F469720

General Info

Members Datasets Scaffolds Average Seq Length
618 473 1236 265

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10000305|Ga0081455_1000030541
Length 294
Sequence MPRSSWKGYLKLSLVSCAVALYNASSSSERVSFNTLNRKTGNRLKQNMVDSVSGEPVDTADRVKGYQVSKGQYVMVEDTDLEALKIESTRMIEIETFVPQAEVDQIYLDSPYYLAPDDKVAEEAFAVIRDAMSRKKVVGIGRVVLNRRERMLMLEPRHNGMLATTLRYPYEVRQDAEYFADISEVKLPAEMLDIAQEIIGRKSGHFEPDKFADRYEEAVVSMLRAKQAGQTFAVPEAAAPANVVNIMDALRRSLEAEGTDAGAIRRPRAPSKKPAEAPAAAAETRKPKARKAAR

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
106 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
213 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
216 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
220 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
228 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
229 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
230 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
231 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
232 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
233 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
234 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
235 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
236 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
237 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
238 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
239 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
240 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
241 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
242 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
243 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
244 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
245 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
246 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
247 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
248 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
249 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
250 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
251 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
252 2643221557 Ensifer sp. Root558 Isolate Unclassified
253 2643221599 Rhizobium sp. Root708 Isolate Unclassified
254 2643221610 Ensifer sp. Root74 Isolate Unclassified
255 2643221626 Ensifer sp. Root31 Isolate Unclassified
256 2643221655 Ensifer sp. Root1252 Isolate Unclassified
257 2643221659 Ensifer sp. Root127 Isolate Unclassified
258 2643221668 Ensifer sp. Root423 Isolate Unclassified
259 2643221675 Ensifer sp. Root1298 Isolate Unclassified
260 2643221680 Ensifer sp. Root1312 Isolate Unclassified
261 2643221688 Rhizobium sp. Root482 Isolate Unclassified
262 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
263 2643221693 Rhizobium sp. Root491 Isolate Unclassified
264 2643221698 Ensifer sp. Root142 Isolate Unclassified
265 2643221712 Ensifer sp. Root258 Isolate Unclassified
266 2643221723 Ensifer sp. Root278 Isolate Unclassified
267 2643221726 Ensifer sp. Root954 Isolate Unclassified
268 2718217882 Rhizobium sp. N741 Isolate Nodule
269 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
270 2718218009 Rhizobium sp. N561 Isolate Nodule
271 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
272 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
273 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
274 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
275 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
276 2718218363 Rhizobium sp. N113 Isolate Nodule
277 2718218365 Rhizobium sp. N731 Isolate Nodule
278 2718218366 Rhizobium sp. N621 Isolate Nodule
279 2721755514 Rhizobium sp. N6212 Isolate Nodule
280 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
281 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
282 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
283 2721755810 Rhizobium sp. N871 Isolate Nodule
284 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
285 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
286 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
287 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
288 2728369365 Rhizobium sp. N1341 Isolate Nodule
289 2728369397 Rhizobium sp. N1314 Isolate Nodule
290 2791355260 Rhizobium sp. L9 Isolate Nodule
291 2791355263 Rhizobium chutanense C5 Isolate Nodule
292 2791355264 Rhizobium sp. S9 Isolate Nodule
293 2791355265 Rhizobium sp. H4 Isolate Nodule
294 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
295 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
296 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
297 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
298 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
299 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
300 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
301 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
302 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
303 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
304 2838048938 Rhizobium pisi 27/80 Isolate Nodule
305 2838061910 Rhizobium phaseoli L15 Isolate Nodule
306 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
307 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
308 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
309 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
310 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
311 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
312 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
313 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
314 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
315 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
316 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
317 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
318 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
319 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
320 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
321 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
322 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
323 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
324 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
325 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
326 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
327 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
328 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
329 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
330 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
331 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
332 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
333 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
334 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
335 2844163670 Ensifer sp. 1H6 Isolate Unclassified
336 2854911287 Brucella lupini LUP21 Isolate Unclassified
337 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
338 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
339 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
340 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
341 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
342 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
343 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
344 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
345 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
346 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
347 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
348 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
349 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
350 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
351 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
352 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
353 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
354 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
355 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
356 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
357 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
358 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
359 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
360 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
361 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
362 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
363 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
364 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
365 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
366 2933599457 Rhizobium phaseoli M3 Isolate Nodule
367 2936381700 Rhizobium chutanense C16 Isolate Unclassified
368 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
369 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
370 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
371 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
372 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
373 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
374 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
375 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
376 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
377 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
378 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
379 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
380 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
381 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
382 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
383 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
384 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
385 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
386 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
387 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
388 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
389 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
390 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
391 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
392 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
393 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
394 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
395 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
396 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
397 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
398 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
399 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
400 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
401 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
402 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
403 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
404 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
405 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
406 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
407 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
408 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
409 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
410 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
411 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
412 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
413 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
414 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
415 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
416 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
417 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
418 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
419 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
420 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
421 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
422 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
423 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
424 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
425 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
426 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
427 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
428 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
429 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
430 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
431 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
432 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
433 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
434 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
435 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
436 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
437 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
438 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
439 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
440 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
441 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
442 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
443 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
444 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
445 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
446 2996887358 Rhizobium sp. R711 Isolate Nodule
447 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
448 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
449 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
450 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
451 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
452 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
453 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
454 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
455 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
456 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
457 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
458 8005321885 Rhizobium sp. R72 Isolate Nodule
459 8005382845 Rhizobium sp. R634 Isolate Nodule
460 8005395548 Rhizobium sp. R339 Isolate Nodule
461 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
462 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
463 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
464 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
465 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
466 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
467 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
468 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
469 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
470 8018176218 Rhizobium sp. N122 Isolate Nodule
471 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
472 8024501048 Rhizobium sp. H4 Isolate Nodule
473 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.9
Metatranscriptomes 0.32
Isolates 40.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 14.89
Nodule 31.23
Rhizoplane 0.97
Rhizosphere 36.25
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10000305 3300005937 Bacteria 64685
2 JGI25152J39213_1009888 3300002773 Bacteria 2224
3 JGI25151J46595_10001032 3300003187 Bacteria 20828
4 JGI25151J46595_10002384 3300003187 Bacteria 11394
5 JGI25151J46595_10059739 3300003187 Bacteria 1225
6 JGI25165J46597_1000159 3300003214 Bacteria 108186
7 rootH2_10157225 3300003320 Bacteria 1450
8 rootH1_10056806 3300003323 Bacteria 5914
9 rootH1_10062594 3300003323 Bacteria 3322
10 JGI25161J50226_1001088 3300003374 Bacteria 9152
11 Ga0055542_1000644 3300003762 Bacteria 29152
12 Ga0055529_1003184 3300003763 Bacteria 2816
13 Ga0055526_1001823 3300003771 Bacteria 14732
14 Ga0055524_1008749 3300003775 Bacteria 4181
15 Ga0055536_1001554 3300003781 Bacteria 13762
16 Ga0055536_1005522 3300003781 Bacteria 6156
17 Ga0055530_10008550 3300003791 Bacteria 4078
18 Ga0055540_1000439 3300003792 Bacteria 32821
19 Ga0055531_10002843 3300003794 Bacteria 11322
20 Ga0055531_10003010 3300003794 Bacteria 10939
21 Ga0055531_10004825 3300003794 Bacteria 8047
22 Ga0058692_1003121 3300003856 Bacteria 5258
23 Ga0065165_1000672 3300005262 Bacteria 49172
24 Ga0070670_100004393 3300005331 Bacteria 11803
25 Ga0070680_100287278 3300005336 Bacteria 1394
26 Ga0070668_100447171 3300005347 Bacteria 1110
27 Ga0070669_100107443 3300005353 Bacteria 2114
28 Ga0070675_100052208 3300005354 Bacteria 3361
29 Ga0070674_100004459 3300005356 Bacteria 7986
30 Ga0070673_100213381 3300005364 Bacteria 1668
31 Ga0070688_100082867 3300005365 Bacteria 2080
32 Ga0070700_100110022 3300005441 Bacteria 1830
33 Ga0070681_10306735 3300005458 Bacteria 1497
34 Ga0070665_100087236 3300005548 Bacteria 3125
35 Ga0068856_100022618 3300005614 Bacteria 6112
36 Ga0068861_100035625 3300005719 Bacteria 3688
37 Ga0081455_10013447 3300005937 Bacteria 8087
38 Ga0081540_1040237 3300005983 Bacteria 2438
39 Ga0081539_10003002 3300005985 Bacteria 22025
40 Ga0081539_10008935 3300005985 Bacteria 8543
41 Ga0075363_100126081 3300006048 Bacteria 1433
42 Ga0075364_10011001 3300006051 Bacteria 5488
43 Ga0075362_10017145 3300006177 Bacteria 2979
44 Ga0075362_10027328 3300006177 Bacteria 2442
45 Ga0075367_10093846 3300006178 Bacteria 1828
46 Ga0075367_10100202 3300006178 Bacteria 1770
47 Ga0075369_10009799 3300006186 Bacteria 3733
48 Ga0075369_10016020 3300006186 Bacteria 3017
49 Ga0075369_10088593 3300006186 Bacteria 1379
50 Ga0075366_10044392 3300006195 Bacteria 2634
51 Ga0075370_10153140 3300006353 Bacteria 1351
52 Ga0075428_100184505 3300006844 Bacteria 2257
53 Ga0075430_100296739 3300006846 Bacteria 1337
54 Ga0105240_10366343 3300009093 Bacteria 1631
55 Ga0105240_10430927 3300009093 Bacteria 1479
56 Ga0111539_10239744 3300009094 Bacteria 2111
57 Ga0111539_10502227 3300009094 Bacteria 1413
58 Ga0111539_10546791 3300009094 Bacteria 1349
59 Ga0105247_10063908 3300009101 Bacteria 2286
60 Ga0114129_10067744 3300009147 Bacteria 4977
61 Ga0105243_10039078 3300009148 Bacteria 3698
62 Ga0105243_10214195 3300009148 Bacteria 1698
63 Ga0105237_10000038 3300009545 Bacteria 190707
64 Ga0105237_10211574 3300009545 Bacteria 1939
65 Ga0105237_10873642 3300009545 Bacteria 906
66 Ga0105238_10243963 3300009551 Bacteria 1774
67 Ga0105238_10274796 3300009551 Bacteria 1665
68 Ga0105238_10311463 3300009551 Bacteria 1559
69 Ga0105238_10342500 3300009551 Bacteria 1483
70 Ga0105249_10330702 3300009553 Bacteria 1537
71 Ga0105239_10000065 3300010375 Bacteria 151224
72 Ga0105239_10002418 3300010375 Bacteria 23771
73 Ga0105239_10455016 3300010375 Bacteria 1452
74 Ga0105239_10590416 3300010375 Bacteria 1266
75 Ga0157373_10001149 3300013100 Bacteria 20277
76 Ga0157373_10028466 3300013100 Bacteria 4031
77 Ga0157371_10005936 3300013102 Bacteria 10194
78 Ga0157370_10000054 3300013104 Bacteria 118718
79 Ga0157369_10103813 3300013105 Bacteria 3028
80 Ga0157374_10558416 3300013296 Bacteria 1153
81 Ga0163162_10646939 3300013306 Bacteria 1181
82 Ga0157372_10169581 3300013307 Bacteria 2525
83 Ga0163163_10260203 3300014325 Bacteria 1786
84 Ga0157380_10004845 3300014326 Bacteria 9372
85 Ga0182006_1043515 3300015261 Bacteria 1755
86 Ga0182007_10011902 3300015262 Bacteria 3366
87 Ga0209436_100157 3300025208 Bacteria 32790
88 Ga0209437_100023 3300025233 Bacteria 614195
89 Ga0209437_113631 3300025233 Bacteria 1157
90 Ga0209677_100525 3300025253 Bacteria 21305
91 Ga0209148_1000126 3300025254 Bacteria 181590
92 Ga0209148_1007709 3300025254 Bacteria 2214
93 Ga0209129_1000070 3300025258 Bacteria 212476
94 Ga0209233_1000127 3300025261 Bacteria 213026
95 Ga0209233_1000214 3300025261 Bacteria 108975
96 Ga0209455_1000105 3300025272 Bacteria 199725
97 Ga0209673_1036445 3300025273 Bacteria 1459
98 Ga0209130_1000242 3300025284 Bacteria 69580
99 Ga0209676_1001945 3300025292 Bacteria 16638
100 Ga0209676_1025564 3300025292 Bacteria 1891
101 Ga0209025_1000175 3300025294 Bacteria 158379
102 Ga0209025_1000240 3300025294 Bacteria 128397
103 Ga0209025_1001648 3300025294 Bacteria 27540
104 Ga0209025_1002267 3300025294 Bacteria 21060
105 Ga0209564_1000338 3300025295 Bacteria 90246
106 Ga0209564_1000341 3300025295 Bacteria 89262
107 Ga0209758_1030208 3300025297 Bacteria 2249
108 Ga0209758_1042558 3300025297 Bacteria 1683
109 Ga0209050_1012027 3300025298 Bacteria 4024
110 Ga0209256_1000534 3300025299 Bacteria 55095
111 Ga0209256_1000573 3300025299 Bacteria 52571
112 Ga0207426_1000483 3300025302 Bacteria 60265
113 Ga0207426_1022166 3300025302 Bacteria 2184
114 Ga0209051_1000192 3300025303 Bacteria 108667
115 Ga0209051_1020577 3300025303 Bacteria 2836
116 Ga0209051_1020896 3300025303 Bacteria 2803
117 Ga0209257_1000300 3300025304 Bacteria 108786
118 Ga0209257_1002029 3300025304 Bacteria 21609
119 Ga0209257_1005011 3300025304 Bacteria 9655
120 Ga0207710_10073308 3300025900 Bacteria 1574
121 Ga0207699_10055720 3300025906 Bacteria 2354
122 Ga0207695_10206822 3300025913 Bacteria 1875
123 Ga0207695_10266521 3300025913 Bacteria 1609
124 Ga0207695_10284633 3300025913 Bacteria 1546
125 Ga0207671_10000418 3300025914 Bacteria 58941
126 Ga0207693_10208515 3300025915 Bacteria 1536
127 Ga0207657_10023716 3300025919 Bacteria 5706
128 Ga0207649_10388056 3300025920 Bacteria 1042
129 Ga0207652_10366347 3300025921 Bacteria 1301
130 Ga0207681_10066348 3300025923 Bacteria 2498
131 Ga0207694_10067404 3300025924 Bacteria 2794
132 Ga0207650_10007578 3300025925 Bacteria 7399
133 Ga0207690_10269967 3300025932 Bacteria 1321
134 Ga0207690_10564547 3300025932 Bacteria 926
135 Ga0207706_10301134 3300025933 Bacteria 1397
136 Ga0207670_10205294 3300025936 Bacteria 1499
137 Ga0207669_10040098 3300025937 Bacteria 2713
138 Ga0207704_10063642 3300025938 Bacteria 2300
139 Ga0207691_10188663 3300025940 Bacteria 1799
140 Ga0207679_10267230 3300025945 Bacteria 1461
141 Ga0207712_10222037 3300025961 Bacteria 1511
142 Ga0207640_10413754 3300025981 Bacteria 1101
143 Ga0207678_10238766 3300026067 Bacteria 1556
144 Ga0207702_10183324 3300026078 Bacteria 1929
145 Ga0207674_10491400 3300026116 Bacteria 1186
146 Ga0207674_10494513 3300026116 Bacteria 1182
147 Ga0207675_100036936 3300026118 Bacteria 4557
148 Ga0207675_100437391 3300026118 Bacteria 1294
149 Ga0209371_1001722 3300027312 Bacteria 13838
150 Ga0209371_1009909 3300027312 Bacteria 2985
151 Ga0209282_1000093 3300027666 Bacteria 62036
152 Ga0268256_1000785 3300030500 Bacteria 22910
153 Ga0268256_1002551 3300030500 Bacteria 9130
154 Ga0265331_10053692 3300031250 Bacteria 1921
155 Ga0307410_10029864 3300031852 Bacteria 3476
156 Ga0307406_10489217 3300031901 Bacteria 995
157 Ga0307407_10003714 3300031903 Bacteria 6331
158 Ga0307409_100002825 3300031995 Bacteria 9181
159 Ga0307416_100265949 3300032002 Bacteria 1680
160 Ga0307414_10072585 3300032004 Bacteria 2487
161 Ga0307414_10152125 3300032004 Bacteria 1827
162 Ga0307414_10353236 3300032004 Bacteria 1262
163 Ga0307415_100176168 3300032126 Bacteria 1673
164 Ga0373941_0009623 3300035115 Unclassified 2439
165 Ga0395899_0002239 3300037312 Bacteria 15835
166 Ga0395898_0004769 3300037466 Bacteria 14761
167 Ga0395898_0284805 3300037466 Bacteria 1576
168 Ga0395905_0000321 3300037471 Bacteria 69144
169 Ga0395905_0068400 3300037471 Bacteria 3326
170 Ga0395901_0011113 3300038443 Bacteria 9124
171 Ga0395901_0404495 3300038443 Bacteria 1402
172 Ga0436360_0886486 3300039438 Bacteria 1893
173 Ga0436360_1098593 3300039438 Bacteria 8015
174 Ga0436361_0694290 3300039447 Bacteria 14486
175 Ga0439436_0000279 3300041404 Bacteria 12352
176 Ga0439438_012958 3300041405 Bacteria 2535
177 Ga0439466_0043540 3300041411 Bacteria 1491
178 Ga0439465_0000751 3300041413 Bacteria 10045
179 Ga0439465_0001030 3300041413 Bacteria 8866
180 Ga0439465_0003064 3300041413 Bacteria 5469
181 Ga0451837_0672962 3300041494 Bacteria 2659
182 Ga0451839_0286878 3300041496 Bacteria 4241
183 Ga0451841_0324813 3300041498 Bacteria 901
184 Ga0451847_0135229 3300041503 Bacteria 3267
185 Ga0451849_0802431 3300041505 Bacteria 3219
186 Ga0451851_0116375 3300041507 Bacteria 2703
187 Ga0439448_0075249 3300042005 Bacteria 1129
188 Ga0439449_0081664 3300042007 Bacteria 1192
189 Ga0439458_0022365 3300042157 Bacteria 1469
190 Ga0439434_0012924 3300042435 Bacteria 2475
191 Ga0466963_0040293 3300044694 Bacteria 3061
192 Ga0466964_0030426 3300044706 Bacteria 2137
193 Ga0466970_0000092 3300044765 Bacteria 38213
194 Ga0466957_0046159 3300044842 Bacteria 2644
195 Ga0466958_0007987 3300045836 Bacteria 5850
196 Ga0466967_0140912 3300045976 Bacteria 2246
197 Ga0495629_0086413 3300046459 Bacteria 2188
198 Ga0495662_0024171 3300046476 Bacteria 2932
199 Ga0495585_0059838 3300046492 Bacteria 2098
200 Ga0495607_0044822 3300046501 Bacteria 2605
201 Ga0495610_0000016 3300046512 Bacteria 373959
202 Ga0495631_0025953 3300046518 Bacteria 2694
203 Ga0495643_0024612 3300046522 Bacteria 3413
204 Ga0495643_0026497 3300046522 Bacteria 3271
205 Ga0495643_0087487 3300046522 Bacteria 1612
206 Ga0495587_0123022 3300046536 Bacteria 1485
207 Ga0495633_0000895 3300046558 Bacteria 25483
208 Ga0495633_0012830 3300046558 Bacteria 4438
209 Ga0495656_0025327 3300046615 Bacteria 2351
210 Ga0495668_0004965 3300046616 Bacteria 9216
211 Ga0495625_0000210 3300046660 Bacteria 93375
212 Ga0495625_0007985 3300046660 Bacteria 9092
213 Ga0495625_0165735 3300046660 Bacteria 1477
214 Ga0495635_0203402 3300046663 Bacteria 1343
215 Ga0495661_0107895 3300046665 Bacteria 1556
216 Ga0495588_0122961 3300046674 Bacteria 1368
217 Ga0495657_0123810 3300046675 Bacteria 1626
218 Ga0495658_0302504 3300046683 Bacteria 1012
219 Ga0495649_0000001 3300046694 Bacteria 1113839
220 Ga0495600_0054695 3300046809 Bacteria 2607
221 Ga0495600_0262563 3300046809 Bacteria 1096
222 Ga0495660_0000673 3300046810 Bacteria 26298
223 Ga0495660_0023648 3300046810 Bacteria 3505
224 Ga0495604_0007159 3300047317 Bacteria 8835
225 Ga0495681_0000507 3300047470 Bacteria 29753
226 Ga0495681_0094207 3300047470 Bacteria 1318
227 Ga0495686_0000895 3300047472 Bacteria 37513
228 Ga0495686_0002749 3300047472 Bacteria 16076
229 Ga0495686_0003551 3300047472 Bacteria 13417
230 Ga0495686_0015440 3300047472 Bacteria 5213
231 Ga0496109_0244347 3300048912 Bacteria 1690
232 Ga0496109_0404302 3300048912 Bacteria 1290
233 Ga0496110_0401827 3300048913 Bacteria 1249
234 Ga0496116_0000247 3300048919 Bacteria 98384
235 Ga0496116_0003190 3300048919 Bacteria 16402
236 Ga0496116_0006733 3300048919 Bacteria 10346
237 Ga0496116_0018236 3300048919 Bacteria 5418
238 Ga0496116_0048266 3300048919 Bacteria 2858
239 Ga0496117_0000105 3300048920 Bacteria 188970
240 Ga0496117_0001492 3300048920 Bacteria 33537
241 Ga0496118_0000168 3300048921 Bacteria 118938
242 Ga0496118_0002150 3300048921 Bacteria 27498
243 Ga0496118_0035272 3300048921 Bacteria 4065
244 Ga0496118_0043064 3300048921 Bacteria 3554
245 Ga0496118_0053946 3300048921 Bacteria 3050
246 Ga0496119_0000443 3300048922 Bacteria 56795
247 Ga0496119_0000887 3300048922 Bacteria 39179
248 Ga0496119_0003427 3300048922 Bacteria 16468
249 Ga0496120_0000818 3300048923 Bacteria 44506
250 Ga0496120_0029492 3300048923 Bacteria 3348
251 Ga0496120_0086412 3300048923 Bacteria 1686
252 Ga0496121_0000005 3300048924 Bacteria 1034486
253 Ga0496121_0018333 3300048924 Bacteria 7064
254 Ga0496121_0073906 3300048924 Bacteria 2729
255 Ga0496121_0127272 3300048924 Bacteria 1913
256 Ga0496122_0001241 3300048925 Bacteria 43048
257 Ga0496122_0002116 3300048925 Bacteria 29353
258 Ga0496122_0057250 3300048925 Bacteria 2897
259 Ga0496122_0063057 3300048925 Bacteria 2708
260 Ga0496122_0103503 3300048925 Bacteria 1894
261 Ga0496122_0112205 3300048925 Bacteria 1786
262 Ga0496123_0001704 3300048926 Bacteria 29372
263 Ga0496123_0076032 3300048926 Bacteria 2069
264 Ga0496123_0131321 3300048926 Unclassified 1386
265 Ga0496123_0242544 3300048926 Bacteria 894
266 Ga0496124_0000091 3300048927 Bacteria 189706
267 Ga0496124_0000254 3300048927 Bacteria 103551
268 Ga0496124_0002483 3300048927 Bacteria 24047
269 Ga0496124_0031267 3300048927 Bacteria 4714
270 Ga0496124_0035183 3300048927 Bacteria 4384
271 Ga0496124_0068831 3300048927 Bacteria 2940
272 Ga0496125_0000034 3300048928 Bacteria 348231
273 Ga0496125_0005508 3300048928 Bacteria 14035
274 Ga0496125_0211900 3300048928 Bacteria 1257
275 Ga0496126_0026321 3300048929 Bacteria 5579
276 Ga0496126_0042165 3300048929 Bacteria 4216
277 Ga0496126_0098573 3300048929 Bacteria 2560
278 Ga0496126_0377732 3300048929 Bacteria 1154
279 Ga0501032_0008593 3300049569 Bacteria 7442
280 Ga0501032_0019882 3300049569 Bacteria 4688
281 Ga0501032_0031140 3300049569 Bacteria 3658
282 Ga0501033_0000350 3300049570 Bacteria 43920
283 Ga0501033_0004563 3300049570 Bacteria 11091
284 Ga0501034_0000109 3300049571 Bacteria 151550
285 Ga0501034_0021544 3300049571 Bacteria 6567
286 Ga0501034_0039043 3300049571 Bacteria 4809
287 Ga0501034_0050108 3300049571 Bacteria 4212
288 Ga0501034_0117395 3300049571 Bacteria 2648
289 Ga0501036_0196698 3300049572 Bacteria 1696
290 Ga0501037_0000193 3300049573 Bacteria 56422
291 Ga0501037_0234790 3300049573 Bacteria 1287
292 Ga0501037_0285631 3300049573 Bacteria 1149
293 Ga0501038_0001744 3300049574 Bacteria 20218
294 Ga0501038_0183214 3300049574 Bacteria 1688
295 Ga0501039_0039516 3300049575 Bacteria 3644
296 Ga0501039_0201911 3300049575 Bacteria 1563
297 Ga0501041_0056638 3300049577 Bacteria 2396
298 Ga0501043_0000861 3300049579 Bacteria 26900
299 Ga0501043_0018589 3300049579 Bacteria 5453
300 Ga0501043_0058567 3300049579 Bacteria 3024
301 Ga0501047_0092662 3300049581 Bacteria 2900
302 Ga0501068_0003917 3300049584 Bacteria 8095
303 Ga0501068_0093202 3300049584 Bacteria 1860
304 Ga0501069_0000193 3300049585 Bacteria 26900
305 Ga0501069_0353946 3300049585 Bacteria 866
306 Ga0501070_0023506 3300049586 Bacteria 5162
307 Ga0501070_0133177 3300049586 Bacteria 2053
308 Ga0501071_0010308 3300049587 Bacteria 6258
309 Ga0501071_0197871 3300049587 Bacteria 1509
310 Ga0501072_0296609 3300049588 Bacteria 1285
311 Ga0501073_0010379 3300049589 Bacteria 6831
312 Ga0501074_0016311 3300049590 Bacteria 5393
313 Ga0501238_011374 3300049671 Bacteria 1196
314 Ga0501079_0042948 3300049741 Bacteria 3490
315 Ga0501080_0046449 3300049742 Bacteria 4043
316 Ga0501080_0475799 3300049742 Bacteria 1118
317 Ga0501083_0000434 3300049744 Bacteria 26877
318 Ga0501241_015982 3300049758 Bacteria 1367
319 Ga0501035_0000791 3300049822 Bacteria 33749
320 Ga0501035_0001209 3300049822 Bacteria 26896
321 Ga0501035_0044869 3300049822 Bacteria 3978
322 Ga0501035_0132164 3300049822 Bacteria 2175
323 Ga0501035_0415868 3300049822 Bacteria 1117
324 Ga0501044_0008505 3300049823 Bacteria 11247
325 Ga0501044_0014505 3300049823 Bacteria 8500
326 Ga0501044_0052558 3300049823 Bacteria 4197
327 Ga0501044_0154669 3300049823 Bacteria 2273
328 Ga0501044_0164008 3300049823 Bacteria 2197
329 nmdc:mga03683_15150_c1 3300050489 Bacteria 2872
330 nmdc:mga03683_8953_c1 3300050489 Bacteria 3541
331 nmdc:mga03n38_353643_c1 3300050490 Bacteria 800
332 nmdc:mga00v17_102107_c1 3300050491 Bacteria 1811
333 nmdc:mga00v17_14211_c1 3300050491 Bacteria 4440
334 nmdc:mga0yw44_104761_c1 3300050492 Bacteria 1280
335 nmdc:mga0yw44_186993_c1 3300050492 Bacteria 1365
336 nmdc:mga0yw44_48933_c1 3300050492 Bacteria 2550
337 nmdc:mga0k408_105410_c1 3300050493 Bacteria 1664
338 nmdc:mga06z11_187730_c1 3300050494 Bacteria 1195
339 nmdc:mga06z11_51697_c1 3300050494 Bacteria 2105
340 nmdc:mga07m45_42905_c1 3300050496 Bacteria 2536
341 nmdc:mga05p37_22572_c1 3300050507 Bacteria 7631
342 nmdc:mga05p37_79233_c1 3300050507 Bacteria 4045
343 nmdc:mga08y16_301492_c1 3300050511 Bacteria 1651
344 nmdc:mga08y16_508921_c1 3300050511 Bacteria 1222
345 nmdc:mga0sz30_15664_c1 3300050516 Bacteria 2998
346 nmdc:mga0sz30_84123_c1 3300050516 Bacteria 1379
347 Ga0500610_0023913 3300053079 Bacteria 3031
348 Ga0495655_0027987 3300053083 Bacteria 1342
349 Ga0500641_0015702 3300053096 Bacteria 2815
350 Ga0500593_000442 3300053117 Bacteria 16334
351 Ga0500618_000118 3300053125 Bacteria 64472
352 Ga0500618_005648 3300053125 Bacteria 3773
353 Ga0500658_0006159 3300053134 Bacteria 4463
354 Ga0500568_0000002 3300053139 Bacteria 880601
355 Ga0500568_0023208 3300053139 Bacteria 2641
356 Ga0500590_000037 3300053148 Bacteria 31191
357 Ga0500590_003038 3300053148 Bacteria 7636
358 Ga0500604_0002218 3300053151 Bacteria 5331
359 Ga0500604_0045878 3300053151 Bacteria 1335
360 Ga0500616_0000108 3300053153 Bacteria 152917
361 Ga0500616_0023485 3300053153 Bacteria 3434
362 Ga0500633_0001175 3300053160 Bacteria 4769
363 Ga0500636_0000013 3300053177 Bacteria 130122
364 Ga0590077_008423 3300059426 Bacteria 2111
365 Ga0587088_024576 3300059508 Bacteria 1034
366 Ga0587072_001056 3300059643 Bacteria 3229
367 2510136417 2510065019 Bacteria 6903379
368 2510892575 2510461076 Bacteria 8618824
369 2513568046 2513237084 Bacteria 7231967
370 2513619358 2513237091 Bacteria 6900273
371 2514018553 2513237162 Bacteria 7468464
372 2515108627 2515075009 Bacteria 7288508
373 2515632468 2515154113 Bacteria 7807172
374 2515640645 2515154114 Bacteria 7848616
375 2515661365 2515154116 Bacteria 7552979
376 2517410271 2517287029 Bacteria 6905599
377 2530644624 2529292951 Bacteria 6916614
378 2551676978 2551306084 Bacteria 8942552
379 2551686771 2551306085 Bacteria 7347181
380 2551702183 2551306087 Bacteria 7351905
381 2551720902 2551306090 Bacteria 7953713
382 2551741497 2551306093 Bacteria 7064773
383 2554249219 2554235003 Bacteria 5877155
384 2554249782 2554235003 Bacteria 5877155
385 2585397242 2582581866 Bacteria 6859583
386 2599416645 2599185170 Bacteria 7295545
387 2599722928 2599185236 Bacteria 6875203
388 2601612995 2600255279 Bacteria 5605316
389 2601749729 2600255308 Bacteria 5611129
390 2616295203 2615840624 Bacteria 6557588
391 2616309893 2615840626 Bacteria 7921970
392 2616550845 2615840698 Bacteria 7319877
393 2643805134 2643221557 Bacteria 7184309
394 2644005638 2643221599 Bacteria 6292121
395 2644065627 2643221610 Bacteria 7480339
396 2644146882 2643221626 Bacteria 8069654
397 2644310766 2643221655 Bacteria 7722067
398 2644334448 2643221659 Bacteria 7890716
399 2644375397 2643221668 Bacteria 7306521
400 2644417953 2643221675 Bacteria 7473456
401 2644451124 2643221680 Bacteria 7473610
402 2644493163 2643221688 Bacteria 5260751
403 2644501541 2643221689 Bacteria 6042950
404 2644520076 2643221693 Bacteria 5513853
405 2644545356 2643221698 Bacteria 7756764
406 2644616600 2643221712 Bacteria 7729434
407 2644673464 2643221723 Bacteria 7095460
408 2644674559 2643221723 Bacteria 7095460
409 2644687471 2643221726 Bacteria 7455827
410 2719183764 2718217882 Bacteria 6556348
411 2719668063 2718217997 Bacteria 6740740
412 2719728205 2718218009 Bacteria 6478651
413 2720494826 2718218199 Bacteria 6740745
414 2720611148 2718218232 Bacteria 6720332
415 2720616320 2718218233 Bacteria 6662049
416 2720629395 2718218235 Bacteria 6630699
417 2720771966 2718218269 Bacteria 6906114
418 2721145066 2718218363 Bacteria 6524337
419 2721155803 2718218365 Bacteria 6274507
420 2721167153 2718218366 Bacteria 6425255
421 2722838131 2721755514 Bacteria 6424414
422 2723029396 2721755556 Bacteria 6745503
423 2723563012 2721755684 Bacteria 6859907
424 2723570993 2721755685 Bacteria 6704835
425 2724042399 2721755810 Bacteria 6479005
426 2724086786 2721755819 Bacteria 6906405
427 2724106944 2721755822 Bacteria 6726041
428 2724107753 2721755823 Bacteria 6752556
429 2730105710 2728369352 Bacteria 6745171
430 2730161904 2728369365 Bacteria 6555560
431 2730300910 2728369397 Bacteria 6274511
432 2793324051 2791355260 Bacteria 6598818
433 2793343413 2791355263 Bacteria 6872478
434 2793346240 2791355264 Bacteria 6429314
435 2793355460 2791355265 Bacteria 6539969
436 2805930679 2802429605 Bacteria 6875453
437 2805934139 2802429606 Bacteria 6346811
438 2808989808 2808606387 Bacteria 5697198
439 2819561540 2818991439 Bacteria 6907412
440 2819613772 2818991448 Bacteria 6772224
441 2819642770 2818991453 Bacteria 7181617
442 2819688833 2818991461 Bacteria 7026071
443 2838019458 2838016132 Bacteria 6577831
444 2838025084 2838022645 Bacteria 6494267
445 2838036753 2838035591 Bacteria 7166484
446 2838050564 2838048938 Bacteria 6044578
447 2838062858 2838061910 Bacteria 6794874
448 2838071806 2838068647 Bacteria 6208656
449 2838662213 2838661181 Bacteria 7385261
450 2838671317 2838668709 Bacteria 6671819
451 2838703502 2838701080 Bacteria 6669771
452 2842149496 2842146304 Bacteria 5957337
453 2842197736 2842192696 Bacteria 6147454
454 2842203284 2842198810 Bacteria 6608673
455 2842210275 2842205361 Bacteria 6340321
456 2842253866 2842250916 Bacteria 6579627
457 2842268009 2842264693 Bacteria 6472963
458 2842283729 2842278818 Bacteria 6340002
459 2842289694 2842285085 Bacteria 6011953
460 2842311770 2842311132 Bacteria 6616990
461 2842321570 2842317721 Bacteria 6793725
462 2842401078 2842395702 Bacteria 6780583
463 2842407165 2842402390 Bacteria 6681310
464 2842414057 2842409023 Bacteria 6687331
465 2842420698 2842415677 Bacteria 6596907
466 2842425439 2842422224 Bacteria 6239196
467 2842432172 2842428310 Bacteria 6767288
468 2842438284 2842434925 Bacteria 6502746
469 2842443980 2842441272 Bacteria 6769273
470 2842450148 2842447887 Bacteria 6754142
471 2842466270 2842462802 Bacteria 6588055
472 2842472746 2842469257 Bacteria 6752936
473 2842493095 2842489311 Bacteria 6620893
474 2842499337 2842495871 Bacteria 6820686
475 2842500805 2842495871 Bacteria 6820686
476 2842515466 2842509118 Bacteria 6850950
477 2842525591 2842521101 Bacteria 6569494
478 2844165866 2844163670 Bacteria 7266046
479 2854915613 2854911287 Bacteria 5582813
480 2854920143 2854916844 Bacteria 5725939
481 2855830189 2855825444 Bacteria 6785811
482 2855875531 2855872281 Bacteria 6964271
483 2899848168 2899845264 Bacteria 5672268
484 2903451722 2903448605 Bacteria 7357801
485 2915996037 2915993759 Bacteria 7016183
486 2916014225 2916007675 Bacteria 6898660
487 2916017195 2916014648 Bacteria 6946486
488 2916041010 2916035215 Bacteria 6755766
489 2916048258 2916041962 Bacteria 6820487
490 2916075950 2916068649 Bacteria 6943657
491 2919104915 2919100787 Bacteria 7710546
492 2919170905 2919166419 Bacteria 4952238
493 2919176213 2919171160 Bacteria 6499771
494 2921215263 2921208531 Bacteria 6745326
495 2921241814 2921237296 Bacteria 6876710
496 2921287947 2921282425 Bacteria 6826397
497 2921297355 2921296804 Bacteria 7176999
498 2924149728 2924144063 Bacteria 6883928
499 2924152998 2924150972 Bacteria 7169444
500 2924161481 2924158325 Bacteria 7188855
501 2924169381 2924165586 Bacteria 7260590
502 2924190498 2924186466 Bacteria 6876637
503 2924205483 2924200457 Bacteria 6757188
504 2924219040 2924214083 Bacteria 7080103
505 2924225945 2924221636 Bacteria 7113495
506 2924232677 2924228884 Bacteria 6633132
507 2929142497 2929138655 Bacteria 5810547
508 2933598842 2933594066 Bacteria 5594265
509 2933602601 2933599457 Bacteria 5858799
510 2936386353 2936381700 Bacteria 7006523
511 2937006297 2937002841 Bacteria 6934057
512 2937019901 2937016420 Bacteria 6782579
513 2937068465 2937063883 Bacteria 7199456
514 2937092685 2937091812 Bacteria 6979387
515 2937104289 2937098957 Bacteria 7249374
516 2937123280 2937119839 Bacteria 6597547
517 2937851811 2937848649 Bacteria 6983481
518 2941506568 2941499720 Bacteria 7599444
519 2957385511 2957382221 Bacteria 6737050
520 2957391084 2957388812 Bacteria 6778072
521 2957405008 2957402308 Bacteria 6741770
522 2957413600 2957408893 Bacteria 6558585
523 2957415566 2957415311 Bacteria 6991633
524 2957433727 2957430029 Bacteria 7022557
525 2957447427 2957443900 Bacteria 6869977
526 2957470261 2957464669 Bacteria 6568877
527 2957473737 2957471148 Bacteria 6797643
528 2957487449 2957484790 Bacteria 6703082
529 2957492572 2957491536 Bacteria 6695180
530 2957503423 2957498199 Bacteria 7126688
531 2957510778 2957505466 Bacteria 7253085
532 2960586510 2960584000 Bacteria 6864594
533 2960606764 2960603979 Bacteria 6898737
534 2960614956 2960610863 Bacteria 6691244
535 2960628557 2960624210 Bacteria 6875384
536 2960642889 2960637947 Bacteria 7296468
537 2960649415 2960645483 Bacteria 7211087
538 2960663139 2960660292 Bacteria 7041660
539 2960674737 2960674078 Bacteria 6609048
540 2964628705 2964621998 Bacteria 6834995
541 2964653267 2964649959 Bacteria 6675118
542 2964659855 2964656573 Bacteria 7100150
543 2964676442 2964670856 Bacteria 6851364
544 2964680292 2964678106 Bacteria 6792020
545 2964690512 2964685014 Bacteria 6839111
546 2964718031 2964712639 Bacteria 6695970
547 2964725269 2964719344 Bacteria 7286602
548 2967683745 2967678726 Bacteria 7264382
549 2967697609 2967693043 Bacteria 6804451
550 2967711347 2967706974 Bacteria 7186053
551 2967718022 2967714385 Bacteria 7000047
552 2967724445 2967721400 Bacteria 7073753
553 2967738079 2967735183 Bacteria 6827012
554 2967748329 2967742019 Bacteria 6794534
555 2967750644 2967748971 Bacteria 6733771
556 2967774330 2967769361 Bacteria 6587838
557 2968087304 2968083720 Bacteria 7351627
558 2968141695 2968138860 Bacteria 6605449
559 2970024589 2970019648 Bacteria 7072033
560 2970038460 2970033650 Bacteria 7118744
561 2970058141 2970054988 Bacteria 6611507
562 2970063653 2970061556 Bacteria 7099761
563 2970073524 2970068827 Bacteria 7123112
564 2970077600 2970076120 Bacteria 6697332
565 2970091436 2970088815 Bacteria 6933825
566 2970112543 2970109326 Bacteria 6863976
567 2970133138 2970129317 Bacteria 6806560
568 2970142422 2970136068 Bacteria 7207982
569 2970159263 2970156795 Bacteria 7168044
570 2970168774 2970164137 Bacteria 6861252
571 2970175411 2970170962 Bacteria 6876229
572 2970188587 2970184632 Bacteria 7054431
573 2970195749 2970191845 Bacteria 7032787
574 2977526450 2977523885 Bacteria 6960446
575 2977543038 2977537788 Bacteria 6929320
576 2977555449 2977551784 Bacteria 7125765
577 2977564622 2977558990 Bacteria 6863948
578 2977572483 2977565890 Bacteria 6901543
579 2977576709 2977572785 Bacteria 6763888
580 2977923332 2977922695 Bacteria 6956781
581 2978974998 2978969890 Bacteria 5400756
582 2979091918 2979089926 Bacteria 5670289
583 2979100867 2979095461 Bacteria 5669583
584 2984514363 2984509177 Bacteria 5274802
585 2984523394 2984518228 Bacteria 5277463
586 2984542584 2984537506 Bacteria 5277481
587 2984589001 2984587000 Bacteria 5263363
588 2984606479 2984601300 Bacteria 5455244
589 2996889640 2996887358 Bacteria 5795980
590 3004212332 3004211236 Bacteria 7417683
591 3004224435 3004218560 Bacteria 7421728
592 3005418055 3005416602 Bacteria 7064308
593 3005452559 3005445848 Bacteria 6906074
594 637080542 637000159 Bacteria 7596297
595 8002286556 8002285264 Bacteria 6717907
596 8003997511 8003992118 Bacteria 7266902
597 8005287838 8005282627 Bacteria 6675747
598 8005290656 8005289223 Bacteria 6634003
599 8005305022 8005301065 Bacteria 6614431
600 8005320023 8005314921 Bacteria 7072929
601 8005324167 8005321885 Bacteria 5795980
602 8005388476 8005382845 Bacteria 6732062
603 8005397642 8005395548 Bacteria 6806915
604 8005399270 8005395548 Bacteria 6806915
605 8005436993 8005430974 Bacteria 6689030
606 8005467199 8005460587 Bacteria 7157962
607 8005503075 8005497431 Bacteria 6477605
608 8005625594 8005619151 Bacteria 7030230
609 8005626107 8005619151 Bacteria 7030230
610 8005630617 8005626139 Bacteria 6534237
611 8005674993 8005668836 Bacteria 6953162
612 8005683428 8005682033 Bacteria 6726518
613 8005689434 8005688590 Bacteria 6610080
614 8018130452 8018127388 Bacteria 7351159
615 8018181193 8018176218 Bacteria 6896178
616 8024491214 8024486573 Bacteria 6540512
617 8024506121 8024501048 Bacteria 6427847
618 8056383519 8056382006 Bacteria 6408074
619 Ga0081455_10000305
620 JGI25152J39213_1009888
621 JGI25151J46595_10001032
622 JGI25151J46595_10002384
623 JGI25151J46595_10059739
624 JGI25165J46597_1000159
625 rootH2_10157225
626 rootH1_10056806
627 rootH1_10062594
628 JGI25161J50226_1001088
629 Ga0055542_1000644
630 Ga0055529_1003184
631 Ga0055526_1001823
632 Ga0055524_1008749
633 Ga0055536_1001554
634 Ga0055536_1005522
635 Ga0055530_10008550
636 Ga0055540_1000439
637 Ga0055531_10002843
638 Ga0055531_10003010
639 Ga0055531_10004825
640 Ga0058692_1003121
641 Ga0065165_1000672
642 Ga0070670_100004393
643 Ga0070680_100287278
644 Ga0070668_100447171
645 Ga0070669_100107443
646 Ga0070675_100052208
647 Ga0070674_100004459
648 Ga0070673_100213381
649 Ga0070688_100082867
650 Ga0070700_100110022
651 Ga0070681_10306735
652 Ga0070665_100087236
653 Ga0068856_100022618
654 Ga0068861_100035625
655 Ga0081455_10013447
656 Ga0081540_1040237
657 Ga0081539_10003002
658 Ga0081539_10008935
659 Ga0075363_100126081
660 Ga0075364_10011001
661 Ga0075362_10017145
662 Ga0075362_10027328
663 Ga0075367_10093846
664 Ga0075367_10100202
665 Ga0075369_10009799
666 Ga0075369_10016020
667 Ga0075369_10088593
668 Ga0075366_10044392
669 Ga0075370_10153140
670 Ga0075428_100184505
671 Ga0075430_100296739
672 Ga0105240_10366343
673 Ga0105240_10430927
674 Ga0111539_10239744
675 Ga0111539_10502227
676 Ga0111539_10546791
677 Ga0105247_10063908
678 Ga0114129_10067744
679 Ga0105243_10039078
680 Ga0105243_10214195
681 Ga0105237_10000038
682 Ga0105237_10211574
683 Ga0105237_10873642
684 Ga0105238_10243963
685 Ga0105238_10274796
686 Ga0105238_10311463
687 Ga0105238_10342500
688 Ga0105249_10330702
689 Ga0105239_10000065
690 Ga0105239_10002418
691 Ga0105239_10455016
692 Ga0105239_10590416
693 Ga0157373_10001149
694 Ga0157373_10028466
695 Ga0157371_10005936
696 Ga0157370_10000054
697 Ga0157369_10103813
698 Ga0157374_10558416
699 Ga0163162_10646939
700 Ga0157372_10169581
701 Ga0163163_10260203
702 Ga0157380_10004845
703 Ga0182006_1043515
704 Ga0182007_10011902
705 Ga0209436_100157
706 Ga0209437_100023
707 Ga0209437_113631
708 Ga0209677_100525
709 Ga0209148_1000126
710 Ga0209148_1007709
711 Ga0209129_1000070
712 Ga0209233_1000127
713 Ga0209233_1000214
714 Ga0209455_1000105
715 Ga0209673_1036445
716 Ga0209130_1000242
717 Ga0209676_1001945
718 Ga0209676_1025564
719 Ga0209025_1000175
720 Ga0209025_1000240
721 Ga0209025_1001648
722 Ga0209025_1002267
723 Ga0209564_1000338
724 Ga0209564_1000341
725 Ga0209758_1030208
726 Ga0209758_1042558
727 Ga0209050_1012027
728 Ga0209256_1000534
729 Ga0209256_1000573
730 Ga0207426_1000483
731 Ga0207426_1022166
732 Ga0209051_1000192
733 Ga0209051_1020577
734 Ga0209051_1020896
735 Ga0209257_1000300
736 Ga0209257_1002029
737 Ga0209257_1005011
738 Ga0207710_10073308
739 Ga0207699_10055720
740 Ga0207695_10206822
741 Ga0207695_10266521
742 Ga0207695_10284633
743 Ga0207671_10000418
744 Ga0207693_10208515
745 Ga0207657_10023716
746 Ga0207649_10388056
747 Ga0207652_10366347
748 Ga0207681_10066348
749 Ga0207694_10067404
750 Ga0207650_10007578
751 Ga0207690_10269967
752 Ga0207690_10564547
753 Ga0207706_10301134
754 Ga0207670_10205294
755 Ga0207669_10040098
756 Ga0207704_10063642
757 Ga0207691_10188663
758 Ga0207679_10267230
759 Ga0207712_10222037
760 Ga0207640_10413754
761 Ga0207678_10238766
762 Ga0207702_10183324
763 Ga0207674_10491400
764 Ga0207674_10494513
765 Ga0207675_100036936
766 Ga0207675_100437391
767 Ga0209371_1001722
768 Ga0209371_1009909
769 Ga0209282_1000093
770 Ga0268256_1000785
771 Ga0268256_1002551
772 Ga0265331_10053692
773 Ga0307410_10029864
774 Ga0307406_10489217
775 Ga0307407_10003714
776 Ga0307409_100002825
777 Ga0307416_100265949
778 Ga0307414_10072585
779 Ga0307414_10152125
780 Ga0307414_10353236
781 Ga0307415_100176168
782 Ga0373941_0009623
783 Ga0395899_0002239
784 Ga0395898_0004769
785 Ga0395898_0284805
786 Ga0395905_0000321
787 Ga0395905_0068400
788 Ga0395901_0011113
789 Ga0395901_0404495
790 Ga0436360_0886486
791 Ga0436360_1098593
792 Ga0436361_0694290
793 Ga0439436_0000279
794 Ga0439438_012958
795 Ga0439466_0043540
796 Ga0439465_0000751
797 Ga0439465_0001030
798 Ga0439465_0003064
799 Ga0451837_0672962
800 Ga0451839_0286878
801 Ga0451841_0324813
802 Ga0451847_0135229
803 Ga0451849_0802431
804 Ga0451851_0116375
805 Ga0439448_0075249
806 Ga0439449_0081664
807 Ga0439458_0022365
808 Ga0439434_0012924
809 Ga0466963_0040293
810 Ga0466964_0030426
811 Ga0466970_0000092
812 Ga0466957_0046159
813 Ga0466958_0007987
814 Ga0466967_0140912
815 Ga0495629_0086413
816 Ga0495662_0024171
817 Ga0495585_0059838
818 Ga0495607_0044822
819 Ga0495610_0000016
820 Ga0495631_0025953
821 Ga0495643_0024612
822 Ga0495643_0026497
823 Ga0495643_0087487
824 Ga0495587_0123022
825 Ga0495633_0000895
826 Ga0495633_0012830
827 Ga0495656_0025327
828 Ga0495668_0004965
829 Ga0495625_0000210
830 Ga0495625_0007985
831 Ga0495625_0165735
832 Ga0495635_0203402
833 Ga0495661_0107895
834 Ga0495588_0122961
835 Ga0495657_0123810
836 Ga0495658_0302504
837 Ga0495649_0000001
838 Ga0495600_0054695
839 Ga0495600_0262563
840 Ga0495660_0000673
841 Ga0495660_0023648
842 Ga0495604_0007159
843 Ga0495681_0000507
844 Ga0495681_0094207
845 Ga0495686_0000895
846 Ga0495686_0002749
847 Ga0495686_0003551
848 Ga0495686_0015440
849 Ga0496109_0244347
850 Ga0496109_0404302
851 Ga0496110_0401827
852 Ga0496116_0000247
853 Ga0496116_0003190
854 Ga0496116_0006733
855 Ga0496116_0018236
856 Ga0496116_0048266
857 Ga0496117_0000105
858 Ga0496117_0001492
859 Ga0496118_0000168
860 Ga0496118_0002150
861 Ga0496118_0035272
862 Ga0496118_0043064
863 Ga0496118_0053946
864 Ga0496119_0000443
865 Ga0496119_0000887
866 Ga0496119_0003427
867 Ga0496120_0000818
868 Ga0496120_0029492
869 Ga0496120_0086412
870 Ga0496121_0000005
871 Ga0496121_0018333
872 Ga0496121_0073906
873 Ga0496121_0127272
874 Ga0496122_0001241
875 Ga0496122_0002116
876 Ga0496122_0057250
877 Ga0496122_0063057
878 Ga0496122_0103503
879 Ga0496122_0112205
880 Ga0496123_0001704
881 Ga0496123_0076032
882 Ga0496123_0131321
883 Ga0496123_0242544
884 Ga0496124_0000091
885 Ga0496124_0000254
886 Ga0496124_0002483
887 Ga0496124_0031267
888 Ga0496124_0035183
889 Ga0496124_0068831
890 Ga0496125_0000034
891 Ga0496125_0005508
892 Ga0496125_0211900
893 Ga0496126_0026321
894 Ga0496126_0042165
895 Ga0496126_0098573
896 Ga0496126_0377732
897 Ga0501032_0008593
898 Ga0501032_0019882
899 Ga0501032_0031140
900 Ga0501033_0000350
901 Ga0501033_0004563
902 Ga0501034_0000109
903 Ga0501034_0021544
904 Ga0501034_0039043
905 Ga0501034_0050108
906 Ga0501034_0117395
907 Ga0501036_0196698
908 Ga0501037_0000193
909 Ga0501037_0234790
910 Ga0501037_0285631
911 Ga0501038_0001744
912 Ga0501038_0183214
913 Ga0501039_0039516
914 Ga0501039_0201911
915 Ga0501041_0056638
916 Ga0501043_0000861
917 Ga0501043_0018589
918 Ga0501043_0058567
919 Ga0501047_0092662
920 Ga0501068_0003917
921 Ga0501068_0093202
922 Ga0501069_0000193
923 Ga0501069_0353946
924 Ga0501070_0023506
925 Ga0501070_0133177
926 Ga0501071_0010308
927 Ga0501071_0197871
928 Ga0501072_0296609
929 Ga0501073_0010379
930 Ga0501074_0016311
931 Ga0501238_011374
932 Ga0501079_0042948
933 Ga0501080_0046449
934 Ga0501080_0475799
935 Ga0501083_0000434
936 Ga0501241_015982
937 Ga0501035_0000791
938 Ga0501035_0001209
939 Ga0501035_0044869
940 Ga0501035_0132164
941 Ga0501035_0415868
942 Ga0501044_0008505
943 Ga0501044_0014505
944 Ga0501044_0052558
945 Ga0501044_0154669
946 Ga0501044_0164008
947 nmdc:mga03683_15150_c1
948 nmdc:mga03683_8953_c1
949 nmdc:mga03n38_353643_c1
950 nmdc:mga00v17_102107_c1
951 nmdc:mga00v17_14211_c1
952 nmdc:mga0yw44_104761_c1
953 nmdc:mga0yw44_186993_c1
954 nmdc:mga0yw44_48933_c1
955 nmdc:mga0k408_105410_c1
956 nmdc:mga06z11_187730_c1
957 nmdc:mga06z11_51697_c1
958 nmdc:mga07m45_42905_c1
959 nmdc:mga05p37_22572_c1
960 nmdc:mga05p37_79233_c1
961 nmdc:mga08y16_301492_c1
962 nmdc:mga08y16_508921_c1
963 nmdc:mga0sz30_15664_c1
964 nmdc:mga0sz30_84123_c1
965 Ga0500610_0023913
966 Ga0495655_0027987
967 Ga0500641_0015702
968 Ga0500593_000442
969 Ga0500618_000118
970 Ga0500618_005648
971 Ga0500658_0006159
972 Ga0500568_0000002
973 Ga0500568_0023208
974 Ga0500590_000037
975 Ga0500590_003038
976 Ga0500604_0002218
977 Ga0500604_0045878
978 Ga0500616_0000108
979 Ga0500616_0023485
980 Ga0500633_0001175
981 Ga0500636_0000013
982 Ga0590077_008423
983 Ga0587088_024576
984 Ga0587072_001056
985 2510136417
986 2510892575
987 2513568046
988 2513619358
989 2514018553
990 2515108627
991 2515632468
992 2515640645
993 2515661365
994 2517410271
995 2530644624
996 2551676978
997 2551686771
998 2551702183
999 2551720902
1000 2551741497
1001 2554249219
1002 2554249782
1003 2585397242
1004 2599416645
1005 2599722928
1006 2601612995
1007 2601749729
1008 2616295203
1009 2616309893
1010 2616550845
1011 2643805134
1012 2644005638
1013 2644065627
1014 2644146882
1015 2644310766
1016 2644334448
1017 2644375397
1018 2644417953
1019 2644451124
1020 2644493163
1021 2644501541
1022 2644520076
1023 2644545356
1024 2644616600
1025 2644673464
1026 2644674559
1027 2644687471
1028 2719183764
1029 2719668063
1030 2719728205
1031 2720494826
1032 2720611148
1033 2720616320
1034 2720629395
1035 2720771966
1036 2721145066
1037 2721155803
1038 2721167153
1039 2722838131
1040 2723029396
1041 2723563012
1042 2723570993
1043 2724042399
1044 2724086786
1045 2724106944
1046 2724107753
1047 2730105710
1048 2730161904
1049 2730300910
1050 2793324051
1051 2793343413
1052 2793346240
1053 2793355460
1054 2805930679
1055 2805934139
1056 2808989808
1057 2819561540
1058 2819613772
1059 2819642770
1060 2819688833
1061 2838019458
1062 2838025084
1063 2838036753
1064 2838050564
1065 2838062858
1066 2838071806
1067 2838662213
1068 2838671317
1069 2838703502
1070 2842149496
1071 2842197736
1072 2842203284
1073 2842210275
1074 2842253866
1075 2842268009
1076 2842283729
1077 2842289694
1078 2842311770
1079 2842321570
1080 2842401078
1081 2842407165
1082 2842414057
1083 2842420698
1084 2842425439
1085 2842432172
1086 2842438284
1087 2842443980
1088 2842450148
1089 2842466270
1090 2842472746
1091 2842493095
1092 2842499337
1093 2842500805
1094 2842515466
1095 2842525591
1096 2844165866
1097 2854915613
1098 2854920143
1099 2855830189
1100 2855875531
1101 2899848168
1102 2903451722
1103 2915996037
1104 2916014225
1105 2916017195
1106 2916041010
1107 2916048258
1108 2916075950
1109 2919104915
1110 2919170905
1111 2919176213
1112 2921215263
1113 2921241814
1114 2921287947
1115 2921297355
1116 2924149728
1117 2924152998
1118 2924161481
1119 2924169381
1120 2924190498
1121 2924205483
1122 2924219040
1123 2924225945
1124 2924232677
1125 2929142497
1126 2933598842
1127 2933602601
1128 2936386353
1129 2937006297
1130 2937019901
1131 2937068465
1132 2937092685
1133 2937104289
1134 2937123280
1135 2937851811
1136 2941506568
1137 2957385511
1138 2957391084
1139 2957405008
1140 2957413600
1141 2957415566
1142 2957433727
1143 2957447427
1144 2957470261
1145 2957473737
1146 2957487449
1147 2957492572
1148 2957503423
1149 2957510778
1150 2960586510
1151 2960606764
1152 2960614956
1153 2960628557
1154 2960642889
1155 2960649415
1156 2960663139
1157 2960674737
1158 2964628705
1159 2964653267
1160 2964659855
1161 2964676442
1162 2964680292
1163 2964690512
1164 2964718031
1165 2964725269
1166 2967683745
1167 2967697609
1168 2967711347
1169 2967718022
1170 2967724445
1171 2967738079
1172 2967748329
1173 2967750644
1174 2967774330
1175 2968087304
1176 2968141695
1177 2970024589
1178 2970038460
1179 2970058141
1180 2970063653
1181 2970073524
1182 2970077600
1183 2970091436
1184 2970112543
1185 2970133138
1186 2970142422
1187 2970159263
1188 2970168774
1189 2970175411
1190 2970188587
1191 2970195749
1192 2977526450
1193 2977543038
1194 2977555449
1195 2977564622
1196 2977572483
1197 2977576709
1198 2977923332
1199 2978974998
1200 2979091918
1201 2979100867
1202 2984514363
1203 2984523394
1204 2984542584
1205 2984589001
1206 2984606479
1207 2996889640
1208 3004212332
1209 3004224435
1210 3005418055
1211 3005452559
1212 637080542
1213 8002286556
1214 8003997511
1215 8005287838
1216 8005290656
1217 8005305022
1218 8005320023
1219 8005324167
1220 8005388476
1221 8005397642
1222 8005399270
1223 8005436993
1224 8005467199
1225 8005503075
1226 8005625594
1227 8005626107
1228 8005630617
1229 8005674993
1230 8005683428
1231 8005689434
1232 8018130452
1233 8018181193
1234 8024491214
1235 8024506121
1236 8056383519

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02735

Ku

Ku70/Ku80 beta-barrel domain

11

194

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bhv-assembly1.cif.gz_b dna-pk xlf mediated dimer bound to paxx 0.7673 7 204
1jeq-assembly1.cif.gz_A crystal structure of the ku heterodimer 0.7646 1 221
7zvt-assembly1.cif.gz_A cryoem structure of ku heterodimer bound to dna 0.7637 1 230
8asc-assembly1.cif.gz_E ku70/80 binds to the ku-binding motif of paxx 0.7628 4 218
6erf-assembly2.cif.gz_C complex of aplf factor and ku heterodimer bound to dna 0.7617 1 221
ID Description Score Start End Superfamily
af_Q8TC57_257_413_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.8457 93 175 2.40.290.10
af_Q4DHP5_233_418_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.8006 8 175 2.40.290.10
af_Q75IP6_213_415_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7838 4 175 2.40.290.10
af_A4I561_246_438_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7685 8 174 2.40.290.10
af_P9WKD9_3_185_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7624 6 188 2.40.290.10
ID Description Score Start End GO Terms
AF-A0A659XXU8-F1-model_v4 Ku protein 0.9525 105 180 GO:0003690
GO:0006303
AF-A0A0N1B535-F1-model_v4 Non-homologous end joining protein Ku 0.9456 1 230 GO:0003690
GO:0004386
GO:0006303
GO:0006310
AF-A0A7Y7M5X0-F1-model_v4 Ku protein 0.9434 1 230 GO:0003690
GO:0006303
AF-J3BVN7-F1-model_v4 Ku domain-containing protein 0.9431 97 229 GO:0003690
GO:0006303
AF-A0A560L186-F1-model_v4 Non-homologous end joining protein Ku 0.9408 1 230 GO:0003690
GO:0006303
GO:0006310

Map