F469699

General Info

Members Datasets Scaffolds Average Seq Length
618 249 611 139

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10081353|rootL2_100813534
Length 161
Sequence MKRFYLIGFALLMGFDTLAQLSFKHAGAGAFPPEASLAWLLRLLQQPWLYGALLGYIGAFFTWMSLLKHAPIGPAFAASHLEVVSVLALSAWLFGERLNALQVAGAVAIVAGIVCLARGEPDEDAQARAAAGDGTAAPSAVPSAAGHRAMAAGEADGGAAH

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
4 2739367700 Dyella sp. YR388 Isolate Unclassified
5 2884411467 Dyella sp. AD56 Isolate Rhizosphere
6 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
7 2928963466 Dyella japonica 1073 Isolate Unclassified
8 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
88 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
92 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
149 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
153 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
171 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
246 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
247 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
248 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 0.49
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.64
Nodule 0.32
Rhizoplane 3.56
Rhizosphere 63.75
Stem 0
Stem Tuber 0
Unclassified 14.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214811339 2209111006 Bacteria 685
2 JGI24739J22299_10007614 3300001989 Bacteria 4056
3 JGI24739J22299_10049283 3300001989 Bacteria 1366
4 JGI24737J22298_10006842 3300001990 Bacteria 3874
5 JGI24737J22298_10013559 3300001990 Bacteria 2651
6 JGI24735J21928_10004826 3300002067 Bacteria 4500
7 JGI25156J39149_1024196 3300002705 Bacteria 997
8 JGI25162J39368_1000138 3300002737 Bacteria 78713
9 JGI25162J39368_1000605 3300002737 Bacteria 25839
10 JGI25162J39368_1001369 3300002737 Bacteria 13418
11 JGI25162J39368_1001619 3300002737 Bacteria 11287
12 JGI25162J39368_1002664 3300002737 Bacteria 6547
13 JGI25157J39369_1000182 3300002741 Bacteria 53311
14 JGI25157J39369_1000253 3300002741 Bacteria 39977
15 JGI25157J39369_1001032 3300002741 Bacteria 12792
16 JGI25157J39369_1006786 3300002741 Bacteria 1708
17 JGI25157J39369_1010147 3300002741 Bacteria 1246
18 JGI25163J39215_1000444 3300002771 Bacteria 12688
19 JGI25164J39214_1000170 3300002772 Bacteria 60952
20 JGI25164J39214_1000390 3300002772 Bacteria 25835
21 JGI25164J39214_1000439 3300002772 Bacteria 22628
22 JGI25165J46597_1000224 3300003214 Bacteria 78713
23 JGI25165J46597_1000725 3300003214 Bacteria 25839
24 JGI25165J46597_1004499 3300003214 Bacteria 2965
25 JGI25153J46596_10012356 3300003215 Bacteria 3693
26 rootH2_10063399 3300003320 Bacteria 7364
27 rootH2_10208949 3300003320 Bacteria 2519
28 rootL2_10081353 3300003322 Bacteria 3488
29 Ga0006562J51391_1016133 3300003578 Bacteria 6100
30 Ga0006562J51391_1016134 3300003578 Bacteria 3610
31 Ga0055538_1002329 3300003751 Bacteria 2863
32 Ga0055533_1000506 3300003756 Bacteria 14133
33 Ga0055533_1004350 3300003756 Bacteria 2569
34 Ga0055525_1000164 3300003759 Bacteria 85555
35 Ga0055527_1000065 3300003760 Bacteria 88416
36 Ga0055527_1000272 3300003760 Bacteria 31210
37 Ga0055527_1000317 3300003760 Bacteria 25995
38 Ga0055535_1000216 3300003761 Bacteria 60912
39 Ga0055535_1000690 3300003761 Bacteria 25995
40 Ga0055535_1000716 3300003761 Bacteria 25197
41 Ga0055535_1000949 3300003761 Bacteria 19236
42 Ga0055542_1000097 3300003762 Bacteria 118227
43 Ga0055542_1000136 3300003762 Bacteria 93218
44 Ga0055542_1000140 3300003762 Bacteria 90195
45 Ga0055542_1000179 3300003762 Bacteria 78713
46 Ga0055542_1000932 3300003762 Bacteria 19284
47 Ga0055529_1000189 3300003763 Bacteria 84123
48 Ga0055529_1000335 3300003763 Bacteria 52579
49 Ga0055529_1008619 3300003763 Bacteria 1353
50 Ga0055537_1000021 3300003773 Bacteria 116840
51 Ga0055524_1000037 3300003775 Bacteria 167140
52 Ga0055524_1028565 3300003775 Bacteria 1668
53 Ga0055534_1000006 3300003784 Bacteria 234368
54 Ga0055528_1000006 3300003790 Bacteria 234368
55 Ga0055531_10003887 3300003794 Bacteria 9348
56 Ga0065165_1000566 3300005262 Bacteria 54948
57 Ga0065165_1003025 3300005262 Bacteria 12677
58 Ga0065716_1009210 3300005277 Bacteria 685
59 Ga0070658_10114304 3300005327 Bacteria 2238
60 Ga0070658_10199149 3300005327 Bacteria 1689
61 Ga0070680_100328929 3300005336 Bacteria 1298
62 Ga0070682_100027250 3300005337 Bacteria 3428
63 Ga0070682_100275457 3300005337 Bacteria 1224
64 Ga0070682_100312909 3300005337 Bacteria 1157
65 Ga0070660_100021077 3300005339 Bacteria 4800
66 Ga0070660_100131048 3300005339 Bacteria 2006
67 Ga0070660_100191114 3300005339 Bacteria 1658
68 Ga0070660_100317864 3300005339 Bacteria 1278
69 Ga0070660_100509730 3300005339 Bacteria 1001
70 Ga0070660_100647956 3300005339 Bacteria 884
71 Ga0070660_100915801 3300005339 Bacteria 739
72 Ga0070661_100029573 3300005344 Bacteria 3955
73 Ga0070661_101646289 3300005344 Bacteria 543
74 Ga0070659_100191664 3300005366 Bacteria 1680
75 Ga0070659_100231405 3300005366 Bacteria 1527
76 Ga0070659_100326043 3300005366 Bacteria 1284
77 Ga0070659_100777757 3300005366 Bacteria 831
78 Ga0070659_101945863 3300005366 Bacteria 527
79 Ga0070714_100000030 3300005435 Bacteria 136610
80 Ga0070714_100092470 3300005435 Bacteria 2651
81 Ga0070713_100001474 3300005436 Bacteria 15027
82 Ga0070711_100130051 3300005439 Bacteria 1874
83 Ga0070694_100069688 3300005444 Bacteria 2420
84 Ga0070663_100705725 3300005455 Bacteria 858
85 Ga0070662_100055644 3300005457 Bacteria 2870
86 Ga0070681_10040856 3300005458 Bacteria 4646
87 Ga0070681_10269327 3300005458 Bacteria 1615
88 Ga0070681_10627521 3300005458 Bacteria 989
89 Ga0068867_101433101 3300005459 Bacteria 641
90 Ga0070685_10000461 3300005466 Bacteria 23671
91 Ga0070679_100039770 3300005530 Bacteria 4675
92 Ga0070679_100149893 3300005530 Bacteria 2309
93 Ga0070684_101167710 3300005535 Bacteria 724
94 Ga0068853_100018029 3300005539 Bacteria 5836
95 Ga0068853_100243644 3300005539 Bacteria 1648
96 Ga0068853_101040921 3300005539 Bacteria 788
97 Ga0070696_100015121 3300005546 Bacteria 5181
98 Ga0070696_100106855 3300005546 Bacteria 2012
99 Ga0070693_100659557 3300005547 Bacteria 762
100 Ga0070665_100071137 3300005548 Bacteria 3485
101 Ga0068855_100066875 3300005563 Bacteria 4189
102 Ga0068855_100148459 3300005563 Bacteria 2667
103 Ga0068855_101869141 3300005563 Bacteria 609
104 Ga0068857_100012027 3300005577 Bacteria 7526
105 Ga0068857_100033648 3300005577 Bacteria 4534
106 Ga0068857_100279182 3300005577 Bacteria 1536
107 Ga0068854_100001248 3300005578 Bacteria 15268
108 Ga0068854_100062286 3300005578 Bacteria 2704
109 Ga0068854_100161396 3300005578 Bacteria 1736
110 Ga0068854_100242675 3300005578 Bacteria 1435
111 Ga0068856_100001493 3300005614 Bacteria 24470
112 Ga0068856_100260833 3300005614 Bacteria 1748
113 Ga0068856_100545950 3300005614 Bacteria 1180
114 Ga0068852_100067297 3300005616 Bacteria 3131
115 Ga0068852_100165028 3300005616 Bacteria 2072
116 Ga0068851_10024532 3300005834 Bacteria 2953
117 Ga0068851_10692160 3300005834 Bacteria 627
118 Ga0068858_100108278 3300005842 Bacteria 2594
119 Ga0068858_102202718 3300005842 Unclassified 545
120 Ga0068862_100400578 3300005844 Bacteria 1284
121 Ga0099823_1000028 3300006944 Bacteria 69723
122 Ga0105244_10028766 3300009036 Bacteria 2978
123 Ga0105250_10056527 3300009092 Bacteria 1575
124 Ga0105240_10000609 3300009093 Bacteria 66384
125 Ga0105240_10002324 3300009093 Bacteria 30759
126 Ga0105240_10005495 3300009093 Bacteria 18891
127 Ga0105240_10023541 3300009093 Bacteria 8141
128 Ga0105240_10027518 3300009093 Bacteria 7442
129 Ga0105240_10034726 3300009093 Bacteria 6502
130 Ga0105240_10429652 3300009093 Bacteria 1482
131 Ga0105247_10001759 3300009101 Bacteria 15236
132 Ga0105241_10177031 3300009174 Bacteria 1766
133 Ga0105241_10526954 3300009174 Bacteria 1057
134 Ga0105241_12634373 3300009174 Bacteria 505
135 Ga0105237_10000150 3300009545 Bacteria 97072
136 Ga0105237_10017018 3300009545 Bacteria 7546
137 Ga0105237_10041409 3300009545 Bacteria 4645
138 Ga0105237_10252220 3300009545 Bacteria 1767
139 Ga0105238_10017721 3300009551 Bacteria 7241
140 Ga0105238_10053232 3300009551 Bacteria 4067
141 Ga0105238_10145302 3300009551 Bacteria 2348
142 Ga0105238_10159548 3300009551 Bacteria 2231
143 Ga0105238_10505221 3300009551 Bacteria 1210
144 Ga0105249_10033072 3300009553 Bacteria 4682
145 Ga0105239_10000043 3300010375 Bacteria 196600
146 Ga0105239_10627913 3300010375 Bacteria 1226
147 Ga0105239_11786623 3300010375 Bacteria 712
148 Ga0157314_1000939 3300012500 Bacteria 2337
149 Ga0157373_10035698 3300013100 Bacteria 3568
150 Ga0157373_10113517 3300013100 Bacteria 1904
151 Ga0157373_10130462 3300013100 Bacteria 1768
152 Ga0157373_10260475 3300013100 Bacteria 1227
153 Ga0157373_10292167 3300013100 Bacteria 1156
154 Ga0157373_10435508 3300013100 Bacteria 942
155 Ga0157373_10541377 3300013100 Bacteria 844
156 Ga0157371_10007045 3300013102 Bacteria 9147
157 Ga0157371_10025302 3300013102 Bacteria 4327
158 Ga0157371_10054194 3300013102 Bacteria 2848
159 Ga0157371_10065001 3300013102 Bacteria 2584
160 Ga0157370_10000662 3300013104 Bacteria 42848
161 Ga0157370_10001955 3300013104 Bacteria 25396
162 Ga0157370_10005446 3300013104 Bacteria 14278
163 Ga0157370_10019836 3300013104 Bacteria 6728
164 Ga0157370_10055639 3300013104 Bacteria 3768
165 Ga0157370_10223059 3300013104 Bacteria 1746
166 Ga0157370_10251118 3300013104 Bacteria 1636
167 Ga0157370_10287348 3300013104 Bacteria 1519
168 Ga0157370_10596023 3300013104 Bacteria 1012
169 Ga0157370_11923945 3300013104 Bacteria 530
170 Ga0157369_10000580 3300013105 Bacteria 47824
171 Ga0157369_10027481 3300013105 Bacteria 6306
172 Ga0157369_10042069 3300013105 Bacteria 4985
173 Ga0157369_10066969 3300013105 Bacteria 3863
174 Ga0157369_10540879 3300013105 Bacteria 1204
175 Ga0163162_10127993 3300013306 Bacteria 2647
176 Ga0157372_10009430 3300013307 Bacteria 10386
177 Ga0157372_10031116 3300013307 Bacteria 5843
178 Ga0157372_10058048 3300013307 Bacteria 4325
179 Ga0157372_10458414 3300013307 Bacteria 1486
180 Ga0163163_12918942 3300014325 Bacteria 533
181 Ga0182008_10000262 3300014497 Bacteria 41194
182 Ga0182008_10008655 3300014497 Bacteria 5539
183 Ga0182008_10085561 3300014497 Bacteria 1553
184 Ga0182008_10114951 3300014497 Bacteria 1335
185 Ga0182008_10684538 3300014497 Bacteria 584
186 Ga0182008_10995007 3300014497 Bacteria 500
187 Ga0182006_1000031 3300015261 Bacteria 240055
188 Ga0182006_1005217 3300015261 Bacteria 6226
189 Ga0182006_1075906 3300015261 Bacteria 1236
190 Ga0182006_1192280 3300015261 Bacteria 678
191 Ga0182007_10002777 3300015262 Bacteria 8548
192 Ga0182007_10026485 3300015262 Bacteria 2009
193 Ga0182007_10031851 3300015262 Bacteria 1794
194 Ga0182007_10037606 3300015262 Bacteria 1625
195 Ga0182007_10379145 3300015262 Bacteria 536
196 Ga0182005_1000352 3300015265 Bacteria 26091
197 Ga0182005_1000424 3300015265 Bacteria 22547
198 Ga0182005_1002188 3300015265 Bacteria 7184
199 Ga0183368_1003 3300015687 Bacteria 1276390
200 Ga0183360_10002 3300015689 Bacteria 953821
201 Ga0163161_10026249 3300017792 Bacteria 4127
202 Ga0206353_11697107 3300020082 Bacteria 856
203 Ga0209435_108199 3300025206 Bacteria 1152
204 Ga0209760_101163 3300025207 Bacteria 2964
205 Ga0209784_100068 3300025224 Bacteria 152526
206 Ga0209566_103158 3300025225 Bacteria 2644
207 Ga0209674_100012 3300025226 Bacteria 950162
208 Ga0209674_100247 3300025226 Bacteria 45826
209 Ga0209674_101344 3300025226 Bacteria 6729
210 Ga0209674_101766 3300025226 Bacteria 5250
211 Ga0209674_112671 3300025226 Bacteria 813
212 Ga0209672_100029 3300025228 Bacteria 339298
213 Ga0209672_100049 3300025228 Bacteria 238787
214 Ga0209672_100828 3300025228 Bacteria 14455
215 Ga0209672_101400 3300025228 Bacteria 8851
216 Ga0209563_100051 3300025230 Bacteria 340545
217 Ga0207427_100118 3300025231 Bacteria 102109
218 Ga0207427_100120 3300025231 Bacteria 101516
219 Ga0207427_100140 3300025231 Bacteria 84637
220 Ga0209437_100020 3300025233 Bacteria 656374
221 Ga0209437_100147 3300025233 Bacteria 161997
222 Ga0209437_100193 3300025233 Bacteria 122027
223 Ga0209437_100231 3300025233 Bacteria 94387
224 Ga0209437_106636 3300025233 Bacteria 1918
225 Ga0209437_113991 3300025233 Bacteria 1132
226 Ga0209258_100053 3300025242 Bacteria 339233
227 Ga0209258_100087 3300025242 Bacteria 238787
228 Ga0209258_100149 3300025242 Bacteria 162184
229 Ga0209258_100360 3300025242 Bacteria 61533
230 Ga0209258_101666 3300025242 Bacteria 7106
231 Ga0209258_111253 3300025242 Bacteria 1133
232 Ga0209646_1001031 3300025246 Bacteria 8416
233 Ga0209646_1001535 3300025246 Bacteria 6093
234 Ga0209026_1000037 3300025250 Bacteria 282562
235 Ga0209026_1000060 3300025250 Bacteria 220052
236 Ga0209026_1000099 3300025250 Bacteria 161750
237 Ga0209026_1000122 3300025250 Bacteria 126140
238 Ga0209026_1010796 3300025250 Bacteria 1683
239 Ga0209148_1000002 3300025254 Bacteria 2399500
240 Ga0209148_1000009 3300025254 Bacteria 1395625
241 Ga0209148_1000010 3300025254 Bacteria 1265567
242 Ga0209148_1000096 3300025254 Bacteria 238787
243 Ga0209148_1000143 3300025254 Bacteria 162184
244 Ga0209148_1001326 3300025254 Bacteria 13150
245 Ga0209759_1000295 3300025256 Bacteria 69093
246 Ga0209759_1000755 3300025256 Bacteria 27927
247 Ga0209759_1005891 3300025256 Bacteria 4195
248 Ga0209759_1011516 3300025256 Bacteria 2508
249 Ga0209759_1018361 3300025256 Bacteria 1690
250 Ga0209759_1039457 3300025256 Bacteria 829
251 Ga0209129_1001547 3300025258 Bacteria 12668
252 Ga0209233_1000009 3300025261 Bacteria 1265567
253 Ga0209233_1000020 3300025261 Bacteria 798224
254 Ga0209233_1000147 3300025261 Bacteria 186517
255 Ga0209233_1016709 3300025261 Bacteria 2016
256 Ga0209233_1019288 3300025261 Bacteria 1816
257 Ga0209565_1000002 3300025263 Bacteria 1423083
258 Ga0209565_1013220 3300025263 Bacteria 1939
259 Ga0209455_1000060 3300025272 Bacteria 339298
260 Ga0209455_1000086 3300025272 Bacteria 244650
261 Ga0209455_1000088 3300025272 Bacteria 238787
262 Ga0209455_1000323 3300025272 Bacteria 47398
263 Ga0209455_1003818 3300025272 Bacteria 5164
264 Ga0209673_1000002 3300025273 Bacteria 1423083
265 Ga0209673_1005616 3300025273 Bacteria 6264
266 Ga0209675_1000002 3300025291 Bacteria 1423083
267 Ga0209564_1000004 3300025295 Bacteria 1424639
268 Ga0209758_1003144 3300025297 Bacteria 15527
269 Ga0209758_1024338 3300025297 Bacteria 2702
270 Ga0209758_1104395 3300025297 Bacteria 798
271 Ga0209758_1137551 3300025297 Bacteria 637
272 Ga0209050_1007094 3300025298 Bacteria 6406
273 Ga0209256_1000004 3300025299 Bacteria 1424643
274 Ga0209256_1001298 3300025299 Bacteria 26918
275 Ga0209051_1036057 3300025303 Bacteria 1832
276 Ga0209051_1056415 3300025303 Bacteria 1267
277 Ga0209257_1004442 3300025304 Bacteria 10862
278 Ga0207656_10006823 3300025321 Bacteria 4129
279 Ga0207655_1005575 3300025728 Bacteria 8528
280 Ga0207692_10105317 3300025898 Bacteria 1556
281 Ga0207710_10030777 3300025900 Bacteria 2343
282 Ga0207647_10000008 3300025904 Bacteria 192602
283 Ga0207647_10010279 3300025904 Bacteria 6611
284 Ga0207647_10017679 3300025904 Bacteria 4843
285 Ga0207647_10025555 3300025904 Bacteria 3877
286 Ga0207705_10065518 3300025909 Bacteria 2626
287 Ga0207705_10445480 3300025909 Bacteria 1004
288 Ga0207707_10031108 3300025912 Bacteria 4670
289 Ga0207707_10049060 3300025912 Bacteria 3678
290 Ga0207707_10065252 3300025912 Bacteria 3171
291 Ga0207707_10445638 3300025912 Bacteria 1108
292 Ga0207695_10000007 3300025913 Bacteria 1092551
293 Ga0207695_10002140 3300025913 Bacteria 29914
294 Ga0207695_10004510 3300025913 Bacteria 18950
295 Ga0207695_10004697 3300025913 Bacteria 18500
296 Ga0207695_10005651 3300025913 Bacteria 16501
297 Ga0207695_10016227 3300025913 Bacteria 8729
298 Ga0207695_10017458 3300025913 Bacteria 8351
299 Ga0207695_10445277 3300025913 Bacteria 1178
300 Ga0207671_10000021 3300025914 Bacteria 300409
301 Ga0207671_10000570 3300025914 Bacteria 49510
302 Ga0207671_10014511 3300025914 Bacteria 6222
303 Ga0207671_10209588 3300025914 Bacteria 1524
304 Ga0207671_10638963 3300025914 Bacteria 848
305 Ga0207663_10158070 3300025916 Bacteria 1597
306 Ga0207660_10382622 3300025917 Bacteria 1131
307 Ga0207657_10122040 3300025919 Bacteria 2143
308 Ga0207657_10505889 3300025919 Bacteria 946
309 Ga0207657_10831361 3300025919 Bacteria 713
310 Ga0207657_10854408 3300025919 Bacteria 702
311 Ga0207657_11016520 3300025919 Bacteria 636
312 Ga0207649_10024302 3300025920 Bacteria 3521
313 Ga0207649_10127093 3300025920 Bacteria 1727
314 Ga0207649_10314006 3300025920 Bacteria 1149
315 Ga0207652_10437223 3300025921 Bacteria 1179
316 Ga0207652_10510715 3300025921 Bacteria 1081
317 Ga0207694_10022646 3300025924 Bacteria 4766
318 Ga0207694_10044760 3300025924 Bacteria 3417
319 Ga0207694_10100021 3300025924 Bacteria 2297
320 Ga0207700_10102431 3300025928 Bacteria 2286
321 Ga0207664_10000026 3300025929 Bacteria 194571
322 Ga0207664_10001232 3300025929 Bacteria 16942
323 Ga0207664_10014498 3300025929 Bacteria 5694
324 Ga0207690_10003519 3300025932 Bacteria 9330
325 Ga0207690_10026092 3300025932 Bacteria 3677
326 Ga0207690_10026659 3300025932 Bacteria 3641
327 Ga0207690_10030691 3300025932 Bacteria 3431
328 Ga0207690_10190131 3300025932 Bacteria 1552
329 Ga0207706_10016229 3300025933 Bacteria 6730
330 Ga0207706_11299653 3300025933 Bacteria 601
331 Ga0207670_10003742 3300025936 Bacteria 8081
332 Ga0207667_10000141 3300025949 Bacteria 109666
333 Ga0207667_10004475 3300025949 Bacteria 17112
334 Ga0207667_10030752 3300025949 Bacteria 5802
335 Ga0207667_10036239 3300025949 Bacteria 5288
336 Ga0207667_10815264 3300025949 Bacteria 929
337 Ga0207668_10058790 3300025972 Bacteria 2689
338 Ga0207640_10000268 3300025981 Bacteria 35119
339 Ga0207640_10005600 3300025981 Bacteria 6847
340 Ga0207640_10076565 3300025981 Bacteria 2271
341 Ga0207640_10299994 3300025981 Bacteria 1270
342 Ga0207640_10726831 3300025981 Bacteria 854
343 Ga0207703_10042601 3300026035 Bacteria 3642
344 Ga0207703_11895906 3300026035 Unclassified 572
345 Ga0207639_10012868 3300026041 Bacteria 5838
346 Ga0207639_10411095 3300026041 Bacteria 1221
347 Ga0207639_10495673 3300026041 Bacteria 1115
348 Ga0207678_10021249 3300026067 Bacteria 5690
349 Ga0207678_10199974 3300026067 Bacteria 1708
350 Ga0207678_10335394 3300026067 Bacteria 1302
351 Ga0207678_10420241 3300026067 Bacteria 1159
352 Ga0207702_10000143 3300026078 Bacteria 84903
353 Ga0207702_10005861 3300026078 Bacteria 10687
354 Ga0207702_10104281 3300026078 Bacteria 2509
355 Ga0207702_10248718 3300026078 Bacteria 1669
356 Ga0207648_11637421 3300026089 Bacteria 605
357 Ga0207674_10018823 3300026116 Bacteria 7492
358 Ga0207674_10028427 3300026116 Bacteria 5902
359 Ga0207674_10053534 3300026116 Bacteria 4113
360 Ga0207683_10537747 3300026121 Bacteria 1080
361 Ga0207698_10050414 3300026142 Bacteria 3175
362 Ga0207698_10146895 3300026142 Bacteria 2040
363 Ga0209389_1002696 3300027296 Bacteria 13795
364 Ga0209371_1028278 3300027312 Bacteria 1253
365 Ga0268266_10067831 3300028379 Bacteria 3088
366 Ga0268265_10047181 3300028380 Bacteria 3226
367 Ga0268256_1031109 3300030500 Bacteria 1285
368 Ga0316575_10120433 3300031665 Bacteria 1073
369 Ga0307412_10001089 3300031911 Bacteria 15538
370 Ga0307412_10009657 3300031911 Bacteria 5539
371 Ga0307414_10006721 3300032004 Bacteria 6434
372 Ga0307414_11436015 3300032004 Bacteria 641
373 Ga0395899_0049847 3300037312 Bacteria 3111
374 Ga0395899_0078980 3300037312 Bacteria 2397
375 Ga0395899_0289097 3300037312 Bacteria 1112
376 Ga0395900_0000012 3300037418 Bacteria 401198
377 Ga0395900_0043991 3300037418 Bacteria 4602
378 Ga0395900_0094855 3300037418 Bacteria 3065
379 Ga0395898_0000144 3300037466 Bacteria 187889
380 Ga0395898_0000278 3300037466 Bacteria 124490
381 Ga0395898_0047872 3300037466 Bacteria 4193
382 Ga0395898_0195278 3300037466 Bacteria 1933
383 Ga0395898_0215239 3300037466 Bacteria 1832
384 Ga0395898_0250134 3300037466 Bacteria 1690
385 Ga0395905_0065805 3300037471 Bacteria 3394
386 Ga0395901_0002971 3300038443 Bacteria 17103
387 Ga0395901_0003001 3300038443 Bacteria 17020
388 Ga0395901_0043917 3300038443 Bacteria 4635
389 Ga0395901_0064734 3300038443 Bacteria 3806
390 Ga0395901_0085942 3300038443 Bacteria 3288
391 Ga0395901_0163441 3300038443 Bacteria 2338
392 Ga0395901_0297520 3300038443 Bacteria 1673
393 Ga0395901_0308117 3300038443 Bacteria 1640
394 Ga0395901_0517473 3300038443 Bacteria 1213
395 Ga0436361_0457520 3300039447 Bacteria 1109
396 Ga0439436_0000022 3300041404 Bacteria 60408
397 Ga0451793_0109338 3300041452 Bacteria 4138
398 Ga0439445_0045814 3300042004 Bacteria 1171
399 Ga0439448_0043018 3300042005 Bacteria 1466
400 Ga0439448_0139858 3300042005 Bacteria 837
401 Ga0450911_003004 3300042115 Bacteria 3102
402 Ga0451577_0013048 3300042876 Bacteria 7795
403 Ga0466969_0011768 3300044656 Bacteria 4627
404 Ga0466969_0096507 3300044656 Bacteria 1395
405 Ga0466969_0160241 3300044656 Bacteria 1034
406 Ga0466969_0173790 3300044656 Bacteria 987
407 Ga0466972_0016889 3300044658 Bacteria 3650
408 Ga0466975_0097397 3300044661 Bacteria 2094
409 Ga0466982_0000005 3300044672 Bacteria 364340
410 Ga0466966_0001494 3300044684 Bacteria 14996
411 Ga0466961_0000566 3300044693 Bacteria 23533
412 Ga0466961_0016490 3300044693 Bacteria 4746
413 Ga0466961_0048925 3300044693 Bacteria 2702
414 Ga0466961_0097893 3300044693 Bacteria 1849
415 Ga0466961_0116544 3300044693 Bacteria 1678
416 Ga0466961_0135840 3300044693 Bacteria 1541
417 Ga0466964_0031182 3300044706 Bacteria 2112
418 Ga0466971_0005312 3300044719 Bacteria 5586
419 Ga0466971_0010066 3300044719 Bacteria 4130
420 Ga0466971_0210131 3300044719 Bacteria 920
421 Ga0466968_0001781 3300044735 Bacteria 7770
422 Ga0466970_0005776 3300044765 Bacteria 6151
423 Ga0466970_0077536 3300044765 Bacteria 1791
424 Ga0466970_0345714 3300044765 Bacteria 843
425 Ga0466957_0057654 3300044842 Bacteria 2377
426 Ga0466957_0114747 3300044842 Bacteria 1712
427 Ga0466957_0168536 3300044842 Bacteria 1425
428 Ga0466957_0892428 3300044842 Bacteria 635
429 Ga0466960_0011759 3300044901 Bacteria 3674
430 Ga0466959_0000204 3300045049 Bacteria 38407
431 Ga0466959_0008851 3300045049 Bacteria 7136
432 Ga0466959_0015619 3300045049 Bacteria 5535
433 Ga0466959_0023999 3300045049 Bacteria 4515
434 Ga0466959_0093158 3300045049 Bacteria 2162
435 Ga0466958_0008283 3300045836 Bacteria 5755
436 Ga0466958_0015594 3300045836 Bacteria 4358
437 Ga0466958_0026658 3300045836 Bacteria 3416
438 Ga0466967_1939174 3300045976 Bacteria 586
439 Ga0495617_000120 3300046452 Bacteria 52244
440 Ga0495617_000348 3300046452 Bacteria 25506
441 Ga0495638_0000007 3300046460 Bacteria 602783
442 Ga0495638_0000194 3300046460 Bacteria 88601
443 Ga0495638_0000213 3300046460 Bacteria 81547
444 Ga0495638_0000498 3300046460 Bacteria 46678
445 Ga0495638_0018390 3300046460 Bacteria 4641
446 Ga0495650_0000202 3300046471 Bacteria 129910
447 Ga0495650_0000703 3300046471 Bacteria 42860
448 Ga0495605_0051913 3300046474 Bacteria 1995
449 Ga0495584_0000688 3300046491 Bacteria 22464
450 Ga0495585_0000200 3300046492 Bacteria 62445
451 Ga0495585_0004150 3300046492 Bacteria 9473
452 Ga0495585_0296953 3300046492 Bacteria 795
453 Ga0495607_0000090 3300046501 Bacteria 94252
454 Ga0495607_0000244 3300046501 Bacteria 58158
455 Ga0495607_0009076 3300046501 Bacteria 6758
456 Ga0495607_0259168 3300046501 Bacteria 833
457 Ga0495583_0058138 3300046506 Bacteria 1736
458 Ga0495606_0000218 3300046507 Bacteria 101645
459 Ga0495606_0001182 3300046507 Bacteria 36798
460 Ga0495606_0001609 3300046507 Bacteria 29457
461 Ga0495606_0045304 3300046507 Bacteria 2916
462 Ga0495606_0197150 3300046507 Bacteria 1150
463 Ga0495610_0001156 3300046512 Bacteria 24006
464 Ga0495610_0061610 3300046512 Bacteria 1781
465 Ga0495616_0000006 3300046513 Bacteria 234766
466 Ga0495616_0006144 3300046513 Bacteria 7313
467 Ga0495616_0429304 3300046513 Bacteria 538
468 Ga0495620_0000806 3300046515 Bacteria 19267
469 Ga0495631_0000398 3300046518 Bacteria 30055
470 Ga0495631_0000820 3300046518 Bacteria 19864
471 Ga0495631_0342553 3300046518 Bacteria 636
472 Ga0495632_0001202 3300046519 Bacteria 21984
473 Ga0495632_0011519 3300046519 Bacteria 5156
474 Ga0495632_0022346 3300046519 Bacteria 3392
475 Ga0495648_0000759 3300046524 Bacteria 34422
476 Ga0495648_0002324 3300046524 Bacteria 17692
477 Ga0495663_0008452 3300046525 Bacteria 2851
478 Ga0495633_0024804 3300046558 Bacteria 2959
479 Ga0495668_0002024 3300046616 Bacteria 17702
480 Ga0495611_0000001 3300046648 Bacteria 2628469
481 Ga0495611_0000126 3300046648 Bacteria 53596
482 Ga0495625_0000200 3300046660 Bacteria 95445
483 Ga0495625_0004350 3300046660 Bacteria 13456
484 Ga0495625_0027318 3300046660 Bacteria 4298
485 Ga0495625_0046163 3300046660 Bacteria 3144
486 Ga0495625_0055139 3300046660 Bacteria 2836
487 Ga0495661_0000316 3300046665 Bacteria 54198
488 Ga0495661_0033224 3300046665 Bacteria 3255
489 Ga0495670_0000526 3300046691 Bacteria 18161
490 Ga0495670_0001971 3300046691 Bacteria 10084
491 Ga0495670_0368421 3300046691 Bacteria 774
492 Ga0495671_0000457 3300046692 Bacteria 32058
493 Ga0495649_0013789 3300046694 Bacteria 4652
494 Ga0495649_0041214 3300046694 Bacteria 2526
495 Ga0495589_0000008 3300046794 Bacteria 266071
496 Ga0495660_0000129 3300046810 Bacteria 83044
497 Ga0495660_0000133 3300046810 Bacteria 81572
498 Ga0495683_0004255 3300047323 Bacteria 8171
499 Ga0495679_000004 3300047446 Bacteria 748056
500 Ga0495673_0000004 3300047469 Bacteria 1354526
501 Ga0495673_0000041 3300047469 Bacteria 296723
502 Ga0495673_0002539 3300047469 Bacteria 12740
503 Ga0495673_0089300 3300047469 Bacteria 1262
504 Ga0495681_0203478 3300047470 Bacteria 802
505 Ga0495686_0003220 3300047472 Bacteria 14363
506 Ga0495686_0015252 3300047472 Bacteria 5256
507 Ga0495686_0021874 3300047472 Bacteria 4237
508 Ga0496100_0053164 3300048903 Bacteria 2636
509 Ga0496100_0107225 3300048903 Bacteria 1935
510 Ga0496101_0000399 3300048904 Bacteria 28414
511 Ga0496101_0066354 3300048904 Bacteria 2632
512 Ga0496104_0029148 3300048907 Bacteria 5119
513 Ga0496104_0177553 3300048907 Bacteria 2040
514 Ga0496105_0004228 3300048908 Bacteria 10787
515 Ga0496105_0780361 3300048908 Bacteria 728
516 Ga0496106_0023931 3300048909 Bacteria 4538
517 Ga0496106_0127954 3300048909 Bacteria 1990
518 Ga0496106_0218359 3300048909 Bacteria 1520
519 Ga0496106_0249028 3300048909 Bacteria 1420
520 Ga0496106_0784324 3300048909 Bacteria 756
521 Ga0496113_0011972 3300048916 Bacteria 5815
522 Ga0496113_0056358 3300048916 Bacteria 2950
523 Ga0496113_0748372 3300048916 Bacteria 778
524 Ga0496114_0174869 3300048917 Bacteria 1873
525 Ga0496115_0000206 3300048918 Bacteria 54824
526 Ga0496115_0000490 3300048918 Bacteria 31241
527 Ga0496115_0014801 3300048918 Bacteria 5915
528 Ga0496115_0085921 3300048918 Bacteria 2566
529 Ga0496116_0000871 3300048919 Bacteria 37596
530 Ga0496116_0056772 3300048919 Bacteria 2564
531 Ga0496116_0088819 3300048919 Bacteria 1887
532 Ga0496116_0092516 3300048919 Bacteria 1834
533 Ga0496117_0007421 3300048920 Bacteria 10711
534 Ga0496117_0016893 3300048920 Bacteria 6123
535 Ga0496117_0023348 3300048920 Bacteria 4932
536 Ga0496117_0249295 3300048920 Bacteria 969
537 Ga0496117_0411350 3300048920 Unclassified 679
538 Ga0496118_0009407 3300048921 Bacteria 9870
539 Ga0496118_0013752 3300048921 Bacteria 7631
540 Ga0496118_0016111 3300048921 Bacteria 6875
541 Ga0496118_0021066 3300048921 Bacteria 5755
542 Ga0496118_0072559 3300048921 Bacteria 2471
543 Ga0496118_0180092 3300048921 Bacteria 1278
544 Ga0496119_0000690 3300048922 Bacteria 45185
545 Ga0496119_0003147 3300048922 Bacteria 17350
546 Ga0496119_0014114 3300048922 Bacteria 6286
547 Ga0496119_0182883 3300048922 Bacteria 1098
548 Ga0496120_0000386 3300048923 Bacteria 71308
549 Ga0496120_0001439 3300048923 Bacteria 28598
550 Ga0496120_0076881 3300048923 Bacteria 1818
551 Ga0496120_0210877 3300048923 Bacteria 934
552 Ga0496121_0001076 3300048924 Bacteria 48261
553 Ga0496121_0001343 3300048924 Bacteria 42115
554 Ga0496121_0001490 3300048924 Bacteria 39440
555 Ga0496121_0001516 3300048924 Bacteria 38982
556 Ga0496121_0003543 3300048924 Bacteria 22104
557 Ga0496121_0005789 3300048924 Bacteria 15685
558 Ga0496121_0033540 3300048924 Bacteria 4644
559 Ga0496121_0085144 3300048924 Bacteria 2489
560 Ga0496121_0095222 3300048924 Bacteria 2314
561 Ga0496121_0099959 3300048924 Bacteria 2240
562 Ga0496121_0113718 3300048924 Bacteria 2059
563 Ga0496121_0121717 3300048924 Bacteria 1970
564 Ga0496121_0140148 3300048924 Bacteria 1795
565 Ga0496122_0059905 3300048925 Bacteria 2808
566 Ga0496122_0070816 3300048925 Bacteria 2488
567 Ga0496122_0182488 3300048925 Bacteria 1250
568 Ga0496122_0544003 3300048925 Bacteria 555
569 Ga0496123_0002220 3300048926 Bacteria 24637
570 Ga0496123_0015659 3300048926 Bacteria 6205
571 Ga0496123_0018729 3300048926 Bacteria 5487
572 Ga0496123_0029338 3300048926 Bacteria 4052
573 Ga0496123_0123842 3300048926 Bacteria 1447
574 Ga0496124_0001682 3300048927 Bacteria 31370
575 Ga0496124_0002165 3300048927 Bacteria 26338
576 Ga0496124_0207846 3300048927 Bacteria 1483
577 Ga0496124_0704787 3300048927 Bacteria 639
578 Ga0496125_0002769 3300048928 Bacteria 22183
579 Ga0496125_0012798 3300048928 Bacteria 8294
580 Ga0496125_0042580 3300048928 Bacteria 3864
581 Ga0496125_0043432 3300048928 Bacteria 3815
582 Ga0496126_0007673 3300048929 Bacteria 11776
583 Ga0496126_0010754 3300048929 Bacteria 9555
584 Ga0496126_0027844 3300048929 Bacteria 5391
585 Ga0496126_0031552 3300048929 Bacteria 5003
586 Ga0496126_0073690 3300048929 Bacteria 3035
587 Ga0496126_0106924 3300048929 Bacteria 2441
588 Ga0496126_0191547 3300048929 Bacteria 1731
589 Ga0495678_000158 3300049459 Bacteria 81058
590 Ga0495678_058029 3300049459 Bacteria 1464
591 Ga0495678_201012 3300049459 Bacteria 614
592 Ga0495682_0001065 3300049460 Bacteria 16148
593 Ga0495682_0010193 3300049460 Bacteria 3650
594 Ga0501036_1417372 3300049572 Bacteria 563
595 Ga0501037_0760215 3300049573 Bacteria 642
596 Ga0501047_0810947 3300049581 Bacteria 751
597 Ga0501048_0015431 3300049582 Bacteria 5642
598 Ga0501035_0099195 3300049822 Bacteria 2557
599 Ga0501044_0044040 3300049823 Bacteria 4634
600 Ga0501044_0270253 3300049823 Bacteria 1636
601 Ga0501044_0408565 3300049823 Bacteria 1269
602 Ga0501044_0702292 3300049823 Bacteria 897
603 nmdc:mga0sz30_120486_c1 3300050516 Bacteria 1153
604 Ga0500643_000140 3300053087 Bacteria 72592
605 Ga0500555_000327 3300053103 Bacteria 20441
606 Ga0500562_000937 3300053108 Bacteria 7099
607 Ga0500586_096669 3300053145 Bacteria 1035
608 Ga0500633_0001235 3300053160 Bacteria 4693
609 Ga0500634_0030361 3300053161 Bacteria 2946
610 Ga0500645_001152 3300053730 Bacteria 14285
611 Ga0466962_0006730 3300061719 Bacteria 5509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2941489479 2941494180 125
2 3300005344 Ga0070661_101646289 Ga0070661_1016462892 126
3 3300009101 Ga0105247_10001759 Ga0105247_100017595 126
4 3300014497 Ga0182008_10008655 Ga0182008_100086554 126
5 3300015261 Ga0182006_1000031 Ga0182006_1000031189 126
6 3300015262 Ga0182007_10002777 Ga0182007_100027773 126
7 3300015265 Ga0182005_1002188 Ga0182005_10021884 126
8 3300025900 Ga0207710_10030777 Ga0207710_100307772 126
9 3300046507 Ga0495606_0197150 Ga0495606_0197150_302_703 126
10 3300046616 Ga0495668_0002024 Ga0495668_0002024_6632_7033 126
11 3300046810 Ga0495660_0000129 Ga0495660_0000129_71451_71852 126
12 3300047469 Ga0495673_0000004 Ga0495673_0000004_479039_479440 126
13 3300048924 Ga0496121_0003543 Ga0496121_0003543_11198_11599 126
14 iso_pu_bacteria 2537561836 2538832171 126
15 iso_pu_bacteria 2895395659 2895398036 126
16 3300046519 Ga0495632_0001202 Ga0495632_0001202_12571_12969 128
17 3300048928 Ga0496125_0012798 Ga0496125_0012798_1945_2421 128
18 3300048929 Ga0496126_0191547 Ga0496126_0191547_842_1318 128
19 iso_pu_bacteria 2718218334 2721026184 128
20 3300003320 rootH2_10208949 rootH2_102089492 129
21 3300003773 Ga0055537_1000021 Ga0055537_100002143 129
22 3300003775 Ga0055524_1000037 Ga0055524_1000037122 129
23 3300003784 Ga0055534_1000006 Ga0055534_1000006178 129
24 3300003790 Ga0055528_1000006 Ga0055528_1000006178 129
25 3300005262 Ga0065165_1000566 Ga0065165_100056641 129
26 3300005458 Ga0070681_10040856 Ga0070681_100408564 129
27 3300005466 Ga0070685_10000461 Ga0070685_1000046112 129
28 3300005616 Ga0068852_100067297 Ga0068852_1000672975 129
29 3300005842 Ga0068858_102202718 Ga0068858_1022027182 129
30 3300009093 Ga0105240_10000609 Ga0105240_1000060966 129
31 3300009545 Ga0105237_10041409 Ga0105237_100414092 129
32 3300009551 Ga0105238_10017721 Ga0105238_100177218 129
33 3300010375 Ga0105239_10627913 Ga0105239_106279131 129
34 3300013100 Ga0157373_10292167 Ga0157373_102921673 129
35 3300013102 Ga0157371_10054194 Ga0157371_100541941 129
36 3300013104 Ga0157370_10596023 Ga0157370_105960231 129
37 3300013307 Ga0157372_10009430 Ga0157372_1000943011 129
38 3300014497 Ga0182008_10995007 Ga0182008_109950071 129
39 3300015689 Ga0183360_10002 Ga0183360_10002188 129
40 3300025261 Ga0209233_1016709 Ga0209233_10167093 129
41 3300025263 Ga0209565_1000002 Ga0209565_1000002785 129
42 3300025263 Ga0209565_1013220 Ga0209565_10132203 129
43 3300025273 Ga0209673_1000002 Ga0209673_1000002785 129
44 3300025291 Ga0209675_1000002 Ga0209675_1000002785 129
45 3300025295 Ga0209564_1000004 Ga0209564_1000004786 129
46 3300025299 Ga0209256_1000004 Ga0209256_1000004786 129
47 3300025912 Ga0207707_10031108 Ga0207707_100311084 129
48 3300025912 Ga0207707_10065252 Ga0207707_100652522 129
49 3300025913 Ga0207695_10000007 Ga0207695_10000007656 129
50 3300025914 Ga0207671_10014511 Ga0207671_100145113 129
51 3300025924 Ga0207694_10022646 Ga0207694_100226462 129
52 3300025932 Ga0207690_10030691 Ga0207690_100306915 129
53 3300026035 Ga0207703_11895906 Ga0207703_118959062 129
54 3300026142 Ga0207698_10050414 Ga0207698_100504145 129
55 3300038443 Ga0395901_0517473 Ga0395901_0517473_219_617 129
56 3300042005 Ga0439448_0043018 Ga0439448_0043018_79_477 129
57 3300046471 Ga0495650_0000703 Ga0495650_0000703_42407_42808 129
58 3300046474 Ga0495605_0051913 Ga0495605_0051913_1224_1625 129
59 3300046491 Ga0495584_0000688 Ga0495584_0000688_6634_7035 129
60 3300046492 Ga0495585_0004150 Ga0495585_0004150_5196_5597 129
61 3300046507 Ga0495606_0001182 Ga0495606_0001182_27395_27796 129
62 3300046513 Ga0495616_0000006 Ga0495616_0000006_206264_206665 129
63 3300046519 Ga0495632_0022346 Ga0495632_0022346_813_1214 129
64 3300046691 Ga0495670_0368421 Ga0495670_0368421_157_558 129
65 3300047323 Ga0495683_0004255 Ga0495683_0004255_1977_2378 129
66 3300047469 Ga0495673_0089300 Ga0495673_0089300_153_554 129
67 3300047472 Ga0495686_0003220 Ga0495686_0003220_4960_5361 129
68 3300048920 Ga0496117_0411350 Ga0496117_0411350_185_577 129
69 3300048921 Ga0496118_0021066 Ga0496118_0021066_5163_5555 129
70 3300048924 Ga0496121_0001076 Ga0496121_0001076_42416_42874 129
71 3300048924 Ga0496121_0001516 Ga0496121_0001516_9000_9401 129
72 3300049582 Ga0501048_0015431 Ga0501048_0015431_4734_5132 129
73 3300002705 JGI25156J39149_1024196 JGI25156J39149_10241961 130
74 3300002737 JGI25162J39368_1000605 JGI25162J39368_10006058 130
75 3300002737 JGI25162J39368_1001369 JGI25162J39368_10013697 130
76 3300002737 JGI25162J39368_1001619 JGI25162J39368_10016192 130
77 3300002741 JGI25157J39369_1001032 JGI25157J39369_100103213 130
78 3300002741 JGI25157J39369_1006786 JGI25157J39369_10067861 130
79 3300002741 JGI25157J39369_1010147 JGI25157J39369_10101471 130
80 3300002772 JGI25164J39214_1000390 JGI25164J39214_100039019 130
81 3300002772 JGI25164J39214_1000439 JGI25164J39214_10004399 130
82 3300003214 JGI25165J46597_1000725 JGI25165J46597_100072519 130
83 3300003214 JGI25165J46597_1004499 JGI25165J46597_10044994 130
84 3300005327 Ga0070658_10199149 Ga0070658_101991492 130
85 3300005336 Ga0070680_100328929 Ga0070680_1003289292 130
86 3300005337 Ga0070682_100027250 Ga0070682_1000272505 130
87 3300005337 Ga0070682_100312909 Ga0070682_1003129091 130
88 3300005339 Ga0070660_100021077 Ga0070660_1000210773 130
89 3300005339 Ga0070660_100131048 Ga0070660_1001310483 130
90 3300005339 Ga0070660_100191114 Ga0070660_1001911142 130
91 3300005339 Ga0070660_100317864 Ga0070660_1003178642 130
92 3300005339 Ga0070660_100647956 Ga0070660_1006479561 130
93 3300005339 Ga0070660_100915801 Ga0070660_1009158011 130
94 3300005344 Ga0070661_100029573 Ga0070661_1000295732 130
95 3300005366 Ga0070659_100191664 Ga0070659_1001916643 130
96 3300005366 Ga0070659_100231405 Ga0070659_1002314052 130
97 3300005366 Ga0070659_100326043 Ga0070659_1003260432 130
98 3300005366 Ga0070659_100777757 Ga0070659_1007777572 130
99 3300005366 Ga0070659_101945863 Ga0070659_1019458631 130
100 3300005435 Ga0070714_100000030 Ga0070714_10000003045 130
101 3300005435 Ga0070714_100092470 Ga0070714_1000924702 130
102 3300005436 Ga0070713_100001474 Ga0070713_10000147411 130
103 3300005439 Ga0070711_100130051 Ga0070711_1001300512 130
104 3300005444 Ga0070694_100069688 Ga0070694_1000696884 130
105 3300005455 Ga0070663_100705725 Ga0070663_1007057251 130
106 3300005457 Ga0070662_100055644 Ga0070662_1000556441 130
107 3300005458 Ga0070681_10269327 Ga0070681_102693273 130
108 3300005458 Ga0070681_10627521 Ga0070681_106275211 130
109 3300005530 Ga0070679_100039770 Ga0070679_1000397704 130
110 3300005530 Ga0070679_100149893 Ga0070679_1001498933 130
111 3300005535 Ga0070684_101167710 Ga0070684_1011677101 130
112 3300005539 Ga0068853_100018029 Ga0068853_1000180295 130
113 3300005539 Ga0068853_100243644 Ga0068853_1002436443 130
114 3300005539 Ga0068853_101040921 Ga0068853_1010409212 130
115 3300005546 Ga0070696_100015121 Ga0070696_1000151213 130
116 3300005546 Ga0070696_100106855 Ga0070696_1001068551 130
117 3300005547 Ga0070693_100659557 Ga0070693_1006595572 130
118 3300005548 Ga0070665_100071137 Ga0070665_1000711374 130
119 3300005563 Ga0068855_100148459 Ga0068855_1001484592 130
120 3300005563 Ga0068855_101869141 Ga0068855_1018691411 130
121 3300005577 Ga0068857_100279182 Ga0068857_1002791823 130
122 3300005578 Ga0068854_100062286 Ga0068854_1000622863 130
123 3300005578 Ga0068854_100161396 Ga0068854_1001613963 130
124 3300005578 Ga0068854_100242675 Ga0068854_1002426752 130
125 3300005614 Ga0068856_100260833 Ga0068856_1002608333 130
126 3300005834 Ga0068851_10692160 Ga0068851_106921601 130
127 3300009093 Ga0105240_10023541 Ga0105240_100235413 130
128 3300009093 Ga0105240_10429652 Ga0105240_104296522 130
129 3300009174 Ga0105241_10177031 Ga0105241_101770312 130
130 3300009174 Ga0105241_12634373 Ga0105241_126343731 130
131 3300009545 Ga0105237_10000150 Ga0105237_1000015076 130
132 3300009545 Ga0105237_10252220 Ga0105237_102522203 130
133 3300009551 Ga0105238_10145302 Ga0105238_101453023 130
134 3300009551 Ga0105238_10505221 Ga0105238_105052212 130
135 3300013100 Ga0157373_10035698 Ga0157373_100356984 130
136 3300013100 Ga0157373_10113517 Ga0157373_101135172 130
137 3300013100 Ga0157373_10130462 Ga0157373_101304622 130
138 3300013100 Ga0157373_10260475 Ga0157373_102604753 130
139 3300013100 Ga0157373_10435508 Ga0157373_104355082 130
140 3300013102 Ga0157371_10007045 Ga0157371_1000704510 130
141 3300013102 Ga0157371_10025302 Ga0157371_100253024 130
142 3300013102 Ga0157371_10065001 Ga0157371_100650012 130
143 3300013104 Ga0157370_10000662 Ga0157370_1000066219 130
144 3300013104 Ga0157370_10001955 Ga0157370_1000195517 130
145 3300013104 Ga0157370_10019836 Ga0157370_100198367 130
146 3300013104 Ga0157370_10055639 Ga0157370_100556394 130
147 3300013104 Ga0157370_10223059 Ga0157370_102230593 130
148 3300013104 Ga0157370_10251118 Ga0157370_102511182 130
149 3300013104 Ga0157370_10287348 Ga0157370_102873482 130
150 3300013104 Ga0157370_11923945 Ga0157370_119239451 130
151 3300013105 Ga0157369_10000580 Ga0157369_1000058020 130
152 3300013105 Ga0157369_10027481 Ga0157369_100274813 130
153 3300013105 Ga0157369_10042069 Ga0157369_100420695 130
154 3300013105 Ga0157369_10540879 Ga0157369_105408792 130
155 3300013307 Ga0157372_10031116 Ga0157372_100311164 130
156 3300013307 Ga0157372_10058048 Ga0157372_100580486 130
157 3300013307 Ga0157372_10458414 Ga0157372_104584142 130
158 3300014497 Ga0182008_10085561 Ga0182008_100855612 130
159 3300014497 Ga0182008_10114951 Ga0182008_101149513 130
160 3300015261 Ga0182006_1075906 Ga0182006_10759062 130
161 3300015261 Ga0182006_1192280 Ga0182006_11922802 130
162 3300015262 Ga0182007_10026485 Ga0182007_100264854 130
163 3300015262 Ga0182007_10031851 Ga0182007_100318513 130
164 3300017792 Ga0163161_10026249 Ga0163161_100262494 130
165 3300020082 Ga0206353_11697107 Ga0206353_116971072 130
166 3300025226 Ga0209674_112671 Ga0209674_1126712 130
167 3300025231 Ga0207427_100118 Ga0207427_10011880 130
168 3300025231 Ga0207427_100120 Ga0207427_10012021 130
169 3300025233 Ga0209437_100020 Ga0209437_100020494 130
170 3300025233 Ga0209437_100231 Ga0209437_1002318 130
171 3300025242 Ga0209258_111253 Ga0209258_1112532 130
172 3300025246 Ga0209646_1001535 Ga0209646_10015353 130
173 3300025250 Ga0209026_1000037 Ga0209026_1000037216 130
174 3300025250 Ga0209026_1000122 Ga0209026_100012289 130
175 3300025250 Ga0209026_1010796 Ga0209026_10107963 130
176 3300025256 Ga0209759_1005891 Ga0209759_10058913 130
177 3300025256 Ga0209759_1018361 Ga0209759_10183612 130
178 3300025256 Ga0209759_1039457 Ga0209759_10394571 130
179 3300025261 Ga0209233_1000020 Ga0209233_1000020132 130
180 3300025261 Ga0209233_1000147 Ga0209233_1000147134 130
181 3300025272 Ga0209455_1000323 Ga0209455_100032348 130
182 3300025297 Ga0209758_1024338 Ga0209758_10243383 130
183 3300025303 Ga0209051_1036057 Ga0209051_10360572 130
184 3300025898 Ga0207692_10105317 Ga0207692_101053172 130
185 3300025904 Ga0207647_10000008 Ga0207647_10000008159 130
186 3300025904 Ga0207647_10017679 Ga0207647_100176792 130
187 3300025909 Ga0207705_10065518 Ga0207705_100655183 130
188 3300025909 Ga0207705_10445480 Ga0207705_104454802 130
189 3300025912 Ga0207707_10049060 Ga0207707_100490602 130
190 3300025912 Ga0207707_10445638 Ga0207707_104456382 130
191 3300025913 Ga0207695_10002140 Ga0207695_1000214010 130
192 3300025913 Ga0207695_10445277 Ga0207695_104452772 130
193 3300025914 Ga0207671_10000570 Ga0207671_1000057048 130
194 3300025914 Ga0207671_10209588 Ga0207671_102095882 130
195 3300025914 Ga0207671_10638963 Ga0207671_106389632 130
196 3300025916 Ga0207663_10158070 Ga0207663_101580702 130
197 3300025917 Ga0207660_10382622 Ga0207660_103826223 130
198 3300025919 Ga0207657_10122040 Ga0207657_101220402 130
199 3300025919 Ga0207657_10505889 Ga0207657_105058892 130
200 3300025919 Ga0207657_10831361 Ga0207657_108313612 130
201 3300025919 Ga0207657_10854408 Ga0207657_108544082 130
202 3300025919 Ga0207657_11016520 Ga0207657_110165202 130
203 3300025920 Ga0207649_10314006 Ga0207649_103140062 130
204 3300025921 Ga0207652_10437223 Ga0207652_104372231 130
205 3300025921 Ga0207652_10510715 Ga0207652_105107152 130
206 3300025928 Ga0207700_10102431 Ga0207700_101024313 130
207 3300025929 Ga0207664_10000026 Ga0207664_10000026109 130
208 3300025929 Ga0207664_10001232 Ga0207664_100012322 130
209 3300025929 Ga0207664_10014498 Ga0207664_100144982 130
210 3300025932 Ga0207690_10003519 Ga0207690_100035195 130
211 3300025932 Ga0207690_10026092 Ga0207690_100260925 130
212 3300025932 Ga0207690_10026659 Ga0207690_100266593 130
213 3300025932 Ga0207690_10190131 Ga0207690_101901312 130
214 3300025933 Ga0207706_10016229 Ga0207706_100162296 130
215 3300025949 Ga0207667_10030752 Ga0207667_100307526 130
216 3300025949 Ga0207667_10036239 Ga0207667_100362393 130
217 3300025949 Ga0207667_10815264 Ga0207667_108152642 130
218 3300025972 Ga0207668_10058790 Ga0207668_100587902 130
219 3300025981 Ga0207640_10076565 Ga0207640_100765652 130
220 3300025981 Ga0207640_10299994 Ga0207640_102999942 130
221 3300026041 Ga0207639_10012868 Ga0207639_100128682 130
222 3300026041 Ga0207639_10411095 Ga0207639_104110952 130
223 3300026041 Ga0207639_10495673 Ga0207639_104956733 130
224 3300026067 Ga0207678_10021249 Ga0207678_100212496 130
225 3300026067 Ga0207678_10199974 Ga0207678_101999742 130
226 3300026067 Ga0207678_10335394 Ga0207678_103353942 130
227 3300026067 Ga0207678_10420241 Ga0207678_104202412 130
228 3300026078 Ga0207702_10000143 Ga0207702_1000014327 130
229 3300026078 Ga0207702_10104281 Ga0207702_101042812 130
230 3300026116 Ga0207674_10028427 Ga0207674_100284273 130
231 3300026121 Ga0207683_10537747 Ga0207683_105377472 130
232 3300028379 Ga0268266_10067831 Ga0268266_100678313 130
233 3300031665 Ga0316575_10120433 Ga0316575_101204332 130
234 3300031911 Ga0307412_10001089 Ga0307412_1000108912 130
235 3300032004 Ga0307414_10006721 Ga0307414_100067217 130
236 3300032004 Ga0307414_11436015 Ga0307414_114360151 130
237 3300037312 Ga0395899_0078980 Ga0395899_0078980_402_809 130
238 3300037312 Ga0395899_0289097 Ga0395899_0289097_493_900 130
239 3300037418 Ga0395900_0043991 Ga0395900_0043991_2450_2857 130
240 3300037418 Ga0395900_0094855 Ga0395900_0094855_2429_2836 130
241 3300037466 Ga0395898_0047872 Ga0395898_0047872_679_1086 130
242 3300037466 Ga0395898_0195278 Ga0395898_0195278_365_772 130
243 3300037466 Ga0395898_0215239 Ga0395898_0215239_1034_1441 130
244 3300037466 Ga0395898_0250134 Ga0395898_0250134_882_1289 130
245 3300037471 Ga0395905_0065805 Ga0395905_0065805_2492_2899 130
246 3300038443 Ga0395901_0002971 Ga0395901_0002971_6811_7206 130
247 3300038443 Ga0395901_0003001 Ga0395901_0003001_365_772 130
248 3300038443 Ga0395901_0043917 Ga0395901_0043917_2768_3175 130
249 3300038443 Ga0395901_0064734 Ga0395901_0064734_672_1079 130
250 3300038443 Ga0395901_0085942 Ga0395901_0085942_1848_2255 130
251 3300038443 Ga0395901_0297520 Ga0395901_0297520_136_543 130
252 3300042115 Ga0450911_003004 Ga0450911_003004_90_488 130
253 3300044842 Ga0466957_0892428 Ga0466957_0892428_79_480 130
254 3300045976 Ga0466967_1939174 Ga0466967_1939174_26_427 130
255 3300046525 Ga0495663_0008452 Ga0495663_0008452_20_418 130
256 3300046558 Ga0495633_0024804 Ga0495633_0024804_18_416 130
257 3300048908 Ga0496105_0780361 Ga0496105_0780361_199_594 130
258 3300048909 Ga0496106_0127954 Ga0496106_0127954_68_466 130
259 3300048909 Ga0496106_0784324 Ga0496106_0784324_131_526 130
260 3300048916 Ga0496113_0056358 Ga0496113_0056358_212_610 130
261 3300048916 Ga0496113_0748372 Ga0496113_0748372_47_442 130
262 3300048919 Ga0496116_0000871 Ga0496116_0000871_24857_25255 130
263 3300048919 Ga0496116_0088819 Ga0496116_0088819_125_520 130
264 3300048919 Ga0496116_0092516 Ga0496116_0092516_200_595 130
265 3300048920 Ga0496117_0016893 Ga0496117_0016893_2821_3216 130
266 3300048920 Ga0496117_0249295 Ga0496117_0249295_278_676 130
267 3300048921 Ga0496118_0013752 Ga0496118_0013752_3795_4190 130
268 3300048921 Ga0496118_0072559 Ga0496118_0072559_523_921 130
269 3300048922 Ga0496119_0182883 Ga0496119_0182883_407_805 130
270 3300048923 Ga0496120_0210877 Ga0496120_0210877_33_431 130
271 3300048924 Ga0496121_0001490 Ga0496121_0001490_10460_10855 130
272 3300048924 Ga0496121_0005789 Ga0496121_0005789_2951_3349 130
273 3300048924 Ga0496121_0095222 Ga0496121_0095222_1393_1791 130
274 3300048925 Ga0496122_0070816 Ga0496122_0070816_898_1293 130
275 3300048925 Ga0496122_0544003 Ga0496122_0544003_16_411 130
276 3300048926 Ga0496123_0015659 Ga0496123_0015659_3401_3796 130
277 3300048926 Ga0496123_0029338 Ga0496123_0029338_2618_3013 130
278 3300048926 Ga0496123_0123842 Ga0496123_0123842_919_1317 130
279 3300048927 Ga0496124_0207846 Ga0496124_0207846_835_1233 130
280 3300048927 Ga0496124_0704787 Ga0496124_0704787_79_477 130
281 3300048928 Ga0496125_0043432 Ga0496125_0043432_3327_3722 130
282 3300048929 Ga0496126_0027844 Ga0496126_0027844_4508_4903 130
283 3300048929 Ga0496126_0106924 Ga0496126_0106924_738_1136 130
284 3300049572 Ga0501036_1417372 Ga0501036_1417372_67_468 130
285 3300049573 Ga0501037_0760215 Ga0501037_0760215_93_494 130
286 3300049581 Ga0501047_0810947 Ga0501047_0810947_211_612 130
287 3300049822 Ga0501035_0099195 Ga0501035_0099195_1787_2188 130
288 3300049823 Ga0501044_0044040 Ga0501044_0044040_2504_2905 130
289 3300049823 Ga0501044_0270253 Ga0501044_0270253_51_461 130
290 3300049823 Ga0501044_0408565 Ga0501044_0408565_328_723 130
291 3300049823 Ga0501044_0702292 Ga0501044_0702292_352_771 130
292 3300009551 Ga0105238_10159548 Ga0105238_101595482 131
293 3300010375 Ga0105239_11786623 Ga0105239_117866231 131
294 3300013104 Ga0157370_10005446 Ga0157370_100054465 131
295 3300014497 Ga0182008_10000262 Ga0182008_100002627 131
296 3300015261 Ga0182006_1005217 Ga0182006_10052177 131
297 3300015262 Ga0182007_10037606 Ga0182007_100376063 131
298 3300015265 Ga0182005_1000352 Ga0182005_10003524 131
299 3300015265 Ga0182005_1000424 Ga0182005_10004243 131
300 3300025226 Ga0209674_101344 Ga0209674_1013446 131
301 3300025233 Ga0209437_113991 Ga0209437_1139912 131
302 3300025254 Ga0209148_1001326 Ga0209148_10013264 131
303 3300025924 Ga0207694_10100021 Ga0207694_101000212 131
304 3300025981 Ga0207640_10726831 Ga0207640_107268312 131
305 3300031911 Ga0307412_10009657 Ga0307412_100096574 131
306 3300041404 Ga0439436_0000022 Ga0439436_0000022_57993_58391 131
307 3300042004 Ga0439445_0045814 Ga0439445_0045814_586_984 131
308 3300044693 Ga0466961_0097893 Ga0466961_0097893_29_475 131
309 3300044719 Ga0466971_0010066 Ga0466971_0010066_2266_2712 131
310 3300044842 Ga0466957_0168536 Ga0466957_0168536_648_1094 131
311 3300045049 Ga0466959_0015619 Ga0466959_0015619_434_880 131
312 3300045836 Ga0466958_0008283 Ga0466958_0008283_4623_5069 131
313 3300046452 Ga0495617_000348 Ga0495617_000348_13957_14355 131
314 3300046460 Ga0495638_0000498 Ga0495638_0000498_43218_43616 131
315 3300046492 Ga0495585_0000200 Ga0495585_0000200_50896_51294 131
316 3300046492 Ga0495585_0296953 Ga0495585_0296953_356_754 131
317 3300046501 Ga0495607_0000090 Ga0495607_0000090_57459_57857 131
318 3300046501 Ga0495607_0000244 Ga0495607_0000244_29572_29970 131
319 3300046501 Ga0495607_0009076 Ga0495607_0009076_3220_3618 131
320 3300046506 Ga0495583_0058138 Ga0495583_0058138_822_1220 131
321 3300046512 Ga0495610_0001156 Ga0495610_0001156_18849_19247 131
322 3300046513 Ga0495616_0006144 Ga0495616_0006144_2788_3186 131
323 3300046513 Ga0495616_0429304 Ga0495616_0429304_83_481 131
324 3300046518 Ga0495631_0000398 Ga0495631_0000398_20949_21347 131
325 3300046519 Ga0495632_0011519 Ga0495632_0011519_853_1251 131
326 3300046524 Ga0495648_0000759 Ga0495648_0000759_25179_25577 131
327 3300046648 Ga0495611_0000001 Ga0495611_0000001_2544303_2544701 131
328 3300046660 Ga0495625_0000200 Ga0495625_0000200_11327_11725 131
329 3300046665 Ga0495661_0000316 Ga0495661_0000316_8424_8822 131
330 3300046665 Ga0495661_0033224 Ga0495661_0033224_42_440 131
331 3300046691 Ga0495670_0000526 Ga0495670_0000526_6796_7194 131
332 3300046691 Ga0495670_0001971 Ga0495670_0001971_4589_4987 131
333 3300046692 Ga0495671_0000457 Ga0495671_0000457_24607_25005 131
334 3300046694 Ga0495649_0041214 Ga0495649_0041214_2069_2467 131
335 3300046794 Ga0495589_0000008 Ga0495589_0000008_83610_84008 131
336 3300046810 Ga0495660_0000133 Ga0495660_0000133_11125_11523 131
337 3300047446 Ga0495679_000004 Ga0495679_000004_663992_664390 131
338 3300047469 Ga0495673_0002539 Ga0495673_0002539_9043_9441 131
339 3300047470 Ga0495681_0203478 Ga0495681_0203478_93_491 131
340 3300048903 Ga0496100_0053164 Ga0496100_0053164_194_592 131
341 3300048904 Ga0496101_0000399 Ga0496101_0000399_20979_21377 131
342 3300048919 Ga0496116_0056772 Ga0496116_0056772_753_1151 131
343 3300048921 Ga0496118_0180092 Ga0496118_0180092_57_455 131
344 3300048922 Ga0496119_0014114 Ga0496119_0014114_3412_3810 131
345 3300048923 Ga0496120_0076881 Ga0496120_0076881_62_460 131
346 3300048925 Ga0496122_0059905 Ga0496122_0059905_38_436 131
347 3300048925 Ga0496122_0182488 Ga0496122_0182488_463_861 131
348 3300048926 Ga0496123_0002220 Ga0496123_0002220_6651_7049 131
349 3300048926 Ga0496123_0018729 Ga0496123_0018729_1747_2145 131
350 3300048927 Ga0496124_0001682 Ga0496124_0001682_22703_23101 131
351 3300048927 Ga0496124_0002165 Ga0496124_0002165_17540_17938 131
352 3300049459 Ga0495678_000158 Ga0495678_000158_56456_56854 131
353 3300049460 Ga0495682_0001065 Ga0495682_0001065_8437_8835 131
354 3300049460 Ga0495682_0010193 Ga0495682_0010193_2118_2516 131
355 3300050516 nmdc:mga0sz30_120486_c1 nmdc:mga0sz30_120486_c1_688_1086 131
356 3300053087 Ga0500643_000140 Ga0500643_000140_42766_43164 131
357 3300053103 Ga0500555_000327 Ga0500555_000327_5890_6288 131
358 3300053161 Ga0500634_0030361 Ga0500634_0030361_1334_1753 131
359 3300053730 Ga0500645_001152 Ga0500645_001152_6931_7329 131
360 3300061719 Ga0466962_0006730 Ga0466962_0006730_2739_3185 131
361 2209111006 2214811339 2213844226 132
362 3300001989 JGI24739J22299_10007614 JGI24739J22299_100076142 132
363 3300001989 JGI24739J22299_10049283 JGI24739J22299_100492832 132
364 3300001990 JGI24737J22298_10006842 JGI24737J22298_100068424 132
365 3300001990 JGI24737J22298_10013559 JGI24737J22298_100135594 132
366 3300002067 JGI24735J21928_10004826 JGI24735J21928_100048262 132
367 3300002737 JGI25162J39368_1000138 JGI25162J39368_100013876 132
368 3300002737 JGI25162J39368_1002664 JGI25162J39368_10026646 132
369 3300002741 JGI25157J39369_1000182 JGI25157J39369_100018216 132
370 3300002741 JGI25157J39369_1000253 JGI25157J39369_100025333 132
371 3300002771 JGI25163J39215_1000444 JGI25163J39215_10004447 132
372 3300002772 JGI25164J39214_1000170 JGI25164J39214_100017056 132
373 3300003214 JGI25165J46597_1000224 JGI25165J46597_10002248 132
374 3300003215 JGI25153J46596_10012356 JGI25153J46596_100123564 132
375 3300003320 rootH2_10063399 rootH2_100633992 132
376 3300003322 rootL2_10081353 rootL2_100813534 132
377 3300003578 Ga0006562J51391_1016133 Ga0006562J51391_10161332 132
378 3300003578 Ga0006562J51391_1016134 Ga0006562J51391_10161344 132
379 3300003751 Ga0055538_1002329 Ga0055538_10023292 132
380 3300003756 Ga0055533_1000506 Ga0055533_100050614 132
381 3300003756 Ga0055533_1004350 Ga0055533_10043501 132
382 3300003759 Ga0055525_1000164 Ga0055525_100016477 132
383 3300003760 Ga0055527_1000065 Ga0055527_100006578 132
384 3300003760 Ga0055527_1000272 Ga0055527_100027222 132
385 3300003760 Ga0055527_1000317 Ga0055527_100031716 132
386 3300003761 Ga0055535_1000216 Ga0055535_10002168 132
387 3300003761 Ga0055535_1000690 Ga0055535_100069016 132
388 3300003761 Ga0055535_1000716 Ga0055535_100071616 132
389 3300003761 Ga0055535_1000949 Ga0055535_100094916 132
390 3300003762 Ga0055542_1000097 Ga0055542_1000097103 132
391 3300003762 Ga0055542_1000136 Ga0055542_100013619 132
392 3300003762 Ga0055542_1000140 Ga0055542_100014077 132
393 3300003762 Ga0055542_1000179 Ga0055542_10001798 132
394 3300003762 Ga0055542_1000932 Ga0055542_100093215 132
395 3300003763 Ga0055529_1000189 Ga0055529_10001898 132
396 3300003763 Ga0055529_1000335 Ga0055529_100033541 132
397 3300003763 Ga0055529_1008619 Ga0055529_10086192 132
398 3300003775 Ga0055524_1028565 Ga0055524_10285652 132
399 3300003794 Ga0055531_10003887 Ga0055531_100038872 132
400 3300005262 Ga0065165_1003025 Ga0065165_100302510 132
401 3300005277 Ga0065716_1009210 Ga0065716_10092101 132
402 3300005327 Ga0070658_10114304 Ga0070658_101143042 132
403 3300005337 Ga0070682_100275457 Ga0070682_1002754572 132
404 3300005339 Ga0070660_100509730 Ga0070660_1005097302 132
405 3300005459 Ga0068867_101433101 Ga0068867_1014331011 132
406 3300005563 Ga0068855_100066875 Ga0068855_1000668752 132
407 3300005577 Ga0068857_100012027 Ga0068857_1000120272 132
408 3300005577 Ga0068857_100033648 Ga0068857_1000336485 132
409 3300005578 Ga0068854_100001248 Ga0068854_1000012488 132
410 3300005614 Ga0068856_100001493 Ga0068856_10000149311 132
411 3300005614 Ga0068856_100545950 Ga0068856_1005459501 132
412 3300005616 Ga0068852_100165028 Ga0068852_1001650282 132
413 3300005834 Ga0068851_10024532 Ga0068851_100245325 132
414 3300005842 Ga0068858_100108278 Ga0068858_1001082782 132
415 3300005844 Ga0068862_100400578 Ga0068862_1004005782 132
416 3300006944 Ga0099823_1000028 Ga0099823_100002861 132
417 3300009036 Ga0105244_10028766 Ga0105244_100287662 132
418 3300009092 Ga0105250_10056527 Ga0105250_100565273 132
419 3300009093 Ga0105240_10002324 Ga0105240_1000232414 132
420 3300009093 Ga0105240_10005495 Ga0105240_100054957 132
421 3300009093 Ga0105240_10027518 Ga0105240_100275188 132
422 3300009093 Ga0105240_10034726 Ga0105240_100347267 132
423 3300009174 Ga0105241_10526954 Ga0105241_105269542 132
424 3300009545 Ga0105237_10017018 Ga0105237_100170182 132
425 3300009551 Ga0105238_10053232 Ga0105238_100532325 132
426 3300009553 Ga0105249_10033072 Ga0105249_100330724 132
427 3300010375 Ga0105239_10000043 Ga0105239_100000437 132
428 3300012500 Ga0157314_1000939 Ga0157314_10009392 132
429 3300013100 Ga0157373_10541377 Ga0157373_105413772 132
430 3300013105 Ga0157369_10066969 Ga0157369_100669693 132
431 3300013306 Ga0163162_10127993 Ga0163162_101279933 132
432 3300014325 Ga0163163_12918942 Ga0163163_129189421 132
433 3300014497 Ga0182008_10684538 Ga0182008_106845381 132
434 3300015262 Ga0182007_10379145 Ga0182007_103791451 132
435 3300015687 Ga0183368_1003 Ga0183368_1003764 132
436 3300025206 Ga0209435_108199 Ga0209435_1081992 132
437 3300025207 Ga0209760_101163 Ga0209760_1011634 132
438 3300025224 Ga0209784_100068 Ga0209784_1000687 132
439 3300025225 Ga0209566_103158 Ga0209566_1031582 132
440 3300025226 Ga0209674_100012 Ga0209674_100012515 132
441 3300025226 Ga0209674_100247 Ga0209674_10024713 132
442 3300025226 Ga0209674_101766 Ga0209674_1017666 132
443 3300025228 Ga0209672_100029 Ga0209672_10002985 132
444 3300025228 Ga0209672_100049 Ga0209672_10004975 132
445 3300025228 Ga0209672_100828 Ga0209672_1008288 132
446 3300025228 Ga0209672_101400 Ga0209672_1014007 132
447 3300025230 Ga0209563_100051 Ga0209563_10005174 132
448 3300025231 Ga0207427_100140 Ga0207427_1001407 132
449 3300025233 Ga0209437_100147 Ga0209437_100147163 132
450 3300025233 Ga0209437_100193 Ga0209437_10019321 132
451 3300025233 Ga0209437_106636 Ga0209437_1066362 132
452 3300025242 Ga0209258_100053 Ga0209258_100053245 132
453 3300025242 Ga0209258_100087 Ga0209258_10008775 132
454 3300025242 Ga0209258_100149 Ga0209258_10014971 132
455 3300025242 Ga0209258_100360 Ga0209258_10036057 132
456 3300025242 Ga0209258_101666 Ga0209258_1016664 132
457 3300025246 Ga0209646_1001031 Ga0209646_10010317 132
458 3300025250 Ga0209026_1000060 Ga0209026_100006083 132
459 3300025250 Ga0209026_1000099 Ga0209026_10000997 132
460 3300025254 Ga0209148_1000002 Ga0209148_10000021368 132
461 3300025254 Ga0209148_1000009 Ga0209148_100000985 132
462 3300025254 Ga0209148_1000010 Ga0209148_10000101075 132
463 3300025254 Ga0209148_1000096 Ga0209148_100009675 132
464 3300025254 Ga0209148_1000143 Ga0209148_100014371 132
465 3300025256 Ga0209759_1000295 Ga0209759_100029534 132
466 3300025256 Ga0209759_1000755 Ga0209759_10007557 132
467 3300025256 Ga0209759_1011516 Ga0209759_10115164 132
468 3300025258 Ga0209129_1001547 Ga0209129_10015473 132
469 3300025261 Ga0209233_1000009 Ga0209233_100000994 132
470 3300025261 Ga0209233_1019288 Ga0209233_10192883 132
471 3300025272 Ga0209455_1000060 Ga0209455_100006085 132
472 3300025272 Ga0209455_1000086 Ga0209455_100008695 132
473 3300025272 Ga0209455_1000088 Ga0209455_100008875 132
474 3300025272 Ga0209455_1003818 Ga0209455_10038185 132
475 3300025273 Ga0209673_1005616 Ga0209673_10056167 132
476 3300025297 Ga0209758_1003144 Ga0209758_10031449 132
477 3300025297 Ga0209758_1104395 Ga0209758_11043951 132
478 3300025297 Ga0209758_1137551 Ga0209758_11375512 132
479 3300025298 Ga0209050_1007094 Ga0209050_10070944 132
480 3300025299 Ga0209256_1001298 Ga0209256_100129810 132
481 3300025303 Ga0209051_1056415 Ga0209051_10564152 132
482 3300025304 Ga0209257_1004442 Ga0209257_100444210 132
483 3300025321 Ga0207656_10006823 Ga0207656_100068237 132
484 3300025728 Ga0207655_1005575 Ga0207655_10055758 132
485 3300025904 Ga0207647_10010279 Ga0207647_100102794 132
486 3300025904 Ga0207647_10025555 Ga0207647_100255552 132
487 3300025913 Ga0207695_10004510 Ga0207695_1000451013 132
488 3300025913 Ga0207695_10004697 Ga0207695_1000469714 132
489 3300025913 Ga0207695_10005651 Ga0207695_100056512 132
490 3300025913 Ga0207695_10016227 Ga0207695_100162275 132
491 3300025913 Ga0207695_10017458 Ga0207695_100174587 132
492 3300025914 Ga0207671_10000021 Ga0207671_1000002198 132
493 3300025920 Ga0207649_10024302 Ga0207649_100243024 132
494 3300025920 Ga0207649_10127093 Ga0207649_101270932 132
495 3300025924 Ga0207694_10044760 Ga0207694_100447603 132
496 3300025933 Ga0207706_11299653 Ga0207706_112996531 132
497 3300025936 Ga0207670_10003742 Ga0207670_100037422 132
498 3300025949 Ga0207667_10000141 Ga0207667_10000141107 132
499 3300025949 Ga0207667_10004475 Ga0207667_100044757 132
500 3300025981 Ga0207640_10000268 Ga0207640_1000026830 132
501 3300025981 Ga0207640_10005600 Ga0207640_100056002 132
502 3300026035 Ga0207703_10042601 Ga0207703_100426014 132
503 3300026078 Ga0207702_10005861 Ga0207702_100058619 132
504 3300026078 Ga0207702_10248718 Ga0207702_102487183 132
505 3300026089 Ga0207648_11637421 Ga0207648_116374212 132
506 3300026116 Ga0207674_10018823 Ga0207674_100188237 132
507 3300026116 Ga0207674_10053534 Ga0207674_100535344 132
508 3300026142 Ga0207698_10146895 Ga0207698_101468952 132
509 3300027296 Ga0209389_1002696 Ga0209389_10026962 132
510 3300027312 Ga0209371_1028278 Ga0209371_10282782 132
511 3300028380 Ga0268265_10047181 Ga0268265_100471811 132
512 3300030500 Ga0268256_1031109 Ga0268256_10311092 132
513 3300037312 Ga0395899_0049847 Ga0395899_0049847_1926_2360 132
514 3300037418 Ga0395900_0000012 Ga0395900_0000012_124676_125125 132
515 3300037466 Ga0395898_0000144 Ga0395898_0000144_173541_173975 132
516 3300037466 Ga0395898_0000278 Ga0395898_0000278_12558_13007 132
517 3300038443 Ga0395901_0163441 Ga0395901_0163441_1149_1583 132
518 3300038443 Ga0395901_0308117 Ga0395901_0308117_862_1311 132
519 3300039447 Ga0436361_0457520 Ga0436361_0457520_245_682 132
520 3300041452 Ga0451793_0109338 Ga0451793_0109338_368_799 132
521 3300042005 Ga0439448_0139858 Ga0439448_0139858_224_676 132
522 3300042876 Ga0451577_0013048 Ga0451577_0013048_5440_5850 132
523 3300044656 Ga0466969_0011768 Ga0466969_0011768_2261_2710 132
524 3300044656 Ga0466969_0096507 Ga0466969_0096507_625_1074 132
525 3300044656 Ga0466969_0160241 Ga0466969_0160241_64_510 132
526 3300044656 Ga0466969_0173790 Ga0466969_0173790_407_853 132
527 3300044658 Ga0466972_0016889 Ga0466972_0016889_80_526 132
528 3300044661 Ga0466975_0097397 Ga0466975_0097397_1522_1971 132
529 3300044672 Ga0466982_0000005 Ga0466982_0000005_2428_2874 132
530 3300044684 Ga0466966_0001494 Ga0466966_0001494_6905_7351 132
531 3300044693 Ga0466961_0000566 Ga0466961_0000566_8741_9175 132
532 3300044693 Ga0466961_0016490 Ga0466961_0016490_3672_4121 132
533 3300044693 Ga0466961_0048925 Ga0466961_0048925_522_962 132
534 3300044693 Ga0466961_0116544 Ga0466961_0116544_1027_1476 132
535 3300044693 Ga0466961_0135840 Ga0466961_0135840_55_501 132
536 3300044706 Ga0466964_0031182 Ga0466964_0031182_350_796 132
537 3300044719 Ga0466971_0005312 Ga0466971_0005312_565_1011 132
538 3300044719 Ga0466971_0210131 Ga0466971_0210131_16_465 132
539 3300044735 Ga0466968_0001781 Ga0466968_0001781_1080_1526 132
540 3300044765 Ga0466970_0005776 Ga0466970_0005776_3125_3571 132
541 3300044765 Ga0466970_0077536 Ga0466970_0077536_410_859 132
542 3300044765 Ga0466970_0345714 Ga0466970_0345714_347_796 132
543 3300044842 Ga0466957_0057654 Ga0466957_0057654_1712_2161 132
544 3300044842 Ga0466957_0114747 Ga0466957_0114747_1209_1655 132
545 3300044901 Ga0466960_0011759 Ga0466960_0011759_2772_3218 132
546 3300045049 Ga0466959_0000204 Ga0466959_0000204_27057_27506 132
547 3300045049 Ga0466959_0008851 Ga0466959_0008851_3095_3535 132
548 3300045049 Ga0466959_0023999 Ga0466959_0023999_2229_2678 132
549 3300045049 Ga0466959_0093158 Ga0466959_0093158_952_1386 132
550 3300045836 Ga0466958_0015594 Ga0466958_0015594_1898_2347 132
551 3300045836 Ga0466958_0026658 Ga0466958_0026658_2704_3138 132
552 3300046452 Ga0495617_000120 Ga0495617_000120_43485_43892 132
553 3300046460 Ga0495638_0000007 Ga0495638_0000007_504493_504924 132
554 3300046460 Ga0495638_0000194 Ga0495638_0000194_42015_42458 132
555 3300046460 Ga0495638_0000213 Ga0495638_0000213_23527_23970 132
556 3300046460 Ga0495638_0018390 Ga0495638_0018390_4154_4555 132
557 3300046471 Ga0495650_0000202 Ga0495650_0000202_92829_93272 132
558 3300046501 Ga0495607_0259168 Ga0495607_0259168_420_821 132
559 3300046507 Ga0495606_0000218 Ga0495606_0000218_71288_71725 132
560 3300046507 Ga0495606_0001609 Ga0495606_0001609_18956_19399 132
561 3300046507 Ga0495606_0045304 Ga0495606_0045304_1202_1603 132
562 3300046512 Ga0495610_0061610 Ga0495610_0061610_898_1299 132
563 3300046515 Ga0495620_0000806 Ga0495620_0000806_10478_10885 132
564 3300046518 Ga0495631_0000820 Ga0495631_0000820_11312_11743 132
565 3300046518 Ga0495631_0342553 Ga0495631_0342553_174_572 132
566 3300046524 Ga0495648_0002324 Ga0495648_0002324_10653_11054 132
567 3300046648 Ga0495611_0000126 Ga0495611_0000126_11293_11694 132
568 3300046660 Ga0495625_0004350 Ga0495625_0004350_6172_6609 132
569 3300046660 Ga0495625_0027318 Ga0495625_0027318_565_966 132
570 3300046660 Ga0495625_0046163 Ga0495625_0046163_1500_1943 132
571 3300046660 Ga0495625_0055139 Ga0495625_0055139_1439_1882 132
572 3300046694 Ga0495649_0013789 Ga0495649_0013789_208_651 132
573 3300047469 Ga0495673_0000041 Ga0495673_0000041_94237_94638 132
574 3300047472 Ga0495686_0015252 Ga0495686_0015252_3949_4350 132
575 3300047472 Ga0495686_0021874 Ga0495686_0021874_186_623 132
576 3300048903 Ga0496100_0107225 Ga0496100_0107225_719_1150 132
577 3300048904 Ga0496101_0066354 Ga0496101_0066354_295_726 132
578 3300048907 Ga0496104_0029148 Ga0496104_0029148_1473_1904 132
579 3300048907 Ga0496104_0177553 Ga0496104_0177553_306_749 132
580 3300048908 Ga0496105_0004228 Ga0496105_0004228_6268_6699 132
581 3300048909 Ga0496106_0023931 Ga0496106_0023931_938_1345 132
582 3300048909 Ga0496106_0218359 Ga0496106_0218359_236_667 132
583 3300048909 Ga0496106_0249028 Ga0496106_0249028_486_929 132
584 3300048916 Ga0496113_0011972 Ga0496113_0011972_624_1061 132
585 3300048917 Ga0496114_0174869 Ga0496114_0174869_890_1333 132
586 3300048918 Ga0496115_0000206 Ga0496115_0000206_30801_31238 132
587 3300048918 Ga0496115_0000490 Ga0496115_0000490_10415_10858 132
588 3300048918 Ga0496115_0014801 Ga0496115_0014801_4994_5437 132
589 3300048918 Ga0496115_0085921 Ga0496115_0085921_1381_1812 132
590 3300048920 Ga0496117_0007421 Ga0496117_0007421_4341_4772 132
591 3300048920 Ga0496117_0023348 Ga0496117_0023348_4243_4674 132
592 3300048921 Ga0496118_0009407 Ga0496118_0009407_4343_4774 132
593 3300048921 Ga0496118_0016111 Ga0496118_0016111_2104_2535 132
594 3300048922 Ga0496119_0000690 Ga0496119_0000690_26638_27069 132
595 3300048922 Ga0496119_0003147 Ga0496119_0003147_12854_13285 132
596 3300048923 Ga0496120_0000386 Ga0496120_0000386_34774_35205 132
597 3300048923 Ga0496120_0001439 Ga0496120_0001439_15408_15839 132
598 3300048924 Ga0496121_0001343 Ga0496121_0001343_24477_24908 132
599 3300048924 Ga0496121_0033540 Ga0496121_0033540_1328_1771 132
600 3300048924 Ga0496121_0085144 Ga0496121_0085144_473_904 132
601 3300048924 Ga0496121_0099959 Ga0496121_0099959_1418_1870 132
602 3300048924 Ga0496121_0113718 Ga0496121_0113718_902_1309 132
603 3300048924 Ga0496121_0121717 Ga0496121_0121717_1099_1530 132
604 3300048924 Ga0496121_0140148 Ga0496121_0140148_1294_1731 132
605 3300048928 Ga0496125_0002769 Ga0496125_0002769_4988_5446 132
606 3300048928 Ga0496125_0042580 Ga0496125_0042580_1378_1830 132
607 3300048929 Ga0496126_0007673 Ga0496126_0007673_4959_5390 132
608 3300048929 Ga0496126_0010754 Ga0496126_0010754_4952_5395 132
609 3300048929 Ga0496126_0031552 Ga0496126_0031552_333_776 132
610 3300048929 Ga0496126_0073690 Ga0496126_0073690_1043_1474 132
611 3300049459 Ga0495678_058029 Ga0495678_058029_619_1062 132
612 3300049459 Ga0495678_201012 Ga0495678_201012_160_603 132
613 3300053108 Ga0500562_000937 Ga0500562_000937_5210_5689 132
614 3300053145 Ga0500586_096669 Ga0500586_096669_242_730 132
615 3300053160 Ga0500633_0001235 Ga0500633_0001235_2039_2440 132
616 iso_pu_bacteria 2739367700 2739732041 132
617 iso_pu_bacteria 2884411467 2884413818 132
618 iso_pu_bacteria 2928963466 2928964735 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

4

118

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8035 7 116
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.7717 7 116
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.7672 7 119
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7552 7 116
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.7347 7 119
ID Description Score Start End Superfamily
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8722 7 116 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8516 7 120 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8304 8 117 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.822 7 120 1.10.3730.20
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8202 7 118 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A318SH63-F1-model_v4 Multidrug transporter EmrE-like cation transporter 0.9902 1 121 GO:0005886
GO:0022857
AF-A0A2R4ED90-F1-model_v4 deleted 0.9896 1 123
AF-A0A1Q4FY64-F1-model_v4 EamA domain-containing protein 0.9828 1 129 GO:0005886
GO:0009103
GO:0009245
GO:0022857
AF-A0A5A7VNI1-F1-model_v4 EamA family transporter 0.9816 1 131 GO:0005886
GO:0022857
AF-A0A5N7TUJ0-F1-model_v4 deleted 0.9815 1 132

Feature Viewer

pLDDT pTM Quality
87.95 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map