F469637

General Info

Members Datasets Scaffolds Average Seq Length
617 220 1234 125

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10021159|Ga0157370_100211594
Length 145
Sequence MQHELQQQVINNKSKKMKRLIINIGLMLAVVIGLTGCYKDVIKPQLAVDPDGPPQQVSFAQDLAPIFESSCALAGCHVSGSHKPYMKATISYNEITGGGFVNTTFPKLSMLYKEVYGEMAQYLPAGSSAFKQKVYDWIRNGAPNN

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 1.78
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 12.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10021159 3300013104 Bacteria 6486
2 SwRhRL3b_contig_3788158 2162886006 Bacteria 893
3 SwRhRL2b_contig_3171726 2162886007 Bacteria 1460
4 JGI24738J21930_10159885 3300002075 Unclassified 504
5 JGI24751J29686_10004430 3300002459 Bacteria 2851
6 rootH1_10113339 3300003316 Bacteria 6766
7 rootL2_10257551 3300003322 Bacteria 1796
8 Ga0055529_1035859 3300003763 Bacteria 605
9 Ga0065714_10275581 3300005288 Bacteria 731
10 Ga0065714_10413957 3300005288 Bacteria 580
11 Ga0065712_10102581 3300005290 Bacteria 2005
12 Ga0065712_10125134 3300005290 Unclassified 1617
13 Ga0065712_10185035 3300005290 Bacteria 1174
14 Ga0065712_10203615 3300005290 Bacteria 1099
15 Ga0065715_10103344 3300005293 Bacteria 3040
16 Ga0065715_10286080 3300005293 Bacteria 1074
17 Ga0065707_10115295 3300005295 Bacteria 2271
18 Ga0065707_10825910 3300005295 Bacteria 527
19 Ga0070658_10000025 3300005327 Bacteria 174551
20 Ga0070658_10000869 3300005327 Bacteria 25832
21 Ga0070658_10021912 3300005327 Bacteria 5124
22 Ga0070658_10055644 3300005327 Bacteria 3214
23 Ga0070658_10108295 3300005327 Bacteria 2300
24 Ga0070658_10233005 3300005327 Unclassified 1559
25 Ga0070658_10691227 3300005327 Bacteria 885
26 Ga0070676_10000097 3300005328 Bacteria 30711
27 Ga0070683_100442570 3300005329 Bacteria 1240
28 Ga0070683_100600737 3300005329 Unclassified 1053
29 Ga0070683_101431747 3300005329 Bacteria 664
30 Ga0070683_102161623 3300005329 Unclassified 534
31 Ga0070690_100754476 3300005330 Bacteria 751
32 Ga0070670_100270608 3300005331 Unclassified 1482
33 Ga0070670_100281740 3300005331 Bacteria 1451
34 Ga0070670_100418966 3300005331 Bacteria 1184
35 Ga0070670_100544383 3300005331 Bacteria 1035
36 Ga0070677_10042041 3300005333 Bacteria 1808
37 Ga0070677_10283953 3300005333 Bacteria 835
38 Ga0068869_100044315 3300005334 Bacteria 3199
39 Ga0068869_100054906 3300005334 Bacteria 2902
40 Ga0068869_100221034 3300005334 Bacteria 1501
41 Ga0070666_10012342 3300005335 Bacteria 5385
42 Ga0070680_100082691 3300005336 Bacteria 2651
43 Ga0070680_100200630 3300005336 Bacteria 1682
44 Ga0070680_101182838 3300005336 Bacteria 661
45 Ga0070682_100236830 3300005337 Bacteria 1308
46 Ga0070682_100491932 3300005337 Unclassified 948
47 Ga0068868_100001216 3300005338 Bacteria 17693
48 Ga0068868_100027721 3300005338 Bacteria 4323
49 Ga0068868_100150513 3300005338 Bacteria 1916
50 Ga0068868_100334421 3300005338 Bacteria 1293
51 Ga0070660_100112424 3300005339 Bacteria 2168
52 Ga0070660_100119160 3300005339 Bacteria 2105
53 Ga0070660_101165142 3300005339 Bacteria 653
54 Ga0070660_101517104 3300005339 Unclassified 570
55 Ga0070689_100039653 3300005340 Bacteria 3608
56 Ga0070689_100538306 3300005340 Bacteria 1005
57 Ga0070689_100614702 3300005340 Bacteria 942
58 Ga0070689_101545778 3300005340 Unclassified 602
59 Ga0070687_100212722 3300005343 Unclassified 1179
60 Ga0070687_100640285 3300005343 Bacteria 735
61 Ga0070661_100133317 3300005344 Bacteria 1867
62 Ga0070668_100000017 3300005347 Bacteria 100828
63 Ga0070668_100000912 3300005347 Bacteria 20597
64 Ga0070668_100112801 3300005347 Bacteria 2165
65 Ga0070668_100260680 3300005347 Bacteria 1441
66 Ga0070669_100027588 3300005353 Bacteria 4087
67 Ga0070669_100035410 3300005353 Bacteria 3616
68 Ga0070669_100299484 3300005353 Bacteria 1293
69 Ga0070669_100589087 3300005353 Unclassified 931
70 Ga0070669_100886206 3300005353 Bacteria 762
71 Ga0070675_100016938 3300005354 Bacteria 5788
72 Ga0070675_100063083 3300005354 Bacteria 3063
73 Ga0070675_100071538 3300005354 Bacteria 2877
74 Ga0070675_100205048 3300005354 Bacteria 1712
75 Ga0070675_100702379 3300005354 Unclassified 921
76 Ga0070675_101222383 3300005354 Bacteria 692
77 Ga0070671_100333273 3300005355 Bacteria 1293
78 Ga0070671_100575955 3300005355 Bacteria 972
79 Ga0070671_101506231 3300005355 Bacteria 595
80 Ga0070674_100201278 3300005356 Bacteria 1538
81 Ga0070674_100221387 3300005356 Bacteria 1472
82 Ga0070674_100898930 3300005356 Bacteria 771
83 Ga0070674_101683276 3300005356 Bacteria 573
84 Ga0070673_100000587 3300005364 Bacteria 19767
85 Ga0070673_100228450 3300005364 Bacteria 1614
86 Ga0070673_100308950 3300005364 Bacteria 1394
87 Ga0070673_100356205 3300005364 Bacteria 1300
88 Ga0070688_100019619 3300005365 Bacteria 3919
89 Ga0070688_100181453 3300005365 Unclassified 1460
90 Ga0070659_100043359 3300005366 Bacteria 3518
91 Ga0070667_100001108 3300005367 Bacteria 24656
92 Ga0070667_100090642 3300005367 Bacteria 2628
93 Ga0070667_100888525 3300005367 Bacteria 829
94 Ga0070667_101136822 3300005367 Bacteria 730
95 Ga0070667_101652555 3300005367 Bacteria 602
96 Ga0070701_10522564 3300005438 Bacteria 774
97 Ga0070701_11254622 3300005438 Bacteria 528
98 Ga0070700_101480343 3300005441 Bacteria 576
99 Ga0070663_100452181 3300005455 Bacteria 1059
100 Ga0070678_100101259 3300005456 Bacteria 2233
101 Ga0070678_100872142 3300005456 Bacteria 821
102 Ga0070678_101889736 3300005456 Bacteria 564
103 Ga0070662_100011806 3300005457 Bacteria 5773
104 Ga0070662_100020017 3300005457 Bacteria 4554
105 Ga0070681_10328177 3300005458 Bacteria 1440
106 Ga0070681_11807749 3300005458 Unclassified 538
107 Ga0068867_100001305 3300005459 Bacteria 17233
108 Ga0068867_100153659 3300005459 Bacteria 1810
109 Ga0068867_100181153 3300005459 Bacteria 1675
110 Ga0068867_100206930 3300005459 Bacteria 1574
111 Ga0068867_100243859 3300005459 Bacteria 1458
112 Ga0068867_100526671 3300005459 Bacteria 1020
113 Ga0070685_10468892 3300005466 Bacteria 885
114 Ga0070685_10471921 3300005466 Unclassified 883
115 Ga0070685_10488498 3300005466 Bacteria 869
116 Ga0070698_100023413 3300005471 Bacteria 6456
117 Ga0070679_100011316 3300005530 Bacteria 8506
118 Ga0070679_100163011 3300005530 Bacteria 2203
119 Ga0070679_100699073 3300005530 Bacteria 957
120 Ga0070684_100347323 3300005535 Unclassified 1364
121 Ga0068853_100135767 3300005539 Bacteria 2205
122 Ga0068853_100142764 3300005539 Bacteria 2150
123 Ga0068853_100230233 3300005539 Bacteria 1695
124 Ga0068853_100245639 3300005539 Unclassified 1641
125 Ga0068853_101106528 3300005539 Unclassified 764
126 Ga0070672_100000633 3300005543 Bacteria 20584
127 Ga0070672_100032981 3300005543 Bacteria 3917
128 Ga0070672_100275287 3300005543 Bacteria 1422
129 Ga0070672_101688359 3300005543 Bacteria 569
130 Ga0070686_100718987 3300005544 Bacteria 798
131 Ga0070695_100704003 3300005545 Bacteria 802
132 Ga0070665_100000876 3300005548 Bacteria 38793
133 Ga0070665_100001963 3300005548 Bacteria 23141
134 Ga0068855_100000139 3300005563 Bacteria 92537
135 Ga0068855_100018294 3300005563 Bacteria 8417
136 Ga0068855_100213839 3300005563 Bacteria 2165
137 Ga0068855_100217485 3300005563 Bacteria 2144
138 Ga0068855_100470849 3300005563 Bacteria 1369
139 Ga0068855_100473279 3300005563 Unclassified 1364
140 Ga0068855_102263873 3300005563 Bacteria 544
141 Ga0070664_100051331 3300005564 Bacteria 3492
142 Ga0070664_100449509 3300005564 Bacteria 1183
143 Ga0070664_100811625 3300005564 Bacteria 875
144 Ga0070664_102392393 3300005564 Bacteria 501
145 Ga0068857_100663851 3300005577 Bacteria 989
146 Ga0068857_101143456 3300005577 Bacteria 753
147 Ga0068857_101620929 3300005577 Bacteria 632
148 Ga0068857_102107138 3300005577 Bacteria 553
149 Ga0068854_100173304 3300005578 Bacteria 1680
150 Ga0068854_100194772 3300005578 Bacteria 1590
151 Ga0068854_100218382 3300005578 Bacteria 1507
152 Ga0068854_100234211 3300005578 Unclassified 1459
153 Ga0068854_100446330 3300005578 Bacteria 1079
154 Ga0068854_100540133 3300005578 Bacteria 987
155 Ga0068854_101083256 3300005578 Bacteria 713
156 Ga0068856_100000385 3300005614 Bacteria 48447
157 Ga0068856_100019733 3300005614 Bacteria 6542
158 Ga0068856_100037748 3300005614 Bacteria 4740
159 Ga0068856_100063445 3300005614 Unclassified 3650
160 Ga0070702_100986219 3300005615 Bacteria 666
161 Ga0068852_100138081 3300005616 Unclassified 2253
162 Ga0068852_100196111 3300005616 Bacteria 1908
163 Ga0068852_100485741 3300005616 Bacteria 1228
164 Ga0068852_100593422 3300005616 Bacteria 1111
165 Ga0068852_100673853 3300005616 Bacteria 1043
166 Ga0068852_101196434 3300005616 Bacteria 781
167 Ga0068852_101561311 3300005616 Bacteria 682
168 Ga0068859_100015830 3300005617 Bacteria 7578
169 Ga0068859_100020914 3300005617 Bacteria 6568
170 Ga0068859_100509591 3300005617 Bacteria 1298
171 Ga0068859_100780344 3300005617 Bacteria 1044
172 Ga0068859_101163288 3300005617 Bacteria 849
173 Ga0068859_101366398 3300005617 Bacteria 781
174 Ga0068859_102817897 3300005617 Unclassified 533
175 Ga0068864_100001914 3300005618 Bacteria 17084
176 Ga0068864_100028707 3300005618 Bacteria 4706
177 Ga0068864_100083534 3300005618 Bacteria 2805
178 Ga0068864_100628523 3300005618 Bacteria 1044
179 Ga0068864_100776811 3300005618 Bacteria 940
180 Ga0068866_10274127 3300005718 Unclassified 1042
181 Ga0068861_100015400 3300005719 Bacteria 5388
182 Ga0068861_100464268 3300005719 Bacteria 1137
183 Ga0068851_10000634 3300005834 Bacteria 14963
184 Ga0068870_10005796 3300005840 Bacteria 5419
185 Ga0068870_11226037 3300005840 Bacteria 544
186 Ga0068863_100001806 3300005841 Bacteria 21231
187 Ga0068863_100023737 3300005841 Bacteria 5851
188 Ga0068858_100001289 3300005842 Bacteria 25885
189 Ga0068860_100049830 3300005843 Bacteria 3987
190 Ga0068860_100080043 3300005843 Bacteria 3107
191 Ga0068860_100290358 3300005843 Bacteria 1600
192 Ga0068862_100008325 3300005844 Bacteria 8584
193 Ga0068862_100092548 3300005844 Bacteria 2635
194 Ga0068862_100674388 3300005844 Bacteria 999
195 Ga0070715_10643289 3300006163 Bacteria 627
196 Ga0070716_100864213 3300006173 Bacteria 705
197 Ga0097621_100000393 3300006237 Bacteria 30466
198 Ga0097621_100012851 3300006237 Bacteria 6219
199 Ga0097621_100088789 3300006237 Bacteria 2583
200 Ga0097621_100162232 3300006237 Bacteria 1922
201 Ga0097621_100246187 3300006237 Bacteria 1564
202 Ga0097621_100512720 3300006237 Bacteria 1088
203 Ga0097621_100848961 3300006237 Bacteria 848
204 Ga0097621_102022702 3300006237 Bacteria 550
205 Ga0068871_100009062 3300006358 Bacteria 7187
206 Ga0068871_100014045 3300006358 Bacteria 5956
207 Ga0068871_100051598 3300006358 Bacteria 3330
208 Ga0068871_100292858 3300006358 Bacteria 1427
209 Ga0068871_100445979 3300006358 Bacteria 1159
210 Ga0068871_100627425 3300006358 Bacteria 979
211 Ga0068871_101652565 3300006358 Bacteria 607
212 Ga0068871_101853048 3300006358 Bacteria 573
213 Ga0075428_100160177 3300006844 Bacteria 2443
214 Ga0075430_100488533 3300006846 Bacteria 1016
215 Ga0075431_100060769 3300006847 Bacteria 3899
216 Ga0075429_100115060 3300006880 Unclassified 2351
217 Ga0075429_100161390 3300006880 Bacteria 1963
218 Ga0075429_100864128 3300006880 Bacteria 792
219 Ga0068865_100001528 3300006881 Bacteria 13508
220 Ga0068865_100841938 3300006881 Bacteria 794
221 Ga0068865_100914336 3300006881 Bacteria 764
222 Ga0097620_100015832 3300006931 Bacteria 7578
223 Ga0097620_100020914 3300006931 Bacteria 6568
224 Ga0097620_100509626 3300006931 Bacteria 1298
225 Ga0097620_100780378 3300006931 Bacteria 1044
226 Ga0097620_101163145 3300006931 Bacteria 849
227 Ga0097620_101365951 3300006931 Bacteria 781
228 Ga0097620_102817258 3300006931 Unclassified 533
229 Ga0105240_10016822 3300009093 Bacteria 9888
230 Ga0105240_10031607 3300009093 Bacteria 6862
231 Ga0105240_10384119 3300009093 Bacteria 1585
232 Ga0105240_10492878 3300009093 Unclassified 1364
233 Ga0111539_10001827 3300009094 Bacteria 28327
234 Ga0111539_10405764 3300009094 Bacteria 1587
235 Ga0105245_10520532 3300009098 Bacteria 1208
236 Ga0105245_11378219 3300009098 Bacteria 755
237 Ga0105245_11501640 3300009098 Bacteria 725
238 Ga0105247_10003381 3300009101 Bacteria 10432
239 Ga0105247_10007550 3300009101 Bacteria 6662
240 Ga0105247_10423827 3300009101 Bacteria 953
241 Ga0105247_11701033 3300009101 Bacteria 522
242 Ga0114129_10256030 3300009147 Bacteria 2348
243 Ga0114129_11636285 3300009147 Bacteria 787
244 Ga0105243_10141428 3300009148 Bacteria 2054
245 Ga0105243_10910393 3300009148 Bacteria 875
246 Ga0105241_10024494 3300009174 Unclassified 4481
247 Ga0105241_10049460 3300009174 Bacteria 3201
248 Ga0105242_10006376 3300009176 Bacteria 9083
249 Ga0105242_10012619 3300009176 Bacteria 6506
250 Ga0105242_10167061 3300009176 Bacteria 1931
251 Ga0105242_11201777 3300009176 Bacteria 777
252 Ga0105242_11489922 3300009176 Unclassified 707
253 Ga0105242_12734491 3300009176 Unclassified 543
254 Ga0105248_10051927 3300009177 Bacteria 4601
255 Ga0105248_12229241 3300009177 Bacteria 623
256 Ga0105248_12806034 3300009177 Bacteria 556
257 Ga0105237_10096209 3300009545 Bacteria 2952
258 Ga0105237_10134450 3300009545 Unclassified 2467
259 Ga0105237_10180644 3300009545 Bacteria 2110
260 Ga0105237_10260633 3300009545 Bacteria 1736
261 Ga0105238_10413477 3300009551 Bacteria 1343
262 Ga0105249_10002193 3300009553 Bacteria 16909
263 Ga0105249_10002960 3300009553 Bacteria 14658
264 Ga0105249_10014760 3300009553 Bacteria 6905
265 Ga0105249_10017239 3300009553 Bacteria 6410
266 Ga0105249_10141842 3300009553 Unclassified 2305
267 Ga0105249_10211965 3300009553 Bacteria 1901
268 Ga0105249_10894275 3300009553 Bacteria 955
269 Ga0105239_10173411 3300010375 Bacteria 2412
270 Ga0105239_10286433 3300010375 Unclassified 1855
271 Ga0157373_10021135 3300013100 Bacteria 4724
272 Ga0157373_10057431 3300013100 Bacteria 2760
273 Ga0157373_10124199 3300013100 Bacteria 1815
274 Ga0157373_10281965 3300013100 Bacteria 1178
275 Ga0157373_10957849 3300013100 Bacteria 637
276 Ga0157371_10004275 3300013102 Bacteria 12535
277 Ga0157371_10010869 3300013102 Bacteria 7061
278 Ga0157371_10016688 3300013102 Bacteria 5471
279 Ga0157371_10023528 3300013102 Bacteria 4505
280 Ga0157371_10027212 3300013102 Unclassified 4149
281 Ga0157371_10240375 3300013102 Bacteria 1302
282 Ga0157371_11021745 3300013102 Bacteria 631
283 Ga0157370_10002146 3300013104 Bacteria 24107
284 Ga0157370_10154079 3300013104 Bacteria 2138
285 Ga0157370_10247408 3300013104 Bacteria 1649
286 Ga0157370_10518243 3300013104 Unclassified 1094
287 Ga0157370_10551361 3300013104 Bacteria 1057
288 Ga0157370_10763663 3300013104 Bacteria 881
289 Ga0157370_11850922 3300013104 Unclassified 541
290 Ga0157369_10105726 3300013105 Bacteria 2996
291 Ga0157369_10304439 3300013105 Unclassified 1658
292 Ga0157369_10987774 3300013105 Bacteria 862
293 Ga0157369_11188841 3300013105 Bacteria 778
294 Ga0157374_10004948 3300013296 Bacteria 11184
295 Ga0157374_10592572 3300013296 Unclassified 1118
296 Ga0157378_10000300 3300013297 Bacteria 47857
297 Ga0157378_10002218 3300013297 Bacteria 17223
298 Ga0157378_10002843 3300013297 Bacteria 15430
299 Ga0157378_10077809 3300013297 Bacteria 2991
300 Ga0157378_10134103 3300013297 Bacteria 2295
301 Ga0157378_10470725 3300013297 Bacteria 1250
302 Ga0157378_10708334 3300013297 Bacteria 1027
303 Ga0157378_10862572 3300013297 Bacteria 934
304 Ga0163162_10000309 3300013306 Bacteria 45197
305 Ga0163162_10002015 3300013306 Bacteria 19126
306 Ga0163162_10042253 3300013306 Unclassified 4562
307 Ga0163162_10173464 3300013306 Bacteria 2281
308 Ga0163162_10366664 3300013306 Bacteria 1573
309 Ga0163162_10585427 3300013306 Bacteria 1243
310 Ga0163162_10719584 3300013306 Bacteria 1119
311 Ga0163162_10737703 3300013306 Bacteria 1105
312 Ga0163162_10832308 3300013306 Bacteria 1039
313 Ga0157372_10030801 3300013307 Bacteria 5869
314 Ga0157372_10056173 3300013307 Unclassified 4399
315 Ga0157372_10250577 3300013307 Bacteria 2055
316 Ga0157372_10377719 3300013307 Bacteria 1651
317 Ga0157372_10605930 3300013307 Unclassified 1276
318 Ga0157372_10807245 3300013307 Bacteria 1090
319 Ga0157372_10823184 3300013307 Bacteria 1078
320 Ga0157372_11079113 3300013307 Unclassified 929
321 Ga0157375_10021700 3300013308 Bacteria 5894
322 Ga0157375_10073277 3300013308 Bacteria 3443
323 Ga0157375_10116344 3300013308 Bacteria 2778
324 Ga0157375_10424720 3300013308 Bacteria 1495
325 Ga0157375_10616505 3300013308 Bacteria 1243
326 Ga0157375_11134725 3300013308 Bacteria 916
327 Ga0163163_10000201 3300014325 Bacteria 61825
328 Ga0163163_10007313 3300014325 Bacteria 9740
329 Ga0163163_10228377 3300014325 Bacteria 1910
330 Ga0163163_10484106 3300014325 Unclassified 1298
331 Ga0163163_10655452 3300014325 Bacteria 1113
332 Ga0157380_10006199 3300014326 Bacteria 8392
333 Ga0157380_10044461 3300014326 Bacteria 3481
334 Ga0157380_10096713 3300014326 Bacteria 2449
335 Ga0157380_10122046 3300014326 Bacteria 2209
336 Ga0157380_11369507 3300014326 Bacteria 757
337 Ga0157380_11516747 3300014326 Bacteria 724
338 Ga0157377_10473537 3300014745 Unclassified 870
339 Ga0157377_10510989 3300014745 Bacteria 841
340 Ga0157379_10000235 3300014968 Bacteria 43455
341 Ga0157379_10000895 3300014968 Bacteria 24098
342 Ga0157379_10115970 3300014968 Bacteria 2408
343 Ga0157379_10308393 3300014968 Bacteria 1443
344 Ga0157379_10387943 3300014968 Bacteria 1282
345 Ga0157379_10766414 3300014968 Bacteria 909
346 Ga0157379_10832050 3300014968 Unclassified 873
347 Ga0157379_11685100 3300014968 Bacteria 621
348 Ga0157379_12345481 3300014968 Unclassified 532
349 Ga0157376_10000520 3300014969 Bacteria 24842
350 Ga0157376_10001131 3300014969 Bacteria 17505
351 Ga0157376_10351349 3300014969 Bacteria 1411
352 Ga0157376_10448807 3300014969 Unclassified 1257
353 Ga0157376_11030112 3300014969 Bacteria 847
354 Ga0157376_11299072 3300014969 Unclassified 757
355 Ga0157376_11477527 3300014969 Bacteria 712
356 Ga0157376_12361001 3300014969 Bacteria 571
357 Ga0163161_10001998 3300017792 Bacteria 14764
358 Ga0163161_10034877 3300017792 Bacteria 3599
359 Ga0163161_10053315 3300017792 Bacteria 2933
360 Ga0163161_10541329 3300017792 Bacteria 953
361 Ga0163161_10704250 3300017792 Bacteria 841
362 Ga0209455_1001148 3300025272 Bacteria 12787
363 Ga0207697_10022293 3300025315 Bacteria 2594
364 Ga0207697_10107480 3300025315 Bacteria 1193
365 Ga0207656_10000323 3300025321 Bacteria 16457
366 Ga0207656_10064999 3300025321 Bacteria 1609
367 Ga0207682_10112035 3300025893 Bacteria 1202
368 Ga0207642_10230099 3300025899 Bacteria 1041
369 Ga0207710_10001761 3300025900 Bacteria 10447
370 Ga0207710_10013102 3300025900 Bacteria 3492
371 Ga0207710_10454586 3300025900 Bacteria 661
372 Ga0207680_10006935 3300025903 Bacteria 5493
373 Ga0207680_11244124 3300025903 Unclassified 530
374 Ga0207647_10046562 3300025904 Unclassified 2702
375 Ga0207647_10078389 3300025904 Bacteria 1984
376 Ga0207647_10175342 3300025904 Bacteria 1247
377 Ga0207647_10481013 3300025904 Bacteria 694
378 Ga0207645_10000332 3300025907 Bacteria 39392
379 Ga0207645_10027999 3300025907 Bacteria 3638
380 Ga0207643_10444612 3300025908 Bacteria 824
381 Ga0207705_10000185 3300025909 Bacteria 65037
382 Ga0207705_10003822 3300025909 Bacteria 11455
383 Ga0207705_10008406 3300025909 Bacteria 7538
384 Ga0207705_10011007 3300025909 Bacteria 6565
385 Ga0207705_10184242 3300025909 Unclassified 1577
386 Ga0207705_10216004 3300025909 Bacteria 1455
387 Ga0207705_10628321 3300025909 Bacteria 835
388 Ga0207707_10662378 3300025912 Bacteria 879
389 Ga0207695_10017367 3300025913 Bacteria 8373
390 Ga0207695_10017984 3300025913 Bacteria 8185
391 Ga0207695_10117209 3300025913 Bacteria 2636
392 Ga0207695_10875936 3300025913 Bacteria 778
393 Ga0207671_10161935 3300025914 Unclassified 1733
394 Ga0207671_10468252 3300025914 Bacteria 1004
395 Ga0207671_10559978 3300025914 Bacteria 911
396 Ga0207671_11501998 3300025914 Bacteria 520
397 Ga0207660_10869075 3300025917 Bacteria 736
398 Ga0207662_10102058 3300025918 Bacteria 1779
399 Ga0207662_10931378 3300025918 Bacteria 616
400 Ga0207657_10032360 3300025919 Bacteria 4725
401 Ga0207657_10087188 3300025919 Bacteria 2612
402 Ga0207657_10207743 3300025919 Bacteria 1572
403 Ga0207657_10512143 3300025919 Bacteria 939
404 Ga0207657_10802600 3300025919 Bacteria 728
405 Ga0207649_10106261 3300025920 Bacteria 1867
406 Ga0207652_10312761 3300025921 Bacteria 1418
407 Ga0207652_10459450 3300025921 Unclassified 1148
408 Ga0207652_10606639 3300025921 Bacteria 981
409 Ga0207681_10051216 3300025923 Bacteria 2796
410 Ga0207681_10087866 3300025923 Bacteria 2213
411 Ga0207681_10786883 3300025923 Unclassified 794
412 Ga0207650_10037975 3300025925 Bacteria 3512
413 Ga0207650_10327482 3300025925 Bacteria 1256
414 Ga0207650_11379779 3300025925 Bacteria 600
415 Ga0207659_10046015 3300025926 Bacteria 3079
416 Ga0207659_10066945 3300025926 Bacteria 2608
417 Ga0207659_10212330 3300025926 Bacteria 1552
418 Ga0207659_10807427 3300025926 Unclassified 806
419 Ga0207659_11037470 3300025926 Bacteria 706
420 Ga0207687_11114564 3300025927 Bacteria 678
421 Ga0207644_10113064 3300025931 Bacteria 2056
422 Ga0207644_10309290 3300025931 Bacteria 1275
423 Ga0207690_10126456 3300025932 Bacteria 1864
424 Ga0207706_10013524 3300025933 Bacteria 7417
425 Ga0207706_10021198 3300025933 Bacteria 5838
426 Ga0207686_10014710 3300025934 Bacteria 4363
427 Ga0207686_10156171 3300025934 Unclassified 1594
428 Ga0207686_11498197 3300025934 Bacteria 556
429 Ga0207670_10166074 3300025936 Bacteria 1651
430 Ga0207669_10067537 3300025937 Bacteria 2229
431 Ga0207669_10163181 3300025937 Bacteria 1577
432 Ga0207669_11846078 3300025937 Bacteria 516
433 Ga0207704_10009227 3300025938 Bacteria 4749
434 Ga0207704_10894092 3300025938 Bacteria 746
435 Ga0207704_11450880 3300025938 Bacteria 588
436 Ga0207691_10000164 3300025940 Bacteria 61768
437 Ga0207691_10031854 3300025940 Bacteria 4921
438 Ga0207691_10378587 3300025940 Bacteria 1208
439 Ga0207691_10524543 3300025940 Bacteria 1005
440 Ga0207691_10810797 3300025940 Bacteria 786
441 Ga0207689_10084988 3300025942 Bacteria 2601
442 Ga0207689_10087817 3300025942 Bacteria 2554
443 Ga0207689_10263335 3300025942 Bacteria 1427
444 Ga0207661_10692745 3300025944 Bacteria 937
445 Ga0207661_10759162 3300025944 Bacteria 893
446 Ga0207679_10070147 3300025945 Bacteria 2640
447 Ga0207679_10362966 3300025945 Bacteria 1265
448 Ga0207679_10901106 3300025945 Bacteria 809
449 Ga0207667_10000033 3300025949 Bacteria 314353
450 Ga0207667_10026940 3300025949 Bacteria 6271
451 Ga0207667_10032443 3300025949 Bacteria 5628
452 Ga0207667_10051453 3300025949 Bacteria 4343
453 Ga0207667_10060000 3300025949 Unclassified 3982
454 Ga0207667_10106290 3300025949 Bacteria 2895
455 Ga0207667_11717741 3300025949 Unclassified 594
456 Ga0207667_11757805 3300025949 Bacteria 585
457 Ga0207651_10000385 3300025960 Bacteria 18809
458 Ga0207651_10213340 3300025960 Bacteria 1555
459 Ga0207651_10276481 3300025960 Bacteria 1386
460 Ga0207651_10437655 3300025960 Bacteria 1119
461 Ga0207651_10658833 3300025960 Bacteria 919
462 Ga0207651_10837759 3300025960 Unclassified 817
463 Ga0207651_11092332 3300025960 Bacteria 715
464 Ga0207712_10005661 3300025961 Bacteria 7881
465 Ga0207712_10025671 3300025961 Bacteria 3917
466 Ga0207712_10064117 3300025961 Bacteria 2618
467 Ga0207712_10189631 3300025961 Bacteria 1622
468 Ga0207712_10466197 3300025961 Bacteria 1074
469 Ga0207668_10004288 3300025972 Bacteria 8369
470 Ga0207668_10103051 3300025972 Bacteria 2124
471 Ga0207668_10233571 3300025972 Bacteria 1484
472 Ga0207668_10607934 3300025972 Bacteria 953
473 Ga0207668_11716449 3300025972 Bacteria 567
474 Ga0207640_10098041 3300025981 Unclassified 2048
475 Ga0207640_10143483 3300025981 Bacteria 1744
476 Ga0207640_10421220 3300025981 Bacteria 1093
477 Ga0207640_10682912 3300025981 Bacteria 878
478 Ga0207640_11132480 3300025981 Bacteria 693
479 Ga0207640_11151643 3300025981 Bacteria 688
480 Ga0207640_11480990 3300025981 Bacteria 609
481 Ga0207658_10000445 3300025986 Bacteria 38969
482 Ga0207658_11349048 3300025986 Bacteria 652
483 Ga0207677_10002079 3300026023 Bacteria 10537
484 Ga0207677_10174985 3300026023 Bacteria 1683
485 Ga0207703_10001076 3300026035 Bacteria 25996
486 Ga0207639_10011294 3300026041 Bacteria 6198
487 Ga0207639_10041918 3300026041 Bacteria 3429
488 Ga0207639_10104102 3300026041 Bacteria 2301
489 Ga0207639_10120817 3300026041 Bacteria 2152
490 Ga0207639_10134941 3300026041 Unclassified 2048
491 Ga0207639_10666862 3300026041 Bacteria 963
492 Ga0207639_11051984 3300026041 Bacteria 763
493 Ga0207639_11434049 3300026041 Unclassified 648
494 Ga0207678_10238704 3300026067 Bacteria 1557
495 Ga0207708_10265926 3300026075 Bacteria 1385
496 Ga0207708_10920729 3300026075 Bacteria 757
497 Ga0207708_11147659 3300026075 Bacteria 678
498 Ga0207702_10013671 3300026078 Bacteria 6742
499 Ga0207702_10015109 3300026078 Bacteria 6401
500 Ga0207702_10060403 3300026078 Unclassified 3232
501 Ga0207702_10355139 3300026078 Bacteria 1403
502 Ga0207641_10000213 3300026088 Bacteria 75051
503 Ga0207641_10001216 3300026088 Bacteria 25760
504 Ga0207641_10017861 3300026088 Bacteria 5810
505 Ga0207641_10230111 3300026088 Bacteria 1722
506 Ga0207641_12547718 3300026088 Bacteria 510
507 Ga0207648_10006386 3300026089 Bacteria 11716
508 Ga0207648_10101441 3300026089 Bacteria 2522
509 Ga0207648_10230310 3300026089 Bacteria 1648
510 Ga0207648_10411446 3300026089 Bacteria 1227
511 Ga0207676_10000619 3300026095 Bacteria 29040
512 Ga0207676_10001280 3300026095 Bacteria 18696
513 Ga0207676_10067285 3300026095 Bacteria 2861
514 Ga0207676_10922853 3300026095 Bacteria 857
515 Ga0207676_10993477 3300026095 Unclassified 827
516 Ga0207674_10057215 3300026116 Bacteria 3953
517 Ga0207674_10064024 3300026116 Bacteria 3709
518 Ga0207674_11549710 3300026116 Bacteria 631
519 Ga0207674_11850129 3300026116 Bacteria 570
520 Ga0207675_100000468 3300026118 Bacteria 39425
521 Ga0207675_100024985 3300026118 Bacteria 5559
522 Ga0207675_100197747 3300026118 Bacteria 1930
523 Ga0207675_100451115 3300026118 Unclassified 1274
524 Ga0207675_100898239 3300026118 Bacteria 902
525 Ga0207683_10077564 3300026121 Bacteria 2943
526 Ga0207683_10575644 3300026121 Bacteria 1042
527 Ga0207683_11515447 3300026121 Bacteria 619
528 Ga0207698_10318972 3300026142 Unclassified 1454
529 Ga0207698_10571829 3300026142 Bacteria 1111
530 Ga0207698_10705721 3300026142 Bacteria 1004
531 Ga0207698_10765879 3300026142 Bacteria 965
532 Ga0207698_11312088 3300026142 Bacteria 738
533 Ga0207698_11422135 3300026142 Unclassified 709
534 Ga0209995_1078918 3300027471 Bacteria 565
535 Ga0209968_1035704 3300027526 Bacteria 840
536 Ga0209968_1062548 3300027526 Unclassified 657
537 Ga0209968_1065746 3300027526 Bacteria 642
538 Ga0207428_10021368 3300027907 Bacteria 5480
539 Ga0268266_10013608 3300028379 Bacteria 7007
540 Ga0268265_10017540 3300028380 Bacteria 4942
541 Ga0268265_10396616 3300028380 Bacteria 1274
542 Ga0268265_10463920 3300028380 Bacteria 1186
543 Ga0268264_10099722 3300028381 Bacteria 2521
544 Ga0268264_10358413 3300028381 Bacteria 1390
545 Ga0265338_10395958 3300028800 Unclassified 985
546 Ga0265327_10002339 3300031251 Bacteria 20220
547 Ga0265327_10050785 3300031251 Bacteria 2168
548 Ga0307408_100302186 3300031548 Bacteria 1341
549 Ga0307406_10698108 3300031901 Bacteria 847
550 Ga0307409_100994262 3300031995 Bacteria 857
551 Ga0307409_101960007 3300031995 Unclassified 615
552 Ga0307411_10558182 3300032005 Bacteria 978
553 Ga0307411_10571135 3300032005 Bacteria 968
554 Ga0373936_0246650 3300035113 Bacteria 797
555 Ga0373937_0268417 3300036401 Bacteria 1610
556 Ga0373925_0266567 3300037068 Bacteria 1377
557 Ga0395899_0037572 3300037312 Bacteria 3630
558 Ga0395899_0067735 3300037312 Unclassified 2619
559 Ga0395900_0051706 3300037418 Bacteria 4231
560 Ga0395898_0017915 3300037466 Bacteria 7226
561 Ga0395898_0047697 3300037466 Bacteria 4202
562 Ga0395905_1564025 3300037471 Bacteria 564
563 Ga0395901_0275455 3300038443 Bacteria 1749
564 Ga0439453_0150679 3300041408 Bacteria 552
565 Ga0451798_0049460 3300041458 Bacteria 633
566 Ga0451802_1780706 3300041460 Bacteria 1063
567 Ga0451835_0574206 3300041492 Unclassified 504
568 Ga0451577_0299068 3300042876 Bacteria 1458
569 Ga0453683_0738980 3300044673 Bacteria 646
570 Ga0453684_0124855 3300044712 Bacteria 3100
571 Ga0453684_0187223 3300044712 Bacteria 2424
572 Ga0466959_0406182 3300045049 Bacteria 925
573 Ga0495592_0759504 3300046454 Bacteria 579
574 Ga0495629_0692429 3300046459 Bacteria 677
575 Ga0495580_0031732 3300046472 Bacteria 3816
576 Ga0495639_0162726 3300046475 Bacteria 1081
577 Ga0495662_0362140 3300046476 Bacteria 713
578 Ga0495662_0430063 3300046476 Unclassified 648
579 Ga0495630_0104642 3300046517 Bacteria 2142
580 Ga0495652_0705077 3300046529 Bacteria 679
581 Ga0495665_0423929 3300046531 Bacteria 674
582 Ga0495587_0154420 3300046536 Bacteria 1308
583 Ga0495587_0239741 3300046536 Bacteria 1020
584 Ga0495645_0175758 3300046543 Bacteria 1471
585 Ga0495645_0252810 3300046543 Bacteria 1171
586 Ga0495633_0088187 3300046558 Bacteria 1443
587 Ga0495667_0460195 3300046559 Bacteria 799
588 Ga0495635_0225507 3300046663 Bacteria 1267
589 Ga0495635_0435598 3300046663 Bacteria 868
590 Ga0495635_0442773 3300046663 Bacteria 860
591 Ga0495657_0432214 3300046675 Bacteria 772
592 Ga0495658_0030647 3300046683 Bacteria 2923
593 Ga0495670_0061653 3300046691 Bacteria 1886
594 Ga0495600_0135987 3300046809 Bacteria 1597
595 Ga0495600_0591859 3300046809 Bacteria 675
596 Ga0495604_0275747 3300047317 Bacteria 1138
597 Ga0495674_0112729 3300047319 Bacteria 2304
598 Ga0495674_0221935 3300047319 Bacteria 1562
599 Ga0495674_1368087 3300047319 Unclassified 529
600 Ga0495675_0767809 3300047444 Bacteria 536
601 Ga0495681_0326515 3300047470 Bacteria 588
602 Ga0495614_0477150 3300048089 Bacteria 592
603 Ga0496104_0187217 3300048907 Unclassified 1981
604 Ga0496105_0355833 3300048908 Archaea 1169
605 Ga0496107_0427080 3300048910 Bacteria 985
606 Ga0496108_1338985 3300048911 Bacteria 601
607 Ga0496109_0039082 3300048912 Bacteria 4294
608 Ga0496109_1277785 3300048912 Bacteria 670
609 Ga0496115_0565946 3300048918 Unclassified 907
610 Ga0496115_0584901 3300048918 Bacteria 889
611 Ga0496115_0972158 3300048918 Bacteria 651
612 nmdc:mga05p37_1713908_c1 3300050507 Unclassified 612
613 nmdc:mga09592_226097_c1 3300050508 Unclassified 1621
614 nmdc:mga09592_945278_c1 3300050508 Bacteria 723
615 nmdc:mga06r32_50915_c1 3300050510 Bacteria 3962
616 nmdc:mga08y16_43367_c1 3300050511 Bacteria 4714
617 Ga0495619_0107781 3300053085 Bacteria 1901
618 Ga0157370_10021159
619 SwRhRL3b_contig_3788158
620 SwRhRL2b_contig_3171726
621 JGI24738J21930_10159885
622 JGI24751J29686_10004430
623 rootH1_10113339
624 rootL2_10257551
625 Ga0055529_1035859
626 Ga0065714_10275581
627 Ga0065714_10413957
628 Ga0065712_10102581
629 Ga0065712_10125134
630 Ga0065712_10185035
631 Ga0065712_10203615
632 Ga0065715_10103344
633 Ga0065715_10286080
634 Ga0065707_10115295
635 Ga0065707_10825910
636 Ga0070658_10000025
637 Ga0070658_10000869
638 Ga0070658_10021912
639 Ga0070658_10055644
640 Ga0070658_10108295
641 Ga0070658_10233005
642 Ga0070658_10691227
643 Ga0070676_10000097
644 Ga0070683_100442570
645 Ga0070683_100600737
646 Ga0070683_101431747
647 Ga0070683_102161623
648 Ga0070690_100754476
649 Ga0070670_100270608
650 Ga0070670_100281740
651 Ga0070670_100418966
652 Ga0070670_100544383
653 Ga0070677_10042041
654 Ga0070677_10283953
655 Ga0068869_100044315
656 Ga0068869_100054906
657 Ga0068869_100221034
658 Ga0070666_10012342
659 Ga0070680_100082691
660 Ga0070680_100200630
661 Ga0070680_101182838
662 Ga0070682_100236830
663 Ga0070682_100491932
664 Ga0068868_100001216
665 Ga0068868_100027721
666 Ga0068868_100150513
667 Ga0068868_100334421
668 Ga0070660_100112424
669 Ga0070660_100119160
670 Ga0070660_101165142
671 Ga0070660_101517104
672 Ga0070689_100039653
673 Ga0070689_100538306
674 Ga0070689_100614702
675 Ga0070689_101545778
676 Ga0070687_100212722
677 Ga0070687_100640285
678 Ga0070661_100133317
679 Ga0070668_100000017
680 Ga0070668_100000912
681 Ga0070668_100112801
682 Ga0070668_100260680
683 Ga0070669_100027588
684 Ga0070669_100035410
685 Ga0070669_100299484
686 Ga0070669_100589087
687 Ga0070669_100886206
688 Ga0070675_100016938
689 Ga0070675_100063083
690 Ga0070675_100071538
691 Ga0070675_100205048
692 Ga0070675_100702379
693 Ga0070675_101222383
694 Ga0070671_100333273
695 Ga0070671_100575955
696 Ga0070671_101506231
697 Ga0070674_100201278
698 Ga0070674_100221387
699 Ga0070674_100898930
700 Ga0070674_101683276
701 Ga0070673_100000587
702 Ga0070673_100228450
703 Ga0070673_100308950
704 Ga0070673_100356205
705 Ga0070688_100019619
706 Ga0070688_100181453
707 Ga0070659_100043359
708 Ga0070667_100001108
709 Ga0070667_100090642
710 Ga0070667_100888525
711 Ga0070667_101136822
712 Ga0070667_101652555
713 Ga0070701_10522564
714 Ga0070701_11254622
715 Ga0070700_101480343
716 Ga0070663_100452181
717 Ga0070678_100101259
718 Ga0070678_100872142
719 Ga0070678_101889736
720 Ga0070662_100011806
721 Ga0070662_100020017
722 Ga0070681_10328177
723 Ga0070681_11807749
724 Ga0068867_100001305
725 Ga0068867_100153659
726 Ga0068867_100181153
727 Ga0068867_100206930
728 Ga0068867_100243859
729 Ga0068867_100526671
730 Ga0070685_10468892
731 Ga0070685_10471921
732 Ga0070685_10488498
733 Ga0070698_100023413
734 Ga0070679_100011316
735 Ga0070679_100163011
736 Ga0070679_100699073
737 Ga0070684_100347323
738 Ga0068853_100135767
739 Ga0068853_100142764
740 Ga0068853_100230233
741 Ga0068853_100245639
742 Ga0068853_101106528
743 Ga0070672_100000633
744 Ga0070672_100032981
745 Ga0070672_100275287
746 Ga0070672_101688359
747 Ga0070686_100718987
748 Ga0070695_100704003
749 Ga0070665_100000876
750 Ga0070665_100001963
751 Ga0068855_100000139
752 Ga0068855_100018294
753 Ga0068855_100213839
754 Ga0068855_100217485
755 Ga0068855_100470849
756 Ga0068855_100473279
757 Ga0068855_102263873
758 Ga0070664_100051331
759 Ga0070664_100449509
760 Ga0070664_100811625
761 Ga0070664_102392393
762 Ga0068857_100663851
763 Ga0068857_101143456
764 Ga0068857_101620929
765 Ga0068857_102107138
766 Ga0068854_100173304
767 Ga0068854_100194772
768 Ga0068854_100218382
769 Ga0068854_100234211
770 Ga0068854_100446330
771 Ga0068854_100540133
772 Ga0068854_101083256
773 Ga0068856_100000385
774 Ga0068856_100019733
775 Ga0068856_100037748
776 Ga0068856_100063445
777 Ga0070702_100986219
778 Ga0068852_100138081
779 Ga0068852_100196111
780 Ga0068852_100485741
781 Ga0068852_100593422
782 Ga0068852_100673853
783 Ga0068852_101196434
784 Ga0068852_101561311
785 Ga0068859_100015830
786 Ga0068859_100020914
787 Ga0068859_100509591
788 Ga0068859_100780344
789 Ga0068859_101163288
790 Ga0068859_101366398
791 Ga0068859_102817897
792 Ga0068864_100001914
793 Ga0068864_100028707
794 Ga0068864_100083534
795 Ga0068864_100628523
796 Ga0068864_100776811
797 Ga0068866_10274127
798 Ga0068861_100015400
799 Ga0068861_100464268
800 Ga0068851_10000634
801 Ga0068870_10005796
802 Ga0068870_11226037
803 Ga0068863_100001806
804 Ga0068863_100023737
805 Ga0068858_100001289
806 Ga0068860_100049830
807 Ga0068860_100080043
808 Ga0068860_100290358
809 Ga0068862_100008325
810 Ga0068862_100092548
811 Ga0068862_100674388
812 Ga0070715_10643289
813 Ga0070716_100864213
814 Ga0097621_100000393
815 Ga0097621_100012851
816 Ga0097621_100088789
817 Ga0097621_100162232
818 Ga0097621_100246187
819 Ga0097621_100512720
820 Ga0097621_100848961
821 Ga0097621_102022702
822 Ga0068871_100009062
823 Ga0068871_100014045
824 Ga0068871_100051598
825 Ga0068871_100292858
826 Ga0068871_100445979
827 Ga0068871_100627425
828 Ga0068871_101652565
829 Ga0068871_101853048
830 Ga0075428_100160177
831 Ga0075430_100488533
832 Ga0075431_100060769
833 Ga0075429_100115060
834 Ga0075429_100161390
835 Ga0075429_100864128
836 Ga0068865_100001528
837 Ga0068865_100841938
838 Ga0068865_100914336
839 Ga0097620_100015832
840 Ga0097620_100020914
841 Ga0097620_100509626
842 Ga0097620_100780378
843 Ga0097620_101163145
844 Ga0097620_101365951
845 Ga0097620_102817258
846 Ga0105240_10016822
847 Ga0105240_10031607
848 Ga0105240_10384119
849 Ga0105240_10492878
850 Ga0111539_10001827
851 Ga0111539_10405764
852 Ga0105245_10520532
853 Ga0105245_11378219
854 Ga0105245_11501640
855 Ga0105247_10003381
856 Ga0105247_10007550
857 Ga0105247_10423827
858 Ga0105247_11701033
859 Ga0114129_10256030
860 Ga0114129_11636285
861 Ga0105243_10141428
862 Ga0105243_10910393
863 Ga0105241_10024494
864 Ga0105241_10049460
865 Ga0105242_10006376
866 Ga0105242_10012619
867 Ga0105242_10167061
868 Ga0105242_11201777
869 Ga0105242_11489922
870 Ga0105242_12734491
871 Ga0105248_10051927
872 Ga0105248_12229241
873 Ga0105248_12806034
874 Ga0105237_10096209
875 Ga0105237_10134450
876 Ga0105237_10180644
877 Ga0105237_10260633
878 Ga0105238_10413477
879 Ga0105249_10002193
880 Ga0105249_10002960
881 Ga0105249_10014760
882 Ga0105249_10017239
883 Ga0105249_10141842
884 Ga0105249_10211965
885 Ga0105249_10894275
886 Ga0105239_10173411
887 Ga0105239_10286433
888 Ga0157373_10021135
889 Ga0157373_10057431
890 Ga0157373_10124199
891 Ga0157373_10281965
892 Ga0157373_10957849
893 Ga0157371_10004275
894 Ga0157371_10010869
895 Ga0157371_10016688
896 Ga0157371_10023528
897 Ga0157371_10027212
898 Ga0157371_10240375
899 Ga0157371_11021745
900 Ga0157370_10002146
901 Ga0157370_10154079
902 Ga0157370_10247408
903 Ga0157370_10518243
904 Ga0157370_10551361
905 Ga0157370_10763663
906 Ga0157370_11850922
907 Ga0157369_10105726
908 Ga0157369_10304439
909 Ga0157369_10987774
910 Ga0157369_11188841
911 Ga0157374_10004948
912 Ga0157374_10592572
913 Ga0157378_10000300
914 Ga0157378_10002218
915 Ga0157378_10002843
916 Ga0157378_10077809
917 Ga0157378_10134103
918 Ga0157378_10470725
919 Ga0157378_10708334
920 Ga0157378_10862572
921 Ga0163162_10000309
922 Ga0163162_10002015
923 Ga0163162_10042253
924 Ga0163162_10173464
925 Ga0163162_10366664
926 Ga0163162_10585427
927 Ga0163162_10719584
928 Ga0163162_10737703
929 Ga0163162_10832308
930 Ga0157372_10030801
931 Ga0157372_10056173
932 Ga0157372_10250577
933 Ga0157372_10377719
934 Ga0157372_10605930
935 Ga0157372_10807245
936 Ga0157372_10823184
937 Ga0157372_11079113
938 Ga0157375_10021700
939 Ga0157375_10073277
940 Ga0157375_10116344
941 Ga0157375_10424720
942 Ga0157375_10616505
943 Ga0157375_11134725
944 Ga0163163_10000201
945 Ga0163163_10007313
946 Ga0163163_10228377
947 Ga0163163_10484106
948 Ga0163163_10655452
949 Ga0157380_10006199
950 Ga0157380_10044461
951 Ga0157380_10096713
952 Ga0157380_10122046
953 Ga0157380_11369507
954 Ga0157380_11516747
955 Ga0157377_10473537
956 Ga0157377_10510989
957 Ga0157379_10000235
958 Ga0157379_10000895
959 Ga0157379_10115970
960 Ga0157379_10308393
961 Ga0157379_10387943
962 Ga0157379_10766414
963 Ga0157379_10832050
964 Ga0157379_11685100
965 Ga0157379_12345481
966 Ga0157376_10000520
967 Ga0157376_10001131
968 Ga0157376_10351349
969 Ga0157376_10448807
970 Ga0157376_11030112
971 Ga0157376_11299072
972 Ga0157376_11477527
973 Ga0157376_12361001
974 Ga0163161_10001998
975 Ga0163161_10034877
976 Ga0163161_10053315
977 Ga0163161_10541329
978 Ga0163161_10704250
979 Ga0209455_1001148
980 Ga0207697_10022293
981 Ga0207697_10107480
982 Ga0207656_10000323
983 Ga0207656_10064999
984 Ga0207682_10112035
985 Ga0207642_10230099
986 Ga0207710_10001761
987 Ga0207710_10013102
988 Ga0207710_10454586
989 Ga0207680_10006935
990 Ga0207680_11244124
991 Ga0207647_10046562
992 Ga0207647_10078389
993 Ga0207647_10175342
994 Ga0207647_10481013
995 Ga0207645_10000332
996 Ga0207645_10027999
997 Ga0207643_10444612
998 Ga0207705_10000185
999 Ga0207705_10003822
1000 Ga0207705_10008406
1001 Ga0207705_10011007
1002 Ga0207705_10184242
1003 Ga0207705_10216004
1004 Ga0207705_10628321
1005 Ga0207707_10662378
1006 Ga0207695_10017367
1007 Ga0207695_10017984
1008 Ga0207695_10117209
1009 Ga0207695_10875936
1010 Ga0207671_10161935
1011 Ga0207671_10468252
1012 Ga0207671_10559978
1013 Ga0207671_11501998
1014 Ga0207660_10869075
1015 Ga0207662_10102058
1016 Ga0207662_10931378
1017 Ga0207657_10032360
1018 Ga0207657_10087188
1019 Ga0207657_10207743
1020 Ga0207657_10512143
1021 Ga0207657_10802600
1022 Ga0207649_10106261
1023 Ga0207652_10312761
1024 Ga0207652_10459450
1025 Ga0207652_10606639
1026 Ga0207681_10051216
1027 Ga0207681_10087866
1028 Ga0207681_10786883
1029 Ga0207650_10037975
1030 Ga0207650_10327482
1031 Ga0207650_11379779
1032 Ga0207659_10046015
1033 Ga0207659_10066945
1034 Ga0207659_10212330
1035 Ga0207659_10807427
1036 Ga0207659_11037470
1037 Ga0207687_11114564
1038 Ga0207644_10113064
1039 Ga0207644_10309290
1040 Ga0207690_10126456
1041 Ga0207706_10013524
1042 Ga0207706_10021198
1043 Ga0207686_10014710
1044 Ga0207686_10156171
1045 Ga0207686_11498197
1046 Ga0207670_10166074
1047 Ga0207669_10067537
1048 Ga0207669_10163181
1049 Ga0207669_11846078
1050 Ga0207704_10009227
1051 Ga0207704_10894092
1052 Ga0207704_11450880
1053 Ga0207691_10000164
1054 Ga0207691_10031854
1055 Ga0207691_10378587
1056 Ga0207691_10524543
1057 Ga0207691_10810797
1058 Ga0207689_10084988
1059 Ga0207689_10087817
1060 Ga0207689_10263335
1061 Ga0207661_10692745
1062 Ga0207661_10759162
1063 Ga0207679_10070147
1064 Ga0207679_10362966
1065 Ga0207679_10901106
1066 Ga0207667_10000033
1067 Ga0207667_10026940
1068 Ga0207667_10032443
1069 Ga0207667_10051453
1070 Ga0207667_10060000
1071 Ga0207667_10106290
1072 Ga0207667_11717741
1073 Ga0207667_11757805
1074 Ga0207651_10000385
1075 Ga0207651_10213340
1076 Ga0207651_10276481
1077 Ga0207651_10437655
1078 Ga0207651_10658833
1079 Ga0207651_10837759
1080 Ga0207651_11092332
1081 Ga0207712_10005661
1082 Ga0207712_10025671
1083 Ga0207712_10064117
1084 Ga0207712_10189631
1085 Ga0207712_10466197
1086 Ga0207668_10004288
1087 Ga0207668_10103051
1088 Ga0207668_10233571
1089 Ga0207668_10607934
1090 Ga0207668_11716449
1091 Ga0207640_10098041
1092 Ga0207640_10143483
1093 Ga0207640_10421220
1094 Ga0207640_10682912
1095 Ga0207640_11132480
1096 Ga0207640_11151643
1097 Ga0207640_11480990
1098 Ga0207658_10000445
1099 Ga0207658_11349048
1100 Ga0207677_10002079
1101 Ga0207677_10174985
1102 Ga0207703_10001076
1103 Ga0207639_10011294
1104 Ga0207639_10041918
1105 Ga0207639_10104102
1106 Ga0207639_10120817
1107 Ga0207639_10134941
1108 Ga0207639_10666862
1109 Ga0207639_11051984
1110 Ga0207639_11434049
1111 Ga0207678_10238704
1112 Ga0207708_10265926
1113 Ga0207708_10920729
1114 Ga0207708_11147659
1115 Ga0207702_10013671
1116 Ga0207702_10015109
1117 Ga0207702_10060403
1118 Ga0207702_10355139
1119 Ga0207641_10000213
1120 Ga0207641_10001216
1121 Ga0207641_10017861
1122 Ga0207641_10230111
1123 Ga0207641_12547718
1124 Ga0207648_10006386
1125 Ga0207648_10101441
1126 Ga0207648_10230310
1127 Ga0207648_10411446
1128 Ga0207676_10000619
1129 Ga0207676_10001280
1130 Ga0207676_10067285
1131 Ga0207676_10922853
1132 Ga0207676_10993477
1133 Ga0207674_10057215
1134 Ga0207674_10064024
1135 Ga0207674_11549710
1136 Ga0207674_11850129
1137 Ga0207675_100000468
1138 Ga0207675_100024985
1139 Ga0207675_100197747
1140 Ga0207675_100451115
1141 Ga0207675_100898239
1142 Ga0207683_10077564
1143 Ga0207683_10575644
1144 Ga0207683_11515447
1145 Ga0207698_10318972
1146 Ga0207698_10571829
1147 Ga0207698_10705721
1148 Ga0207698_10765879
1149 Ga0207698_11312088
1150 Ga0207698_11422135
1151 Ga0209995_1078918
1152 Ga0209968_1035704
1153 Ga0209968_1062548
1154 Ga0209968_1065746
1155 Ga0207428_10021368
1156 Ga0268266_10013608
1157 Ga0268265_10017540
1158 Ga0268265_10396616
1159 Ga0268265_10463920
1160 Ga0268264_10099722
1161 Ga0268264_10358413
1162 Ga0265338_10395958
1163 Ga0265327_10002339
1164 Ga0265327_10050785
1165 Ga0307408_100302186
1166 Ga0307406_10698108
1167 Ga0307409_100994262
1168 Ga0307409_101960007
1169 Ga0307411_10558182
1170 Ga0307411_10571135
1171 Ga0373936_0246650
1172 Ga0373937_0268417
1173 Ga0373925_0266567
1174 Ga0395899_0037572
1175 Ga0395899_0067735
1176 Ga0395900_0051706
1177 Ga0395898_0017915
1178 Ga0395898_0047697
1179 Ga0395905_1564025
1180 Ga0395901_0275455
1181 Ga0439453_0150679
1182 Ga0451798_0049460
1183 Ga0451802_1780706
1184 Ga0451835_0574206
1185 Ga0451577_0299068
1186 Ga0453683_0738980
1187 Ga0453684_0124855
1188 Ga0453684_0187223
1189 Ga0466959_0406182
1190 Ga0495592_0759504
1191 Ga0495629_0692429
1192 Ga0495580_0031732
1193 Ga0495639_0162726
1194 Ga0495662_0362140
1195 Ga0495662_0430063
1196 Ga0495630_0104642
1197 Ga0495652_0705077
1198 Ga0495665_0423929
1199 Ga0495587_0154420
1200 Ga0495587_0239741
1201 Ga0495645_0175758
1202 Ga0495645_0252810
1203 Ga0495633_0088187
1204 Ga0495667_0460195
1205 Ga0495635_0225507
1206 Ga0495635_0435598
1207 Ga0495635_0442773
1208 Ga0495657_0432214
1209 Ga0495658_0030647
1210 Ga0495670_0061653
1211 Ga0495600_0135987
1212 Ga0495600_0591859
1213 Ga0495604_0275747
1214 Ga0495674_0112729
1215 Ga0495674_0221935
1216 Ga0495674_1368087
1217 Ga0495675_0767809
1218 Ga0495681_0326515
1219 Ga0495614_0477150
1220 Ga0496104_0187217
1221 Ga0496105_0355833
1222 Ga0496107_0427080
1223 Ga0496108_1338985
1224 Ga0496109_0039082
1225 Ga0496109_1277785
1226 Ga0496115_0565946
1227 Ga0496115_0584901
1228 Ga0496115_0972158
1229 nmdc:mga05p37_1713908_c1
1230 nmdc:mga09592_226097_c1
1231 nmdc:mga09592_945278_c1
1232 nmdc:mga06r32_50915_c1
1233 nmdc:mga08y16_43367_c1
1234 Ga0495619_0107781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v67-assembly1.cif.gz_BU crystal structure of a translation termination complex formed with release factor rf2. 0.3358 47 117
6vbk-assembly1.cif.gz_A crystal structure of n-terminal domain of mycobacterium tuberculosis complex lon protease 0.2972 36 124
7jm4-assembly1.cif.gz_B irf transcription factor 0.2859 19 83
1gcv-assembly1.cif.gz_A deoxy form hemoglobin from mustelus griseus 0.2538 42 123
7wbv-assembly1.cif.gz_D rna polymerase ii elongation complex bound with elf1 and spt4/5, stalled at shl(-4) of the nucleosome 0.2456 24 124
ID Description Score Start End Superfamily
2n1rA00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Immunodeficiency lentiviruses, gag gene matrix protein p17 0.3418 23 127 1.10.150.90
af_K7MM64_1_251_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.3373 47 121 3.30.420.10
af_C6KSU9_839_956_1.20.1390.10 Mainly Alpha;Up-down Bundle;PWI domain;PWI domain 0.329 15 125 1.20.1390.10
af_P16521_329_418_1.20.1390.20 Mainly Alpha;Up-down Bundle;PWI domain; 0.3206 40 124 1.20.1390.20
af_C6KSU9_839_956_1.20.1390.10 Mainly Alpha;Up-down Bundle;PWI domain;PWI domain 0.3174 15 125 1.20.1390.10
ID Description Score Start End GO Terms
AF-X1UB42-F1-model_v4 Cytochrome C Planctomycete-type domain-containing protein 0.9335 69 127
AF-X1UB42-F1-model_v4 Cytochrome C Planctomycete-type domain-containing protein 0.9187 69 127
AF-A0A425Y1K5-F1-model_v4 Cytochrome c domain-containing protein 0.8809 38 127 GO:0009055
GO:0020037
GO:0046872
AF-A0A3D3CUZ4-F1-model_v4 Cytochrome C Planctomycete-type domain-containing protein 0.8268 18 127
AF-A0A3B9N1T7-F1-model_v4 Cytochrome c domain-containing protein 0.8197 39 127

Map