bacteria | 5162 |
| 307 | Ga0501070_0133177 | 3300049586 | Bacteria | 2053 |
| 308 | Ga0501071_0010308 | 3300049587 | Bacteria | 6258 |
| 309 | Ga0501071_0197871 | 3300049587 | Bacteria | 1509 |
| 310 | Ga0501072_0296609 | 3300049588 | Bacteria | 1285 |
| 311 | Ga0501073_0010379 | 3300049589 | Bacteria | 6831 |
| 312 | Ga0501074_0016311 | 3300049590 | Bacteria | 5393 |
| 313 | Ga0501238_011374 | 3300049671 | Bacteria | 1196 |
| 314 | Ga0501079_0042948 | 3300049741 | Bacteria | 3490 |
| 315 | Ga0501080_0046449 | 3300049742 | Bacteria | 4043 |
| 316 | Ga0501080_0475799 | 3300049742 | Bacteria | 1118 |
| 317 | Ga0501083_0000434 | 3300049744 | Bacteria | 26877 |
| 318 | Ga0501241_015982 | 3300049758 | Bacteria | 1367 |
| 319 | Ga0501035_0000791 | 3300049822 | Bacteria | 33749 |
| 320 | Ga0501035_0001209 | 3300049822 | Bacteria | 26896 |
| 321 | Ga0501035_0044869 | 3300049822 | Bacteria | 3978 |
| 322 | Ga0501035_0132164 | 3300049822 | Bacteria | 2175 |
| 323 | Ga0501035_0415868 | 3300049822 | Bacteria | 1117 |
| 324 | Ga0501044_0008505 | 3300049823 | Bacteria | 11247 |
| 325 | Ga0501044_0014505 | 3300049823 | Bacteria | 8500 |
| 326 | Ga0501044_0052558 | 3300049823 | Bacteria | 4197 |
| 327 | Ga0501044_0154669 | 3300049823 | Bacteria | 2273 |
| 328 | Ga0501044_0164008 | 3300049823 | Bacteria | 2197 |
| 329 | nmdc:mga03683_15150_c1 | 3300050489 | Bacteria | 2872 |
| 330 | nmdc:mga03683_8953_c1 | 3300050489 | Bacteria | 3541 |
| 331 | nmdc:mga03n38_353643_c1 | 3300050490 | Bacteria | 800 |
| 332 | nmdc:mga00v17_102107_c1 | 3300050491 | Bacteria | 1811 |
| 333 | nmdc:mga00v17_14211_c1 | 3300050491 | Bacteria | 4440 |
| 334 | nmdc:mga0yw44_104761_c1 | 3300050492 | Bacteria | 1280 |
| 335 | nmdc:mga0yw44_186993_c1 | 3300050492 | Bacteria | 1365 |
| 336 | nmdc:mga0yw44_48933_c1 | 3300050492 | Bacteria | 2550 |
| 337 | nmdc:mga0k408_105410_c1 | 3300050493 | Bacteria | 1664 |
| 338 | nmdc:mga06z11_187730_c1 | 3300050494 | Bacteria | 1195 |
| 339 | nmdc:mga06z11_51697_c1 | 3300050494 | Bacteria | 2105 |
| 340 | nmdc:mga07m45_42905_c1 | 3300050496 | Bacteria | 2536 |
| 341 | nmdc:mga05p37_22572_c1 | 3300050507 | Bacteria | 7631 |
| 342 | nmdc:mga05p37_79233_c1 | 3300050507 | Bacteria | 4045 |
| 343 | nmdc:mga08y16_301492_c1 | 3300050511 | Bacteria | 1651 |
| 344 | nmdc:mga08y16_508921_c1 | 3300050511 | Bacteria | 1222 |
| 345 | nmdc:mga0sz30_15664_c1 | 3300050516 | Bacteria | 2998 |
| 346 | nmdc:mga0sz30_84123_c1 | 3300050516 | Bacteria | 1379 |
| 347 | Ga0500610_0023913 | 3300053079 | Bacteria | 3031 |
| 348 | Ga0495655_0027987 | 3300053083 | Bacteria | 1342 |
| 349 | Ga0500641_0015702 | 3300053096 | Bacteria | 2815 |
| 350 | Ga0500593_000442 | 3300053117 | Bacteria | 16334 |
| 351 | Ga0500618_000118 | 3300053125 | Bacteria | 64472 |
| 352 | Ga0500618_005648 | 3300053125 | Bacteria | 3773 |
| 353 | Ga0500658_0006159 | 3300053134 | Bacteria | 4463 |
| 354 | Ga0500568_0000002 | 3300053139 | Bacteria | 880601 |
| 355 | Ga0500568_0023208 | 3300053139 | Bacteria | 2641 |
| 356 | Ga0500590_000037 | 3300053148 | Bacteria | 31191 |
| 357 | Ga0500590_003038 | 3300053148 | Bacteria | 7636 |
| 358 | Ga0500604_0002218 | 3300053151 | Bacteria | 5331 |
| 359 | Ga0500604_0045878 | 3300053151 | Bacteria | 1335 |
| 360 | Ga0500616_0000108 | 3300053153 | Bacteria | 152917 |
| 361 | Ga0500616_0023485 | 3300053153 | Bacteria | 3434 |
| 362 | Ga0500633_0001175 | 3300053160 | Bacteria | 4769 |
| 363 | Ga0500636_0000013 | 3300053177 | Bacteria | 130122 |
| 364 | Ga0590077_008423 | 3300059426 | Bacteria | 2111 |
| 365 | Ga0587088_024576 | 3300059508 | Bacteria | 1034 |
| 366 | Ga0587072_001056 | 3300059643 | Bacteria | 3229 |
| 367 | 2510136417 | 2510065019 | Bacteria | 6903379 |
| 368 | 2510892575 | 2510461076 | Bacteria | 8618824 |
| 369 | 2513568046 | 2513237084 | Bacteria | 7231967 |
| 370 | 2513619358 | 2513237091 | Bacteria | 6900273 |
| 371 | 2514018553 | 2513237162 | Bacteria | 7468464 |
| 372 | 2515108627 | 2515075009 | Bacteria | 7288508 |
| 373 | 2515632468 | 2515154113 | Bacteria | 7807172 |
| 374 | 2515640645 | 2515154114 | Bacteria | 7848616 |
| 375 | 2515661365 | 2515154116 | Bacteria | 7552979 |
| 376 | 2517410271 | 2517287029 | Bacteria | 6905599 |
| 377 | 2530644624 | 2529292951 | Bacteria | 6916614 |
| 378 | 2551676978 | 2551306084 | Bacteria | 8942552 |
| 379 | 2551686771 | 2551306085 | Bacteria | 7347181 |
| 380 | 2551702183 | 2551306087 | Bacteria | 7351905 |
| 381 | 2551720902 | 2551306090 | Bacteria | 7953713 |
| 382 | 2551741497 | 2551306093 | Bacteria | 7064773 |
| 383 | 2554249219 | 2554235003 | Bacteria | 5877155 |
| 384 | 2554249782 | 2554235003 | Bacteria | 5877155 |
| 385 | 2585397242 | 2582581866 | Bacteria | 6859583 |
| 386 | 2599416645 | 2599185170 | Bacteria | 7295545 |
| 387 | 2599722928 | 2599185236 | Bacteria | 6875203 |
| 388 | 2601612995 | 2600255279 | Bacteria | 5605316 |
| 389 | 2601749729 | 2600255308 | Bacteria | 5611129 |
| 390 | 2616295203 | 2615840624 | Bacteria | 6557588 |
| 391 | 2616309893 | 2615840626 | Bacteria | 7921970 |
| 392 | 2616550845 | 2615840698 | Bacteria | 7319877 |
| 393 | 2643805134 | 2643221557 | Bacteria | 7184309 |
| 394 | 2644005638 | 2643221599 | Bacteria | 6292121 |
| 395 | 2644065627 | 2643221610 | Bacteria | 7480339 |
| 396 | 2644146882 | 2643221626 | Bacteria | 8069654 |
| 397 | 2644310766 | 2643221655 | Bacteria | 7722067 |
| 398 | 2644334448 | 2643221659 | Bacteria | 7890716 |
| 399 | 2644375397 | 2643221668 | Bacteria | 7306521 |
| 400 | 2644417953 | 2643221675 | Bacteria | 7473456 |
| 401 | 2644451124 | 2643221680 | Bacteria | 7473610 |
| 402 | 2644493163 | 2643221688 | Bacteria | 5260751 |
| 403 | 2644501541 | 2643221689 | Bacteria | 6042950 |
| 404 | 2644520076 | 2643221693 | Bacteria | 5513853 |
| 405 | 2644545356 | 2643221698 | Bacteria | 7756764 |
| 406 | 2644616600 | 2643221712 | Bacteria | 7729434 |
| 407 | 2644673464 | 2643221723 | Bacteria | 7095460 |
| 408 | 2644674559 | 2643221723 | Bacteria | 7095460 |
| 409 | 2644687471 | 2643221726 | Bacteria | 7455827 |
| 410 | 2719183764 | 2718217882 | Bacteria | 6556348 |
| 411 | 2719668063 | 2718217997 | Bacteria | 6740740 |
| 412 | 2719728205 | 2718218009 | Bacteria | 6478651 |
| 413 | 2720494826 | 2718218199 | Bacteria | 6740745 |
| 414 | 2720611148 | 2718218232 | Bacteria | 6720332 |
| 415 | 2720616320 | 2718218233 | Bacteria | 6662049 |
| 416 | 2720629395 | 2718218235 | Bacteria | 6630699 |
| 417 | 2720771966 | 2718218269 | Bacteria | 6906114 |
| 418 | 2721145066 | 2718218363 | Bacteria | 6524337 |
| 419 | 2721155803 | 2718218365 | Bacteria | 6274507 |
| 420 | 2721167153 | 2718218366 | Bacteria | 6425255 |
| 421 | 2722838131 | 2721755514 | Bacteria | 6424414 |
| 422 | 2723029396 | 2721755556 | Bacteria | 6745503 |
| 423 | 2723563012 | 2721755684 | Bacteria | 6859907 |
| 424 | 2723570993 | 2721755685 | Bacteria | 6704835 |
| 425 | 2724042399 | 2721755810 | Bacteria | 6479005 |
| 426 | 2724086786 | 2721755819 | Bacteria | 6906405 |
| 427 | 2724106944 | 2721755822 | Bacteria | 6726041 |
| 428 | 2724107753 | 2721755823 | Bacteria | 6752556 |
| 429 | 2730105710 | 2728369352 | Bacteria | 6745171 |
| 430 | 2730161904 | 2728369365 | Bacteria | 6555560 |
| 431 | 2730300910 | 2728369397 | Bacteria | 6274511 |
| 432 | 2793324051 | 2791355260 | Bacteria | 6598818 |
| 433 | 2793343413 | 2791355263 | Bacteria | 6872478 |
| 434 | 2793346240 | 2791355264 | Bacteria | 6429314 |
| 435 | 2793355460 | 2791355265 | Bacteria | 6539969 |
| 436 | 2805930679 | 2802429605 | Bacteria | 6875453 |
| 437 | 2805934139 | 2802429606 | Bacteria | 6346811 |
| 438 | 2808989808 | 2808606387 | Bacteria | 5697198 |
| 439 | 2819561540 | 2818991439 | Bacteria | 6907412 |
| 440 | 2819613772 | 2818991448 | Bacteria | 6772224 |
| 441 | 2819642770 | 2818991453 | Bacteria | 7181617 |
| 442 | 2819688833 | 2818991461 | Bacteria | 7026071 |
| 443 | 2838019458 | 2838016132 | Bacteria | 6577831 |
| 444 | 2838025084 | 2838022645 | Bacteria | 6494267 |
| 445 | 2838036753 | 2838035591 | Bacteria | 7166484 |
| 446 | 2838050564 | 2838048938 | Bacteria | 6044578 |
| 447 | 2838062858 | 2838061910 | Bacteria | 6794874 |
| 448 | 2838071806 | 2838068647 | Bacteria | 6208656 |
| 449 | 2838662213 | 2838661181 | Bacteria | 7385261 |
| 450 | 2838671317 | 2838668709 | Bacteria | 6671819 |
| 451 | 2838703502 | 2838701080 | Bacteria | 6669771 |
| 452 | 2842149496 | 2842146304 | Bacteria | 5957337 |
| 453 | 2842197736 | 2842192696 | Bacteria | 6147454 |
| 454 | 2842203284 | 2842198810 | Bacteria | 6608673 |
| 455 | 2842210275 | 2842205361 | Bacteria | 6340321 |
| 456 | 2842253866 | 2842250916 | Bacteria | 6579627 |
| 457 | 2842268009 | 2842264693 | Bacteria | 6472963 |
| 458 | 2842283729 | 2842278818 | Bacteria | 6340002 |
| 459 | 2842289694 | 2842285085 | Bacteria | 6011953 |
| 460 | 2842311770 | 2842311132 | Bacteria | 6616990 |
| 461 | 2842321570 | 2842317721 | Bacteria | 6793725 |
| 462 | 2842401078 | 2842395702 | Bacteria | 6780583 |
| 463 | 2842407165 | 2842402390 | Bacteria | 6681310 |
| 464 | 2842414057 | 2842409023 | Bacteria | 6687331 |
| 465 | 2842420698 | 2842415677 | Bacteria | 6596907 |
| 466 | 2842425439 | 2842422224 | Bacteria | 6239196 |
| 467 | 2842432172 | 2842428310 | Bacteria | 6767288 |
| 468 | 2842438284 | 2842434925 | Bacteria | 6502746 |
| 469 | 2842443980 | 2842441272 | Bacteria | 6769273 |
| 470 | 2842450148 | 2842447887 | Bacteria | 6754142 |
| 471 | 2842466270 | 2842462802 | Bacteria | 6588055 |
| 472 | 2842472746 | 2842469257 | Bacteria | 6752936 |
| 473 | 2842493095 | 2842489311 | Bacteria | 6620893 |
| 474 | 2842499337 | 2842495871 | Bacteria | 6820686 |
| 475 | 2842500805 | 2842495871 | Bacteria | 6820686 |
| 476 | 2842515466 | 2842509118 | Bacteria | 6850950 |
| 477 | 2842525591 | 2842521101 | Bacteria | 6569494 |
| 478 | 2844165866 | 2844163670 | Bacteria | 7266046 |
| 479 | 2854915613 | 2854911287 | Bacteria | 5582813 |
| 480 | 2854920143 | 2854916844 | Bacteria | 5725939 |
| 481 | 2855830189 | 2855825444 | Bacteria | 6785811 |
| 482 | 2855875531 | 2855872281 | Bacteria | 6964271 |
| 483 | 2899848168 | 2899845264 | Bacteria | 5672268 |
| 484 | 2903451722 | 2903448605 | Bacteria | 7357801 |
| 485 | 2915996037 | 2915993759 | Bacteria | 7016183 |
| 486 | 2916014225 | 2916007675 | Bacteria | 6898660 |
| 487 | 2916017195 | 2916014648 | Bacteria | 6946486 |
| 488 | 2916041010 | 2916035215 | Bacteria | 6755766 |
| 489 | 2916048258 | 2916041962 | Bacteria | 6820487 |
| 490 | 2916075950 | 2916068649 | Bacteria | 6943657 |
| 491 | 2919104915 | 2919100787 | Bacteria | 7710546 |
| 492 | 2919170905 | 2919166419 | Bacteria | 4952238 |
| 493 | 2919176213 | 2919171160 | Bacteria | 6499771 |
| 494 | 2921215263 | 2921208531 | Bacteria | 6745326 |
| 495 | 2921241814 | 2921237296 | Bacteria | 6876710 |
| 496 | 2921287947 | 2921282425 | Bacteria | 6826397 |
| 497 | 2921297355 | 2921296804 | Bacteria | 7176999 |
| 498 | 2924149728 | 2924144063 | Bacteria | 6883928 |
| 499 | 2924152998 | 2924150972 | Bacteria | 7169444 |
| 500 | 2924161481 | 2924158325 | Bacteria | 7188855 |
| 501 | 2924169381 | 2924165586 | Bacteria | 7260590 |
| 502 | 2924190498 | 2924186466 | Bacteria | 6876637 |
| 503 | 2924205483 | 2924200457 | Bacteria | 6757188 |
| 504 | 2924219040 | 2924214083 | Bacteria | 7080103 |
| 505 | 2924225945 | 2924221636 | Bacteria | 7113495 |
| 506 | 2924232677 | 2924228884 | Bacteria | 6633132 |
| 507 | 2929142497 | 2929138655 | Bacteria | 5810547 |
| 508 | 2933598842 | 2933594066 | Bacteria | 5594265 |
| 509 | 2933602601 | 2933599457 | Bacteria | 5858799 |
| 510 | 2936386353 | 2936381700 | Bacteria | 7006523 |
| 511 | 2937006297 | 2937002841 | Bacteria | 6934057 |
| 512 | 2937019901 | 2937016420 | Bacteria | 6782579 |
| 513 | 2937068465 | 2937063883 | Bacteria | 7199456 |
| 514 | 2937092685 | 2937091812 | Bacteria | 6979387 |
| 515 | 2937104289 | 2937098957 | Bacteria | 7249374 |
| 516 | 2937123280 | 2937119839 | Bacteria | 6597547 |
| 517 | 2937851811 | 2937848649 | Bacteria | 6983481 |
| 518 | 2941506568 | 2941499720 | Bacteria | 7599444 |
| 519 | 2957385511 | 2957382221 | Bacteria | 6737050 |
| 520 | 2957391084 | 2957388812 | Bacteria | 6778072 |
| 521 | 2957405008 | 2957402308 | Bacteria | 6741770 |
| 522 | 2957413600 | 2957408893 | Bacteria | 6558585 |
| 523 | 2957415566 | 2957415311 | Bacteria | 6991633 |
| 524 | 2957433727 | 2957430029 | Bacteria | 7022557 |
| 525 | 2957447427 | 2957443900 | Bacteria | 6869977 |
| 526 | 2957470261 | 2957464669 | Bacteria | 6568877 |
| 527 | 2957473737 | 2957471148 | Bacteria | 6797643 |
| 528 | 2957487449 | 2957484790 | Bacteria | 6703082 |
| 529 | 2957492572 | 2957491536 | Bacteria | 6695180 |
| 530 | 2957503423 | 2957498199 | Bacteria | 7126688 |
| 531 | 2957510778 | 2957505466 | Bacteria | 7253085 |
| 532 | 2960586510 | 2960584000 | Bacteria | 6864594 |
| 533 | 2960606764 | 2960603979 | Bacteria | 6898737 |
| 534 | 2960614956 | 2960610863 | Bacteria | 6691244 |
| 535 | 2960628557 | 2960624210 | Bacteria | 6875384 |
| 536 | 2960642889 | 2960637947 | Bacteria | 7296468 |
| 537 | 2960649415 | 2960645483 | Bacteria | 7211087 |
| 538 | 2960663139 | 2960660292 | Bacteria | 7041660 |
| 539 | 2960674737 | 2960674078 | Bacteria | 6609048 |
| 540 | 2964628705 | 2964621998 | Bacteria | 6834995 |
| 541 | 2964653267 | 2964649959 | Bacteria | 6675118 |
| 542 | 2964659855 | 2964656573 | Bacteria | 7100150 |
| 543 | 2964676442 | 2964670856 | Bacteria | 6851364 |
| 544 | 2964680292 | 2964678106 | Bacteria | 6792020 |
| 545 | 2964690512 | 2964685014 | Bacteria | 6839111 |
| 546 | 2964718031 | 2964712639 | Bacteria | 6695970 |
| 547 | 2964725269 | 2964719344 | Bacteria | 7286602 |
| 548 | 2967683745 | 2967678726 | Bacteria | 7264382 |
| 549 | 2967697609 | 2967693043 | Bacteria | 6804451 |
| 550 | 2967711347 | 2967706974 | Bacteria | 7186053 |
| 551 | 2967718022 | 2967714385 | Bacteria | 7000047 |
| 552 | 2967724445 | 2967721400 | Bacteria | 7073753 |
| 553 | 2967738079 | 2967735183 | Bacteria | 6827012 |
| 554 | 2967748329 | 2967742019 | Bacteria | 6794534 |
| 555 | 2967750644 | 2967748971 | Bacteria | 6733771 |
| 556 | 2967774330 | 2967769361 | Bacteria | 6587838 |
| 557 | 2968087304 | 2968083720 | Bacteria | 7351627 |
| 558 | 2968141695 | 2968138860 | Bacteria | 6605449 |
| 559 | 2970024589 | 2970019648 | Bacteria | 7072033 |
| 560 | 2970038460 | 2970033650 | Bacteria | 7118744 |
| 561 | 2970058141 | 2970054988 | Bacteria | 6611507 |
| 562 | 2970063653 | 2970061556 | Bacteria | 7099761 |
| 563 | 2970073524 | 2970068827 | Bacteria | 7123112 |
| 564 | 2970077600 | 2970076120 | Bacteria | 6697332 |
| 565 | 2970091436 | 2970088815 | Bacteria | 6933825 |
| 566 | 2970112543 | 2970109326 | Bacteria | 6863976 |
| 567 | 2970133138 | 2970129317 | Bacteria | 6806560 |
| 568 | 2970142422 | 2970136068 | Bacteria | 7207982 |
| 569 | 2970159263 | 2970156795 | Bacteria | 7168044 |
| 570 | 2970168774 | 2970164137 | Bacteria | 6861252 |
| 571 | 2970175411 | 2970170962 | Bacteria | 6876229 |
| 572 | 2970188587 | 2970184632 | Bacteria | 7054431 |
| 573 | 2970195749 | 2970191845 | Bacteria | 7032787 |
| 574 | 2977526450 | 2977523885 | Bacteria | 6960446 |
| 575 | 2977543038 | 2977537788 | Bacteria | 6929320 |
| 576 | 2977555449 | 2977551784 | Bacteria | 7125765 |
| 577 | 2977564622 | 2977558990 | Bacteria | 6863948 |
| 578 | 2977572483 | 2977565890 | Bacteria | 6901543 |
| 579 | 2977576709 | 2977572785 | Bacteria | 6763888 |
| 580 | 2977923332 | 2977922695 | Bacteria | 6956781 |
| 581 | 2978974998 | 2978969890 | Bacteria | 5400756 |
| 582 | 2979091918 | 2979089926 | Bacteria | 5670289 |
| 583 | 2979100867 | 2979095461 | Bacteria | 5669583 |
| 584 | 2984514363 | 2984509177 | Bacteria | 5274802 |
| 585 | 2984523394 | 2984518228 | Bacteria | 5277463 |
| 586 | 2984542584 | 2984537506 | Bacteria | 5277481 |
| 587 | 2984589001 | 2984587000 | Bacteria | 5263363 |
| 588 | 2984606479 | 2984601300 | Bacteria | 5455244 |
| 589 | 2996889640 | 2996887358 | Bacteria | 5795980 |
| 590 | 3004212332 | 3004211236 | Bacteria | 7417683 |
| 591 | 3004224435 | 3004218560 | Bacteria | 7421728 |
| 592 | 3005418055 | 3005416602 | Bacteria | 7064308 |
| 593 | 3005452559 | 3005445848 | Bacteria | 6906074 |
| 594 | 637080542 | 637000159 | Bacteria | 7596297 |
| 595 | 8002286556 | 8002285264 | Bacteria | 6717907 |
| 596 | 8003997511 | 8003992118 | Bacteria | 7266902 |
| 597 | 8005287838 | 8005282627 | Bacteria | 6675747 |
| 598 | 8005290656 | 8005289223 | Bacteria | 6634003 |
| 599 | 8005305022 | 8005301065 | Bacteria | 6614431 |
| 600 | 8005320023 | 8005314921 | Bacteria | 7072929 |
| 601 | 8005324167 | 8005321885 | Bacteria | 5795980 |
| 602 | 8005388476 | 8005382845 | Bacteria | 6732062 |
| 603 | 8005397642 | 8005395548 | Bacteria | 6806915 |
| 604 | 8005399270 | 8005395548 | Bacteria | 6806915 |
| 605 | 8005436993 | 8005430974 | Bacteria | 6689030 |
| 606 | 8005467199 | 8005460587 | Bacteria | 7157962 |
| 607 | 8005503075 | 8005497431 | Bacteria | 6477605 |
| 608 | 8005625594 | 8005619151 | Bacteria | 7030230 |
| 609 | 8005626107 | 8005619151 | Bacteria | 7030230 |
| 610 | 8005630617 | 8005626139 | Bacteria | 6534237 |
| 611 | 8005674993 | 8005668836 | Bacteria | 6953162 |
| 612 | 8005683428 | 8005682033 | Bacteria | 6726518 |
| 613 | 8005689434 | 8005688590 | Bacteria | 6610080 |
| 614 | 8018130452 | 8018127388 | Bacteria | 7351159 |
| 615 | 8018181193 | 8018176218 | Bacteria | 6896178 |
| 616 | 8024491214 | 8024486573 | Bacteria | 6540512 |
| 617 | 8024506121 | 8024501048 | Bacteria | 6427847 |
| 618 | 8056383519 | 8056382006 | Bacteria | 6408074 |
| 619 | Ga0081455_10000305 | |||
| 620 | JGI25152J39213_1009888 | |||
| 621 | JGI25151J46595_10001032 | |||
| 622 | JGI25151J46595_10002384 | |||
| 623 | JGI25151J46595_10059739 | |||
| 624 | JGI25165J46597_1000159 | |||
| 625 | rootH2_10157225 | |||
| 626 | rootH1_10056806 | |||
| 627 | rootH1_10062594 | |||
| 628 | JGI25161J50226_1001088 | |||
| 629 | Ga0055542_1000644 | |||
| 630 | Ga0055529_1003184 | |||
| 631 | Ga0055526_1001823 | |||
| 632 | Ga0055524_1008749 | |||
| 633 | Ga0055536_1001554 | |||
| 634 | Ga0055536_1005522 | |||
| 635 | Ga0055530_10008550 | |||
| 636 | Ga0055540_1000439 | |||
| 637 | Ga0055531_10002843 | |||
| 638 | Ga0055531_10003010 | |||
| 639 | Ga0055531_10004825 | |||
| 640 | Ga0058692_1003121 | |||
| 641 | Ga0065165_1000672 | |||
| 642 | Ga0070670_100004393 | |||
| 643 | Ga0070680_100287278 | |||
| 644 | Ga0070668_100447171 | |||
| 645 | Ga0070669_100107443 | |||
| 646 | Ga0070675_100052208 | |||
| 647 | Ga0070674_100004459 | |||
| 648 | Ga0070673_100213381 | |||
| 649 | Ga0070688_100082867 | |||
| 650 | Ga0070700_100110022 | |||
| 651 | Ga0070681_10306735 | |||
| 652 | Ga0070665_100087236 | |||
| 653 | Ga0068856_100022618 | |||
| 654 | Ga0068861_100035625 | |||
| 655 | Ga0081455_10013447 | |||
| 656 | Ga0081540_1040237 | |||
| 657 | Ga0081539_10003002 | |||
| 658 | Ga0081539_10008935 | |||
| 659 | Ga0075363_100126081 | |||
| 660 | Ga0075364_10011001 | |||
| 661 | Ga0075362_10017145 | |||
| 662 | Ga0075362_10027328 | |||
| 663 | Ga0075367_10093846 | |||
| 664 | Ga0075367_10100202 | |||
| 665 | Ga0075369_10009799 | |||
| 666 | Ga0075369_10016020 | |||
| 667 | Ga0075369_10088593 | |||
| 668 | Ga0075366_10044392 | |||
| 669 | Ga0075370_10153140 | |||
| 670 | Ga0075428_100184505 | |||
| 671 | Ga0075430_100296739 | |||
| 672 | Ga0105240_10366343 | |||
| 673 | Ga0105240_10430927 | |||
| 674 | Ga0111539_10239744 | |||
| 675 | Ga0111539_10502227 | |||
| 676 | Ga0111539_10546791 | |||
| 677 | Ga0105247_10063908 | |||
| 678 | Ga0114129_10067744 | |||
| 679 | Ga0105243_10039078 | |||
| 680 | Ga0105243_10214195 | |||
| 681 | Ga0105237_10000038 | |||
| 682 | Ga0105237_10211574 | |||
| 683 | Ga0105237_10873642 | |||
| 684 | Ga0105238_10243963 | |||
| 685 | Ga0105238_10274796 | |||
| 686 | Ga0105238_10311463 | |||
| 687 | Ga0105238_10342500 | |||
| 688 | Ga0105249_10330702 | |||
| 689 | Ga0105239_10000065 | |||
| 690 | Ga0105239_10002418 | |||
| 691 | Ga0105239_10455016 | |||
| 692 | Ga0105239_10590416 | |||
| 693 | Ga0157373_10001149 | |||
| 694 | Ga0157373_10028466 | |||
| 695 | Ga0157371_10005936 | |||
| 696 | Ga0157370_10000054 | |||
| 697 | Ga0157369_10103813 | |||
| 698 | Ga0157374_10558416 | |||
| 699 | Ga0163162_10646939 | |||
| 700 | Ga0157372_10169581 | |||
| 701 | Ga0163163_10260203 | |||
| 702 | Ga0157380_10004845 | |||
| 703 | Ga0182006_1043515 | |||
| 704 | Ga0182007_10011902 | |||
| 705 | Ga0209436_100157 | |||
| 706 | Ga0209437_100023 | |||
| 707 | Ga0209437_113631 | |||
| 708 | Ga0209677_100525 | |||
| 709 | Ga0209148_1000126 | |||
| 710 | Ga0209148_1007709 | |||
| 711 | Ga0209129_1000070 | |||
| 712 | Ga0209233_1000127 | |||
| 713 | Ga0209233_1000214 | |||
| 714 | Ga0209455_1000105 | |||
| 715 | Ga0209673_1036445 | |||
| 716 | Ga0209130_1000242 | |||
| 717 | Ga0209676_1001945 | |||
| 718 | Ga0209676_1025564 | |||
| 719 | Ga0209025_1000175 | |||
| 720 | Ga0209025_1000240 | |||
| 721 | Ga0209025_1001648 | |||
| 722 | Ga0209025_1002267 | |||
| 723 | Ga0209564_1000338 | |||
| 724 | Ga0209564_1000341 | |||
| 725 | Ga0209758_1030208 | |||
| 726 | Ga0209758_1042558 | |||
| 727 | Ga0209050_1012027 | |||
| 728 | Ga0209256_1000534 | |||
| 729 | Ga0209256_1000573 | |||
| 730 | Ga0207426_1000483 | |||
| 731 | Ga0207426_1022166 | |||
| 732 | Ga0209051_1000192 | |||
| 733 | Ga0209051_1020577 | |||
| 734 | Ga0209051_1020896 | |||
| 735 | Ga0209257_1000300 | |||
| 736 | Ga0209257_1002029 | |||
| 737 | Ga0209257_1005011 | |||
| 738 | Ga0207710_10073308 | |||
| 739 | Ga0207699_10055720 | |||
| 740 | Ga0207695_10206822 | |||
| 741 | Ga0207695_10266521 | |||
| 742 | Ga0207695_10284633 | |||
| 743 | Ga0207671_10000418 | |||
| 744 | Ga0207693_10208515 | |||
| 745 | Ga0207657_10023716 | |||
| 746 | Ga0207649_10388056 | |||
| 747 | Ga0207652_10366347 | |||
| 748 | Ga0207681_10066348 | |||
| 749 | Ga0207694_10067404 | |||
| 750 | Ga0207650_10007578 | |||
| 751 | Ga0207690_10269967 | |||
| 752 | Ga0207690_10564547 | |||
| 753 | Ga0207706_10301134 | |||
| 754 | Ga0207670_10205294 | |||
| 755 | Ga0207669_10040098 | |||
| 756 | Ga0207704_10063642 | |||
| 757 | Ga0207691_10188663 | |||
| 758 | Ga0207679_10267230 | |||
| 759 | Ga0207712_10222037 | |||
| 760 | Ga0207640_10413754 | |||
| 761 | Ga0207678_10238766 | |||
| 762 | Ga0207702_10183324 | |||
| 763 | Ga0207674_10491400 | |||
| 764 | Ga0207674_10494513 | |||
| 765 | Ga0207675_100036936 | |||
| 766 | Ga0207675_100437391 | |||
| 767 | Ga0209371_1001722 | |||
| 768 | Ga0209371_1009909 | |||
| 769 | Ga0209282_1000093 | |||
| 770 | Ga0268256_1000785 | |||
| 771 | Ga0268256_1002551 | |||
| 772 | Ga0265331_10053692 | |||
| 773 | Ga0307410_10029864 | |||
| 774 | Ga0307406_10489217 | |||
| 775 | Ga0307407_10003714 | |||
| 776 | Ga0307409_100002825 | |||
| 777 | Ga0307416_100265949 | |||
| 778 | Ga0307414_10072585 | |||
| 779 | Ga0307414_10152125 | |||
| 780 | Ga0307414_10353236 | |||
| 781 | Ga0307415_100176168 | |||
| 782 | Ga0373941_0009623 | |||
| 783 | Ga0395899_0002239 | |||
| 784 | Ga0395898_0004769 | |||
| 785 | Ga0395898_0284805 | |||
| 786 | Ga0395905_0000321 | |||
| 787 | Ga0395905_0068400 | |||
| 788 | Ga0395901_0011113 | |||
| 789 | Ga0395901_0404495 | |||
| 790 | Ga0436360_0886486 | |||
| 791 | Ga0436360_1098593 | |||
| 792 | Ga0436361_0694290 | |||
| 793 | Ga0439436_0000279 | |||
| 794 | Ga0439438_012958 | |||
| 795 | Ga0439466_0043540 | |||
| 796 | Ga0439465_0000751 | |||
| 797 | Ga0439465_0001030 | |||
| 798 | Ga0439465_0003064 | |||
| 799 | Ga0451837_0672962 | |||
| 800 | Ga0451839_0286878 | |||
| 801 | Ga0451841_0324813 | |||
| 802 | Ga0451847_0135229 | |||
| 803 | Ga0451849_0802431 | |||
| 804 | Ga0451851_0116375 | |||
| 805 | Ga0439448_0075249 | |||
| 806 | Ga0439449_0081664 | |||
| 807 | Ga0439458_0022365 | |||
| 808 | Ga0439434_0012924 | |||
| 809 | Ga0466963_0040293 | |||
| 810 | Ga0466964_0030426 | |||
| 811 | Ga0466970_0000092 | |||
| 812 | Ga0466957_0046159 | |||
| 813 | Ga0466958_0007987 | |||
| 814 | Ga0466967_0140912 | |||
| 815 | Ga0495629_0086413 | |||
| 816 | Ga0495662_0024171 | |||
| 817 | Ga0495585_0059838 | |||
| 818 | Ga0495607_0044822 | |||
| 819 | Ga0495610_0000016 | |||
| 820 | Ga0495631_0025953 | |||
| 821 | Ga0495643_0024612 | |||
| 822 | Ga0495643_0026497 | |||
| 823 | Ga0495643_0087487 | |||
| 824 | Ga0495587_0123022 | |||
| 825 | Ga0495633_0000895 | |||
| 826 | Ga0495633_0012830 | |||
| 827 | Ga0495656_0025327 | |||
| 828 | Ga0495668_0004965 | |||
| 829 | Ga0495625_0000210 | |||
| 830 | Ga0495625_0007985 | |||
| 831 | Ga0495625_0165735 | |||
| 832 | Ga0495635_0203402 | |||
| 833 | Ga0495661_0107895 | |||
| 834 | Ga0495588_0122961 | |||
| 835 | Ga0495657_0123810 | |||
| 836 | Ga0495658_0302504 | |||
| 837 | Ga0495649_0000001 | |||
| 838 | Ga0495600_0054695 | |||
| 839 | Ga0495600_0262563 | |||
| 840 | Ga0495660_0000673 | |||
| 841 | Ga0495660_0023648 | |||
| 842 | Ga0495604_0007159 | |||
| 843 | Ga0495681_0000507 | |||
| 844 | Ga0495681_0094207 | |||
| 845 | Ga0495686_0000895 | |||
| 846 | Ga0495686_0002749 | |||
| 847 | Ga0495686_0003551 | |||
| 848 | Ga0495686_0015440 | |||
| 849 | Ga0496109_0244347 | |||
| 850 | Ga0496109_0404302 | |||
| 851 | Ga0496110_0401827 | |||
| 852 | Ga0496116_0000247 | |||
| 853 | Ga0496116_0003190 | |||
| 854 | Ga0496116_0006733 | |||
| 855 | Ga0496116_0018236 | |||
| 856 | Ga0496116_0048266 | |||
| 857 | Ga0496117_0000105 | |||
| 858 | Ga0496117_0001492 | |||
| 859 | Ga0496118_0000168 | |||
| 860 | Ga0496118_0002150 | |||
| 861 | Ga0496118_0035272 | |||
| 862 | Ga0496118_0043064 | |||
| 863 | Ga0496118_0053946 | |||
| 864 | Ga0496119_0000443 | |||
| 865 | Ga0496119_0000887 | |||
| 866 | Ga0496119_0003427 | |||
| 867 | Ga0496120_0000818 | |||
| 868 | Ga0496120_0029492 | |||
| 869 | Ga0496120_0086412 | |||
| 870 | Ga0496121_0000005 | |||
| 871 | Ga0496121_0018333 | |||
| 872 | Ga0496121_0073906 | |||
| 873 | Ga0496121_0127272 | |||
| 874 | Ga0496122_0001241 | |||
| 875 | Ga0496122_0002116 | |||
| 876 | Ga0496122_0057250 | |||
| 877 | Ga0496122_0063057 | |||
| 878 | Ga0496122_0103503 | |||
| 879 | Ga0496122_0112205 | |||
| 880 | Ga0496123_0001704 | |||
| 881 | Ga0496123_0076032 | |||
| 882 | Ga0496123_0131321 | |||
| 883 | Ga0496123_0242544 | |||
| 884 | Ga0496124_0000091 | |||
| 885 | Ga0496124_0000254 | |||
| 886 | Ga0496124_0002483 | |||
| 887 | Ga0496124_0031267 | |||
| 888 | Ga0496124_0035183 | |||
| 889 | Ga0496124_0068831 | |||
| 890 | Ga0496125_0000034 | |||
| 891 | Ga0496125_0005508 | |||
| 892 | Ga0496125_0211900 | |||
| 893 | Ga0496126_0026321 | |||
| 894 | Ga0496126_0042165 | |||
| 895 | Ga0496126_0098573 | |||
| 896 | Ga0496126_0377732 | |||
| 897 | Ga0501032_0008593 | |||
| 898 | Ga0501032_0019882 | |||
| 899 | Ga0501032_0031140 | |||
| 900 | Ga0501033_0000350 | |||
| 901 | Ga0501033_0004563 | |||
| 902 | Ga0501034_0000109 | |||
| 903 | Ga0501034_0021544 | |||
| 904 | Ga0501034_0039043 | |||
| 905 | Ga0501034_0050108 | |||
| 906 | Ga0501034_0117395 | |||
| 907 | Ga0501036_0196698 | |||
| 908 | Ga0501037_0000193 | |||
| 909 | Ga0501037_0234790 | |||
| 910 | Ga0501037_0285631 | |||
| 911 | Ga0501038_0001744 | |||
| 912 | Ga0501038_0183214 | |||
| 913 | Ga0501039_0039516 | |||
| 914 | Ga0501039_0201911 | |||
| 915 | Ga0501041_0056638 | |||
| 916 | Ga0501043_0000861 | |||
| 917 | Ga0501043_0018589 | |||
| 918 | Ga0501043_0058567 | |||
| 919 | Ga0501047_0092662 | |||
| 920 | Ga0501068_0003917 | |||
| 921 | Ga0501068_0093202 | |||
| 922 | Ga0501069_0000193 | |||
| 923 | Ga0501069_0353946 | |||
| 924 | Ga0501070_0023506 | |||
| 925 | Ga0501070_0133177 | |||
| 926 | Ga0501071_0010308 | |||
| 927 | Ga0501071_0197871 | |||
| 928 | Ga0501072_0296609 | |||
| 929 | Ga0501073_0010379 | |||
| 930 | Ga0501074_0016311 | |||
| 931 | Ga0501238_011374 | |||
| 932 | Ga0501079_0042948 | |||
| 933 | Ga0501080_0046449 | |||
| 934 | Ga0501080_0475799 | |||
| 935 | Ga0501083_0000434 | |||
| 936 | Ga0501241_015982 | |||
| 937 | Ga0501035_0000791 | |||
| 938 | Ga0501035_0001209 | |||
| 939 | Ga0501035_0044869 | |||
| 940 | Ga0501035_0132164 | |||
| 941 | Ga0501035_0415868 | |||
| 942 | Ga0501044_0008505 | |||
| 943 | Ga0501044_0014505 | |||
| 944 | Ga0501044_0052558 | |||
| 945 | Ga0501044_0154669 | |||
| 946 | Ga0501044_0164008 | |||
| 947 | nmdc:mga03683_15150_c1 | |||
| 948 | nmdc:mga03683_8953_c1 | |||
| 949 | nmdc:mga03n38_353643_c1 | |||
| 950 | nmdc:mga00v17_102107_c1 | |||
| 951 | nmdc:mga00v17_14211_c1 | |||
| 952 | nmdc:mga0yw44_104761_c1 | |||
| 953 | nmdc:mga0yw44_186993_c1 | |||
| 954 | nmdc:mga0yw44_48933_c1 | |||
| 955 | nmdc:mga0k408_105410_c1 | |||
| 956 | nmdc:mga06z11_187730_c1 | |||
| 957 | nmdc:mga06z11_51697_c1 | |||
| 958 | nmdc:mga07m45_42905_c1 | |||
| 959 | nmdc:mga05p37_22572_c1 | |||
| 960 | nmdc:mga05p37_79233_c1 | |||
| 961 | nmdc:mga08y16_301492_c1 | |||
| 962 | nmdc:mga08y16_508921_c1 | |||
| 963 | nmdc:mga0sz30_15664_c1 | |||
| 964 | nmdc:mga0sz30_84123_c1 | |||
| 965 | Ga0500610_0023913 | |||
| 966 | Ga0495655_0027987 | |||
| 967 | Ga0500641_0015702 | |||
| 968 | Ga0500593_000442 | |||
| 969 | Ga0500618_000118 | |||
| 970 | Ga0500618_005648 | |||
| 971 | Ga0500658_0006159 | |||
| 972 | Ga0500568_0000002 | |||
| 973 | Ga0500568_0023208 | |||
| 974 | Ga0500590_000037 | |||
| 975 | Ga0500590_003038 | |||
| 976 | Ga0500604_0002218 | |||
| 977 | Ga0500604_0045878 | |||
| 978 | Ga0500616_0000108 | |||
| 979 | Ga0500616_0023485 | |||
| 980 | Ga0500633_0001175 | |||
| 981 | Ga0500636_0000013 | |||
| 982 | Ga0590077_008423 | |||
| 983 | Ga0587088_024576 | |||
| 984 | Ga0587072_001056 | |||
| 985 | 2510136417 | |||
| 986 | 2510892575 | |||
| 987 | 2513568046 | |||
| 988 | 2513619358 | |||
| 989 | 2514018553 | |||
| 990 | 2515108627 | |||
| 991 | 2515632468 | |||
| 992 | 2515640645 | |||
| 993 | 2515661365 | |||
| 994 | 2517410271 | |||
| 995 | 2530644624 | |||
| 996 | 2551676978 | |||
| 997 | 2551686771 | |||
| 998 | 2551702183 | |||
| 999 | 2551720902 | |||
| 1000 | 2551741497 | |||
| 1001 | 2554249219 | |||
| 1002 | 2554249782 | |||
| 1003 | 2585397242 | |||
| 1004 | 2599416645 | |||
| 1005 | 2599722928 | |||
| 1006 | 2601612995 | |||
| 1007 | 2601749729 | |||
| 1008 | 2616295203 | |||
| 1009 | 2616309893 | |||
| 1010 | 2616550845 | |||
| 1011 | 2643805134 | |||
| 1012 | 2644005638 | |||
| 1013 | 2644065627 | |||
| 1014 | 2644146882 | |||
| 1015 | 2644310766 | |||
| 1016 | 2644334448 | |||
| 1017 | 2644375397 | |||
| 1018 | 2644417953 | |||
| 1019 | 2644451124 | |||
| 1020 | 2644493163 | |||
| 1021 | 2644501541 | |||
| 1022 | 2644520076 | |||
| 1023 | 2644545356 | |||
| 1024 | 2644616600 | |||
| 1025 | 2644673464 | |||
| 1026 | 2644674559 | |||
| 1027 | 2644687471 | |||
| 1028 | 2719183764 | |||
| 1029 | 2719668063 | |||
| 1030 | 2719728205 | |||
| 1031 | 2720494826 | |||
| 1032 | 2720611148 | |||
| 1033 | 2720616320 | |||
| 1034 | 2720629395 | |||
| 1035 | 2720771966 | |||
| 1036 | 2721145066 | |||
| 1037 | 2721155803 | |||
| 1038 | 2721167153 | |||
| 1039 | 2722838131 | |||
| 1040 | 2723029396 | |||
| 1041 | 2723563012 | |||
| 1042 | 2723570993 | |||
| 1043 | 2724042399 | |||
| 1044 | 2724086786 | |||
| 1045 | 2724106944 | |||
| 1046 | 2724107753 | |||
| 1047 | 2730105710 | |||
| 1048 | 2730161904 | |||
| 1049 | 2730300910 | |||
| 1050 | 2793324051 | |||
| 1051 | 2793343413 | |||
| 1052 | 2793346240 | |||
| 1053 | 2793355460 | |||
| 1054 | 2805930679 | |||
| 1055 | 2805934139 | |||
| 1056 | 2808989808 | |||
| 1057 | 2819561540 | |||
| 1058 | 2819613772 | |||
| 1059 | 2819642770 | |||
| 1060 | 2819688833 | |||
| 1061 | 2838019458 | |||
| 1062 | 2838025084 | |||
| 1063 | 2838036753 | |||
| 1064 | 2838050564 | |||
| 1065 | 2838062858 | |||
| 1066 | 2838071806 | |||
| 1067 | 2838662213 | |||
| 1068 | 2838671317 | |||
| 1069 | 2838703502 | |||
| 1070 | 2842149496 | |||
| 1071 | 2842197736 | |||
| 1072 | 2842203284 | |||
| 1073 | 2842210275 | |||
| 1074 | 2842253866 | |||
| 1075 | 2842268009 | |||
| 1076 | 2842283729 | |||
| 1077 | 2842289694 | |||
| 1078 | 2842311770 | |||
| 1079 | 2842321570 | |||
| 1080 | 2842401078 | |||
| 1081 | 2842407165 | |||
| 1082 | 2842414057 | |||
| 1083 | 2842420698 | |||
| 1084 | 2842425439 | |||
| 1085 | 2842432172 | |||
| 1086 | 2842438284 | |||
| 1087 | 2842443980 | |||
| 1088 | 2842450148 | |||
| 1089 | 2842466270 | |||
| 1090 | 2842472746 | |||
| 1091 | 2842493095 | |||
| 1092 | 2842499337 | |||
| 1093 | 2842500805 | |||
| 1094 | 2842515466 | |||
| 1095 | 2842525591 | |||
| 1096 | 2844165866 | |||
| 1097 | 2854915613 | |||
| 1098 | 2854920143 | |||
| 1099 | 2855830189 | |||
| 1100 | 2855875531 | |||
| 1101 | 2899848168 | |||
| 1102 | 2903451722 | |||
| 1103 | 2915996037 | |||
| 1104 | 2916014225 | |||
| 1105 | 2916017195 | |||
| 1106 | 2916041010 | |||
| 1107 | 2916048258 | |||
| 1108 | 2916075950 | |||
| 1109 | 2919104915 | |||
| 1110 | 2919170905 | |||
| 1111 | 2919176213 | |||
| 1112 | 2921215263 | |||
| 1113 | 2921241814 | |||
| 1114 | 2921287947 | |||
| 1115 | 2921297355 | |||
| 1116 | 2924149728 | |||
| 1117 | 2924152998 | |||
| 1118 | 2924161481 | |||
| 1119 | 2924169381 | |||
| 1120 | 2924190498 | |||
| 1121 | 2924205483 | |||
| 1122 | 2924219040 | |||
| 1123 | 2924225945 | |||
| 1124 | 2924232677 | |||
| 1125 | 2929142497 | |||
| 1126 | 2933598842 | |||
| 1127 | 2933602601 | |||
| 1128 | 2936386353 | |||
| 1129 | 2937006297 | |||
| 1130 | 2937019901 | |||
| 1131 | 2937068465 | |||
| 1132 | 2937092685 | |||
| 1133 | 2937104289 | |||
| 1134 | 2937123280 | |||
| 1135 | 2937851811 | |||
| 1136 | 2941506568 | |||
| 1137 | 2957385511 | |||
| 1138 | 2957391084 | |||
| 1139 | 2957405008 | |||
| 1140 | 2957413600 | |||
| 1141 | 2957415566 | |||
| 1142 | 2957433727 | |||
| 1143 | 2957447427 | |||
| 1144 | 2957470261 | |||
| 1145 | 2957473737 | |||
| 1146 | 2957487449 | |||
| 1147 | 2957492572 | |||
| 1148 | 2957503423 | |||
| 1149 | 2957510778 | |||
| 1150 | 2960586510 | |||
| 1151 | 2960606764 | |||
| 1152 | 2960614956 | |||
| 1153 | 2960628557 | |||
| 1154 | 2960642889 | |||
| 1155 | 2960649415 | |||
| 1156 | 2960663139 | |||
| 1157 | 2960674737 | |||
| 1158 | 2964628705 | |||
| 1159 | 2964653267 | |||
| 1160 | 2964659855 | |||
| 1161 | 2964676442 | |||
| 1162 | 2964680292 | |||
| 1163 | 2964690512 | |||
| 1164 | 2964718031 | |||
| 1165 | 2964725269 | |||
| 1166 | 2967683745 | |||
| 1167 | 2967697609 | |||
| 1168 | 2967711347 | |||
| 1169 | 2967718022 | |||
| 1170 | 2967724445 | |||
| 1171 | 2967738079 | |||
| 1172 | 2967748329 | |||
| 1173 | 2967750644 | |||
| 1174 | 2967774330 | |||
| 1175 | 2968087304 | |||
| 1176 | 2968141695 | |||
| 1177 | 2970024589 | |||
| 1178 | 2970038460 | |||
| 1179 | 2970058141 | |||
| 1180 | 2970063653 | |||
| 1181 | 2970073524 | |||
| 1182 | 2970077600 | |||
| 1183 | 2970091436 | |||
| 1184 | 2970112543 | |||
| 1185 | 2970133138 | |||
| 1186 | 2970142422 | |||
| 1187 | 2970159263 | |||
| 1188 | 2970168774 | |||
| 1189 | 2970175411 | |||
| 1190 | 2970188587 | |||
| 1191 | 2970195749 | |||
| 1192 | 2977526450 | |||
| 1193 | 2977543038 | |||
| 1194 | 2977555449 | |||
| 1195 | 2977564622 | |||
| 1196 | 2977572483 | |||
| 1197 | 2977576709 | |||
| 1198 | 2977923332 | |||
| 1199 | 2978974998 | |||
| 1200 | 2979091918 | |||
| 1201 | 2979100867 | |||
| 1202 | 2984514363 | |||
| 1203 | 2984523394 | |||
| 1204 | 2984542584 | |||
| 1205 | 2984589001 | |||
| 1206 | 2984606479 | |||
| 1207 | 2996889640 | |||
| 1208 | 3004212332 | |||
| 1209 | 3004224435 | |||
| 1210 | 3005418055 | |||
| 1211 | 3005452559 | |||
| 1212 | 637080542 | |||
| 1213 | 8002286556 | |||
| 1214 | 8003997511 | |||
| 1215 | 8005287838 | |||
| 1216 | 8005290656 | |||
| 1217 | 8005305022 | |||
| 1218 | 8005320023 | |||
| 1219 | 8005324167 | |||
| 1220 | 8005388476 | |||
| 1221 | 8005397642 | |||
| 1222 | 8005399270 | |||
| 1223 | 8005436993 | |||
| 1224 | 8005467199 | |||
| 1225 | 8005503075 | |||
| 1226 | 8005625594 | |||
| 1227 | 8005626107 | |||
| 1228 | 8005630617 | |||
| 1229 | 8005674993 | |||
| 1230 | 8005683428 | |||
| 1231 | 8005689434 | |||
| 1232 | 8018130452 | |||
| 1233 | 8018181193 | |||
| 1234 | 8024491214 | |||
| 1235 | 8024506121 | |||
| 1236 | 8056383519 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bhv-assembly1.cif.gz_b | dna-pk xlf mediated dimer bound to paxx | 0.7673 | 7 | 204 |
| 1jeq-assembly1.cif.gz_A | crystal structure of the ku heterodimer | 0.7646 | 1 | 221 |
| 7zvt-assembly1.cif.gz_A | cryoem structure of ku heterodimer bound to dna | 0.7637 | 1 | 230 |
| 8asc-assembly1.cif.gz_E | ku70/80 binds to the ku-binding motif of paxx | 0.7628 | 4 | 218 |
| 6erf-assembly2.cif.gz_C | complex of aplf factor and ku heterodimer bound to dna | 0.7617 | 1 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8TC57_257_413_2.40.290.10 | Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; | 0.8457 | 93 | 175 | 2.40.290.10 |
| af_Q4DHP5_233_418_2.40.290.10 | Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; | 0.8006 | 8 | 175 | 2.40.290.10 |
| af_Q75IP6_213_415_2.40.290.10 | Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; | 0.7838 | 4 | 175 | 2.40.290.10 |
| af_A4I561_246_438_2.40.290.10 | Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; | 0.7685 | 8 | 174 | 2.40.290.10 |
| af_P9WKD9_3_185_2.40.290.10 | Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; | 0.7624 | 6 | 188 | 2.40.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659XXU8-F1-model_v4 | Ku protein | 0.9525 | 105 | 180 |
GO:0003690
GO:0006303 |
| AF-A0A0N1B535-F1-model_v4 | Non-homologous end joining protein Ku | 0.9456 | 1 | 230 |
GO:0003690
GO:0004386 GO:0006303 GO:0006310 |
| AF-A0A7Y7M5X0-F1-model_v4 | Ku protein | 0.9434 | 1 | 230 |
GO:0003690
GO:0006303 |
| AF-J3BVN7-F1-model_v4 | Ku domain-containing protein | 0.9431 | 97 | 229 |
GO:0003690
GO:0006303 |
| AF-A0A560L186-F1-model_v4 | Non-homologous end joining protein Ku | 0.9408 | 1 | 230 |
GO:0003690
GO:0006303 GO:0006310 |