F469615

General Info

Members Datasets Scaffolds Average Seq Length
617 216 617 429

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100153744|Ga0070706_1001537442
Length 509
Sequence MCFTNKANRCLDSLASAGLAVFNSECSTTEQEAVATWSFRNARALVEWHRNGQVPTASCSVVECEPNTVDLRGPIPYPMSTPEHSPTTTRTEAVAGITTFFTMAYIVVVNPSILSTPGTGMAFSGVLTATVLVCFVMTLLMGLYAKLPFAVAPGMGINAFFTFTIILTQKIWWQVALGIIFWAGVLFLLISITPIRETIAKAIPSELRIATAAGIGIFLTFIGLKNAGFIASDAVTLVRLGTLDKQTLLTILGLVITLVLIIRRSAGAFLAGIFVVTLIAWATGIVKAPEHFFSAPDFHTVFLKLDILGALKLSLLPAIIAILFTDLFDSISTFIGVAHAADLLDEDGNPRNLRQGLIVDSLATLGAGLAGSSSGTAYIESIAGINMGGRTGLTSVFTAACFLPCLFLAPLAGMVPGFATAPVLILVGASMFKSVGQISFGKIEEGLPAFLTIILIPLTFSITQGILWGFISHVGLYLLVGRRKDIHPVMYVLALISIGLLLLEHVRFS

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
199 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
202 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
203 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
204 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 99.03
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000001 3300002074 Bacteria 444271
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 JGI24751J29686_10000107 3300002459 Bacteria 44982
4 JGI25406J46586_10003112 3300003203 Bacteria 7803
5 Ga0065714_10064435 3300005288 Bacteria 121919
6 Ga0065712_10000118 3300005290 Bacteria 121959
7 Ga0065712_10009742 3300005290 Bacteria 2264
8 Ga0065712_10079650 3300005290 Bacteria 3195
9 Ga0065715_10089145 3300005293 Bacteria 13570
10 Ga0065715_10091894 3300005293 Bacteria 5480
11 Ga0065715_10102700 3300005293 Unclassified 3092
12 Ga0065715_10103858 3300005293 Bacteria 3003
13 Ga0065707_10017420 3300005295 Bacteria 2336
14 Ga0065707_10093441 3300005295 Bacteria 3627
15 Ga0065707_10100819 3300005295 Bacteria 2903
16 Ga0070676_10122178 3300005328 Bacteria 1636
17 Ga0070690_100119923 3300005330 Unclassified 1764
18 Ga0070690_100145023 3300005330 Bacteria 1614
19 Ga0070670_100000172 3300005331 Bacteria 58670
20 Ga0070670_100004889 3300005331 Bacteria 11278
21 Ga0070670_100051937 3300005331 Bacteria 3520
22 Ga0070670_100096170 3300005331 Bacteria 2548
23 Ga0070670_100214063 3300005331 Archaea 1676
24 Ga0070670_100282182 3300005331 Bacteria 1450
25 Ga0068869_100009995 3300005334 Bacteria 6170
26 Ga0068869_100016940 3300005334 Bacteria 4926
27 Ga0068869_100065738 3300005334 Bacteria 2670
28 Ga0068869_100074136 3300005334 Unclassified 2525
29 Ga0068869_100126927 3300005334 Bacteria 1957
30 Ga0070680_100000737 3300005336 Bacteria 22831
31 Ga0070682_100000108 3300005337 Bacteria 73708
32 Ga0070682_100019081 3300005337 Bacteria 4017
33 Ga0070689_100003322 3300005340 Bacteria 10683
34 Ga0070689_100017917 3300005340 Bacteria 5207
35 Ga0070689_100027429 3300005340 Bacteria 4293
36 Ga0070687_100000957 3300005343 Bacteria 9821
37 Ga0070687_100010613 3300005343 Bacteria 3993
38 Ga0070687_100043168 3300005343 Bacteria 2289
39 Ga0070661_100004376 3300005344 Bacteria 9742
40 Ga0070661_100055361 3300005344 Bacteria 2905
41 Ga0070692_10012305 3300005345 Bacteria 3956
42 Ga0070692_10062411 3300005345 Bacteria 1967
43 Ga0070669_100000609 3300005353 Bacteria 26606
44 Ga0070669_100006367 3300005353 Bacteria 8505
45 Ga0070669_100013346 3300005353 Bacteria 5839
46 Ga0070675_100000193 3300005354 Bacteria 38339
47 Ga0070675_100011189 3300005354 Bacteria 7020
48 Ga0070675_100016023 3300005354 Bacteria 5941
49 Ga0070675_100041159 3300005354 Bacteria 3774
50 Ga0070675_100121891 3300005354 Bacteria 2216
51 Ga0070671_100001211 3300005355 Bacteria 19307
52 Ga0070671_100086989 3300005355 Bacteria 2615
53 Ga0070674_100085168 3300005356 Bacteria 2268
54 Ga0070674_100104994 3300005356 Bacteria 2065
55 Ga0070673_100009349 3300005364 Bacteria 6576
56 Ga0070673_100028204 3300005364 Bacteria 4172
57 Ga0070673_100043300 3300005364 Bacteria 3478
58 Ga0070673_100084377 3300005364 Bacteria 2583
59 Ga0070673_100130544 3300005364 Bacteria 2107
60 Ga0070673_100183784 3300005364 Bacteria 1791
61 Ga0070673_100268589 3300005364 Bacteria 1492
62 Ga0070688_100002654 3300005365 Bacteria 9076
63 Ga0070688_100010408 3300005365 Bacteria 5126
64 Ga0070688_100011822 3300005365 Bacteria 4867
65 Ga0070688_100030646 3300005365 Bacteria 3229
66 Ga0070688_100064911 3300005365 Bacteria 2318
67 Ga0070659_100008237 3300005366 Bacteria 7611
68 Ga0070667_100100275 3300005367 Bacteria 2501
69 Ga0070703_10000049 3300005406 Bacteria 58073
70 Ga0070701_10078451 3300005438 Bacteria 1782
71 Ga0070701_10092881 3300005438 Bacteria 1657
72 Ga0070705_100012938 3300005440 Bacteria 4257
73 Ga0070700_100001704 3300005441 Bacteria 11035
74 Ga0070700_100012944 3300005441 Bacteria 4675
75 Ga0070700_100028122 3300005441 Bacteria 3341
76 Ga0070700_100028712 3300005441 Bacteria 3312
77 Ga0070700_100028849 3300005441 Unclassified 3305
78 Ga0070694_100004871 3300005444 Bacteria 8085
79 Ga0070694_100028066 3300005444 Unclassified 3659
80 Ga0070694_100041853 3300005444 Bacteria 3058
81 Ga0070694_100054537 3300005444 Unclassified 2708
82 Ga0070694_100137764 3300005444 Unclassified 1770
83 Ga0070708_100002650 3300005445 Bacteria 13861
84 Ga0070708_100043695 3300005445 Unclassified 3938
85 Ga0070678_100072607 3300005456 Bacteria 2580
86 Ga0070678_100078459 3300005456 Bacteria 2494
87 Ga0070662_100092574 3300005457 Bacteria 2272
88 Ga0070662_100169917 3300005457 Unclassified 1712
89 Ga0070662_100214020 3300005457 Bacteria 1535
90 Ga0070681_10003816 3300005458 Bacteria 14167
91 Ga0070681_10005160 3300005458 Bacteria 12600
92 Ga0070681_10108891 3300005458 Bacteria 2711
93 Ga0068867_100010637 3300005459 Bacteria 6492
94 Ga0068867_100056843 3300005459 Bacteria 2896
95 Ga0068867_100057391 3300005459 Bacteria 2883
96 Ga0068867_100151206 3300005459 Unclassified 1824
97 Ga0070685_10071454 3300005466 Bacteria 2058
98 Ga0070685_10169869 3300005466 Bacteria 1397
99 Ga0070706_100008066 3300005467 Bacteria 9823
100 Ga0070706_100030655 3300005467 Bacteria 4957
101 Ga0070706_100105842 3300005467 Bacteria 2617
102 Ga0070706_100153744 3300005467 Bacteria 2148
103 Ga0070707_100000107 3300005468 Bacteria 76101
104 Ga0070707_100158104 3300005468 Unclassified 2207
105 Ga0070698_100000063 3300005471 Bacteria 78062
106 Ga0070698_100031394 3300005471 Bacteria 5507
107 Ga0070698_100033509 3300005471 Bacteria 5319
108 Ga0070698_100047473 3300005471 Bacteria 4389
109 Ga0070698_100152548 3300005471 Bacteria 2257
110 Ga0070698_100211229 3300005471 Bacteria 1875
111 Ga0070699_100003506 3300005518 Bacteria 13861
112 Ga0070699_100026519 3300005518 Bacteria 4996
113 Ga0070699_100090207 3300005518 Bacteria 2679
114 Ga0070699_100097043 3300005518 Bacteria 2582
115 Ga0070699_100205819 3300005518 Unclassified 1751
116 Ga0070679_100000087 3300005530 Bacteria 69339
117 Ga0070697_100000062 3300005536 Bacteria 84791
118 Ga0070697_100000285 3300005536 Bacteria 40932
119 Ga0070697_100212046 3300005536 Bacteria 1649
120 Ga0068853_100038122 3300005539 Bacteria 4092
121 Ga0068853_100059676 3300005539 Bacteria 3296
122 Ga0068853_100186569 3300005539 Bacteria 1883
123 Ga0070672_100024168 3300005543 Bacteria 4486
124 Ga0070672_100028360 3300005543 Bacteria 4187
125 Ga0070686_100023399 3300005544 Bacteria 3691
126 Ga0070686_100046589 3300005544 Unclassified 2737
127 Ga0070686_100056114 3300005544 Bacteria 2525
128 Ga0070686_100086483 3300005544 Bacteria 2087
129 Ga0070695_100020413 3300005545 Unclassified 4046
130 Ga0070695_100021640 3300005545 Bacteria 3938
131 Ga0070695_100063674 3300005545 Unclassified 2397
132 Ga0070695_100170735 3300005545 Bacteria 1534
133 Ga0070665_100318408 3300005548 Bacteria 1560
134 Ga0070704_100006345 3300005549 Bacteria 6967
135 Ga0070704_100015082 3300005549 Bacteria 4844
136 Ga0070704_100021490 3300005549 Bacteria 4185
137 Ga0070704_100057420 3300005549 Bacteria 2767
138 Ga0070704_100103510 3300005549 Unclassified 2151
139 Ga0070704_100104306 3300005549 Bacteria 2144
140 Ga0070704_100136766 3300005549 Bacteria 1907
141 Ga0070664_100005418 3300005564 Bacteria 10243
142 Ga0070664_100006222 3300005564 Bacteria 9643
143 Ga0070664_100011008 3300005564 Bacteria 7336
144 Ga0070664_100168325 3300005564 Bacteria 1943
145 Ga0068857_100061601 3300005577 Bacteria 3333
146 Ga0068857_100068857 3300005577 Unclassified 3150
147 Ga0068857_100167290 3300005577 Bacteria 1997
148 Ga0068856_100017702 3300005614 Bacteria 6909
149 Ga0070702_100017379 3300005615 Bacteria 3709
150 Ga0070702_100020363 3300005615 Bacteria 3474
151 Ga0070702_100105759 3300005615 Bacteria 1735
152 Ga0070702_100118984 3300005615 Bacteria 1650
153 Ga0068852_100158210 3300005616 Bacteria 2113
154 Ga0068859_100000232 3300005617 Bacteria 54896
155 Ga0068859_100001031 3300005617 Bacteria 28545
156 Ga0068859_100004693 3300005617 Bacteria 13906
157 Ga0068859_100016624 3300005617 Bacteria 7386
158 Ga0068859_100028196 3300005617 Bacteria 5629
159 Ga0068859_100034234 3300005617 Bacteria 5099
160 Ga0068859_100040203 3300005617 Bacteria 4694
161 Ga0068859_100050919 3300005617 Bacteria 4161
162 Ga0068864_100022758 3300005618 Bacteria 5256
163 Ga0068864_100027181 3300005618 Bacteria 4829
164 Ga0068864_100035645 3300005618 Bacteria 4236
165 Ga0068864_100060210 3300005618 Bacteria 3288
166 Ga0068864_100098058 3300005618 Bacteria 2595
167 Ga0068864_100101643 3300005618 Bacteria 2550
168 Ga0068864_100124151 3300005618 Bacteria 2311
169 Ga0068864_100187769 3300005618 Bacteria 1893
170 Ga0068866_10001191 3300005718 Bacteria 11349
171 Ga0068866_10026465 3300005718 Bacteria 2740
172 Ga0068861_100003394 3300005719 Bacteria 10568
173 Ga0068861_100006887 3300005719 Bacteria 7764
174 Ga0068861_100104377 3300005719 Bacteria 2261
175 Ga0068861_100172657 3300005719 Bacteria 1793
176 Ga0068870_10009275 3300005840 Bacteria 4467
177 Ga0068870_10016453 3300005840 Bacteria 3533
178 Ga0068870_10019035 3300005840 Bacteria 3325
179 Ga0068870_10087912 3300005840 Bacteria 1731
180 Ga0068870_10095457 3300005840 Bacteria 1670
181 Ga0068863_100002518 3300005841 Bacteria 18195
182 Ga0068863_100049491 3300005841 Unclassified 3985
183 Ga0068863_100087402 3300005841 Unclassified 2953
184 Ga0068863_100273520 3300005841 Bacteria 1635
185 Ga0068858_100000051 3300005842 Bacteria 120692
186 Ga0068858_100032061 3300005842 Bacteria 4881
187 Ga0068858_100036430 3300005842 Bacteria 4562
188 Ga0068858_100037723 3300005842 Bacteria 4482
189 Ga0068858_100056164 3300005842 Bacteria 3640
190 Ga0068858_100064783 3300005842 Bacteria 3383
191 Ga0068858_100105427 3300005842 Bacteria 2630
192 Ga0068860_100004608 3300005843 Bacteria 14080
193 Ga0068860_100033973 3300005843 Bacteria 4892
194 Ga0068860_100083407 3300005843 Unclassified 3040
195 Ga0068860_100133743 3300005843 Unclassified 2381
196 Ga0068862_100017072 3300005844 Bacteria 6039
197 Ga0068862_100054480 3300005844 Unclassified 3425
198 Ga0068862_100076193 3300005844 Bacteria 2903
199 Ga0068862_100151114 3300005844 Bacteria 2067
200 Ga0068862_100201585 3300005844 Bacteria 1794
201 Ga0081539_10000067 3300005985 Bacteria 246361
202 Ga0081539_10000614 3300005985 Bacteria 72137
203 Ga0081539_10001333 3300005985 Bacteria 43002
204 Ga0081539_10002601 3300005985 Bacteria 24748
205 Ga0070715_10000025 3300006163 Bacteria 107539
206 Ga0070716_100000003 3300006173 Bacteria 312721
207 Ga0097621_100002325 3300006237 Bacteria 13032
208 Ga0097621_100110046 3300006237 Bacteria 2327
209 Ga0068871_100008480 3300006358 Bacteria 7393
210 Ga0068871_100058241 3300006358 Bacteria 3145
211 Ga0068871_100062161 3300006358 Bacteria 3051
212 Ga0075428_100005095 3300006844 Bacteria 14602
213 Ga0075428_100018896 3300006844 Bacteria 7622
214 Ga0075428_100083310 3300006844 Bacteria 3489
215 Ga0075428_100115314 3300006844 Bacteria 2926
216 Ga0075428_100175343 3300006844 Bacteria 2322
217 Ga0075428_100226529 3300006844 Unclassified 2018
218 Ga0075430_100074776 3300006846 Unclassified 2840
219 Ga0075433_10001433 3300006852 Bacteria 17582
220 Ga0075433_10011848 3300006852 Bacteria 7024
221 Ga0075433_10013192 3300006852 Bacteria 6708
222 Ga0075433_10042504 3300006852 Unclassified 3944
223 Ga0075433_10058923 3300006852 Bacteria 3359
224 Ga0075433_10083894 3300006852 Bacteria 2812
225 Ga0075433_10085679 3300006852 Bacteria 2781
226 Ga0075433_10128731 3300006852 Bacteria 2249
227 Ga0075433_10136870 3300006852 Bacteria 2177
228 Ga0075434_100000390 3300006871 Bacteria 32102
229 Ga0075434_100003485 3300006871 Bacteria 14071
230 Ga0075434_100006476 3300006871 Bacteria 10734
231 Ga0075434_100201085 3300006871 Bacteria 2012
232 Ga0075434_100220687 3300006871 Bacteria 1915
233 Ga0075429_100008602 3300006880 Bacteria 8878
234 Ga0075429_100029032 3300006880 Bacteria 4803
235 Ga0075429_100031336 3300006880 Bacteria 4621
236 Ga0075429_100039075 3300006880 Bacteria 4131
237 Ga0075429_100072309 3300006880 Bacteria 3003
238 Ga0068865_100010926 3300006881 Bacteria 5667
239 Ga0075436_100000002 3300006914 Bacteria 475522
240 Ga0075436_100001719 3300006914 Bacteria 14992
241 Ga0097620_100000232 3300006931 Bacteria 54896
242 Ga0097620_100001031 3300006931 Bacteria 28545
243 Ga0097620_100004693 3300006931 Bacteria 13906
244 Ga0097620_100016624 3300006931 Bacteria 7386
245 Ga0097620_100028195 3300006931 Bacteria 5629
246 Ga0097620_100034237 3300006931 Bacteria 5099
247 Ga0097620_100040203 3300006931 Bacteria 4694
248 Ga0097620_100050915 3300006931 Bacteria 4161
249 Ga0075435_100005602 3300007076 Bacteria 8793
250 Ga0075435_100040566 3300007076 Unclassified 3718
251 Ga0099794_10036049 3300007265 Bacteria 2336
252 Ga0105240_10031817 3300009093 Bacteria 6836
253 Ga0105240_10153747 3300009093 Bacteria 2738
254 Ga0111539_10000140 3300009094 Bacteria 82527
255 Ga0111539_10000155 3300009094 Bacteria 78151
256 Ga0111539_10001668 3300009094 Bacteria 29647
257 Ga0111539_10015540 3300009094 Bacteria 9464
258 Ga0111539_10017779 3300009094 Bacteria 8802
259 Ga0111539_10037073 3300009094 Bacteria 5891
260 Ga0111539_10037648 3300009094 Bacteria 5840
261 Ga0111539_10064865 3300009094 Bacteria 4318
262 Ga0111539_10077608 3300009094 Bacteria 3909
263 Ga0111539_10230592 3300009094 Bacteria 2156
264 Ga0111539_10265507 3300009094 Bacteria 1998
265 Ga0105245_10015683 3300009098 Bacteria 6606
266 Ga0105247_10000004 3300009101 Bacteria 455497
267 Ga0114129_10000090 3300009147 Bacteria 86472
268 Ga0114129_10000618 3300009147 Bacteria 44064
269 Ga0114129_10002938 3300009147 Bacteria 23853
270 Ga0114129_10012668 3300009147 Bacteria 12007
271 Ga0114129_10017765 3300009147 Bacteria 10128
272 Ga0114129_10030304 3300009147 Bacteria 7657
273 Ga0114129_10039653 3300009147 Bacteria 6641
274 Ga0114129_10050497 3300009147 Bacteria 5841
275 Ga0114129_10053334 3300009147 Bacteria 5671
276 Ga0114129_10090224 3300009147 Bacteria 4248
277 Ga0114129_10149755 3300009147 Bacteria 3194
278 Ga0114129_10186624 3300009147 Bacteria 2818
279 Ga0114129_10194573 3300009147 Bacteria 2751
280 Ga0105243_10000037 3300009148 Bacteria 175237
281 Ga0105243_10002693 3300009148 Bacteria 14758
282 Ga0105243_10021777 3300009148 Bacteria 4867
283 Ga0105243_10023739 3300009148 Bacteria 4674
284 Ga0105243_10038787 3300009148 Bacteria 3711
285 Ga0105243_10187892 3300009148 Bacteria 1802
286 Ga0105241_10098172 3300009174 Bacteria 2324
287 Ga0105241_10178426 3300009174 Bacteria 1760
288 Ga0105242_10001013 3300009176 Bacteria 22070
289 Ga0105242_10003928 3300009176 Bacteria 11551
290 Ga0105242_10102935 3300009176 Bacteria 2422
291 Ga0105242_10122127 3300009176 Unclassified 2237
292 Ga0105248_10018980 3300009177 Bacteria 7602
293 Ga0105248_10140779 3300009177 Unclassified 2721
294 Ga0105248_10275884 3300009177 Bacteria 1893
295 Ga0105248_10405535 3300009177 Unclassified 1535
296 Ga0105237_10130887 3300009545 Unclassified 2503
297 Ga0105238_10013295 3300009551 Bacteria 8306
298 Ga0105238_10038629 3300009551 Bacteria 4847
299 Ga0105249_10000136 3300009553 Bacteria 96659
300 Ga0105249_10002115 3300009553 Bacteria 17250
301 Ga0105249_10013820 3300009553 Bacteria 7133
302 Ga0105249_10017652 3300009553 Bacteria 6337
303 Ga0105249_10058018 3300009553 Bacteria 3548
304 Ga0105249_10131312 3300009553 Bacteria 2391
305 Ga0105249_10199917 3300009553 Bacteria 1955
306 Ga0105239_10043633 3300010375 Bacteria 4917
307 Ga0105239_10329991 3300010375 Bacteria 1721
308 Ga0105246_10031954 3300011119 Bacteria 3487
309 Ga0105246_10254409 3300011119 Archaea 1396
310 Ga0157373_10002757 3300013100 Bacteria 13289
311 Ga0157373_10073086 3300013100 Bacteria 2420
312 Ga0157374_10164387 3300013296 Bacteria 2163
313 Ga0157378_10000004 3300013297 Bacteria 201051
314 Ga0157378_10001819 3300013297 Bacteria 19122
315 Ga0157378_10012428 3300013297 Bacteria 7456
316 Ga0157378_10019632 3300013297 Bacteria 5941
317 Ga0157378_10022839 3300013297 Bacteria 5505
318 Ga0157378_10032699 3300013297 Bacteria 4597
319 Ga0157378_10056817 3300013297 Bacteria 3488
320 Ga0157378_10060262 3300013297 Bacteria 3387
321 Ga0157378_10259768 3300013297 Bacteria 1666
322 Ga0163162_10000001 3300013306 Bacteria 751833
323 Ga0163162_10006022 3300013306 Bacteria 11738
324 Ga0163162_10091360 3300013306 Unclassified 3127
325 Ga0157372_10121998 3300013307 Bacteria 2994
326 Ga0157372_10245011 3300013307 Bacteria 2080
327 Ga0157375_10000479 3300013308 Bacteria 36426
328 Ga0157375_10009751 3300013308 Bacteria 8444
329 Ga0157375_10010051 3300013308 Bacteria 8320
330 Ga0157375_10043350 3300013308 Bacteria 4363
331 Ga0157375_10063344 3300013308 Unclassified 3678
332 Ga0157375_10236400 3300013308 Bacteria 1986
333 Ga0163163_10000172 3300014325 Bacteria 67754
334 Ga0163163_10007063 3300014325 Bacteria 9870
335 Ga0163163_10018637 3300014325 Bacteria 6502
336 Ga0163163_10024520 3300014325 Bacteria 5741
337 Ga0163163_10041530 3300014325 Bacteria 4498
338 Ga0163163_10197229 3300014325 Bacteria 2061
339 Ga0163163_10233341 3300014325 Bacteria 1889
340 Ga0157380_10001650 3300014326 Bacteria 14700
341 Ga0157380_10011393 3300014326 Bacteria 6425
342 Ga0157380_10047165 3300014326 Bacteria 3387
343 Ga0157380_10050668 3300014326 Bacteria 3280
344 Ga0157380_10105941 3300014326 Unclassified 2352
345 Ga0157377_10031672 3300014745 Bacteria 2875
346 Ga0157377_10059093 3300014745 Bacteria 2184
347 Ga0157379_10020546 3300014968 Bacteria 5841
348 Ga0157379_10087323 3300014968 Bacteria 2796
349 Ga0163161_10013806 3300017792 Bacteria 5626
350 Ga0163161_10020028 3300017792 Bacteria 4693
351 Ga0163161_10106196 3300017792 Bacteria 2095
352 Ga0207672_1000002 3300025223 Bacteria 31879
353 Ga0207697_10001069 3300025315 Bacteria 15123
354 Ga0207697_10006224 3300025315 Bacteria 5426
355 Ga0207653_10000163 3300025885 Bacteria 47337
356 Ga0207682_10038034 3300025893 Bacteria 1951
357 Ga0207642_10006126 3300025899 Bacteria 3979
358 Ga0207710_10000002 3300025900 Bacteria 1251998
359 Ga0207688_10000655 3300025901 Bacteria 17084
360 Ga0207647_10009657 3300025904 Bacteria 6851
361 Ga0207685_10000008 3300025905 Bacteria 273136
362 Ga0207645_10047455 3300025907 Bacteria 2743
363 Ga0207643_10001473 3300025908 Bacteria 13518
364 Ga0207643_10001553 3300025908 Bacteria 13094
365 Ga0207643_10012169 3300025908 Bacteria 4651
366 Ga0207684_10007146 3300025910 Bacteria 10089
367 Ga0207684_10020542 3300025910 Bacteria 5642
368 Ga0207684_10039653 3300025910 Bacteria 3993
369 Ga0207684_10128442 3300025910 Bacteria 2175
370 Ga0207684_10131081 3300025910 Bacteria 2151
371 Ga0207654_10011849 3300025911 Unclassified 4455
372 Ga0207707_10000006 3300025912 Bacteria 374131
373 Ga0207707_10021022 3300025912 Bacteria 5700
374 Ga0207707_10150547 3300025912 Bacteria 2034
375 Ga0207695_10033246 3300025913 Bacteria 5629
376 Ga0207660_10000124 3300025917 Bacteria 45248
377 Ga0207662_10018445 3300025918 Bacteria 3960
378 Ga0207662_10030137 3300025918 Bacteria 3147
379 Ga0207662_10045163 3300025918 Bacteria 2604
380 Ga0207652_10000517 3300025921 Bacteria 39157
381 Ga0207646_10000543 3300025922 Bacteria 49799
382 Ga0207646_10022511 3300025922 Bacteria 5806
383 Ga0207646_10055587 3300025922 Bacteria 3539
384 Ga0207646_10125026 3300025922 Unclassified 2312
385 Ga0207646_10206537 3300025922 Unclassified 1774
386 Ga0207681_10001192 3300025923 Bacteria 16734
387 Ga0207681_10003950 3300025923 Bacteria 9195
388 Ga0207681_10021745 3300025923 Unclassified 4082
389 Ga0207681_10073677 3300025923 Bacteria 2389
390 Ga0207681_10131014 3300025923 Bacteria 1854
391 Ga0207694_10010071 3300025924 Bacteria 7125
392 Ga0207694_10080746 3300025924 Bacteria 2553
393 Ga0207650_10000001 3300025925 Bacteria 1545726
394 Ga0207650_10002020 3300025925 Bacteria 14203
395 Ga0207650_10004680 3300025925 Bacteria 9351
396 Ga0207650_10065750 3300025925 Bacteria 2718
397 Ga0207650_10087523 3300025925 Bacteria 2374
398 Ga0207650_10106214 3300025925 Bacteria 2168
399 Ga0207659_10001576 3300025926 Bacteria 13521
400 Ga0207659_10007898 3300025926 Bacteria 6578
401 Ga0207659_10008836 3300025926 Bacteria 6278
402 Ga0207659_10010519 3300025926 Bacteria 5816
403 Ga0207659_10039733 3300025926 Bacteria 3284
404 Ga0207659_10202207 3300025926 Bacteria 1587
405 Ga0207644_10000179 3300025931 Bacteria 45397
406 Ga0207644_10100301 3300025931 Bacteria 2174
407 Ga0207644_10151243 3300025931 Bacteria 1796
408 Ga0207690_10101956 3300025932 Bacteria 2051
409 Ga0207690_10122641 3300025932 Bacteria 1890
410 Ga0207706_10071070 3300025933 Unclassified 3061
411 Ga0207706_10215850 3300025933 Bacteria 1681
412 Ga0207686_10000003 3300025934 Bacteria 376934
413 Ga0207686_10014087 3300025934 Unclassified 4442
414 Ga0207709_10000017 3300025935 Bacteria 470753
415 Ga0207709_10003560 3300025935 Bacteria 9208
416 Ga0207709_10020202 3300025935 Bacteria 3754
417 Ga0207709_10076425 3300025935 Bacteria 2143
418 Ga0207670_10000293 3300025936 Bacteria 30293
419 Ga0207670_10002977 3300025936 Bacteria 8945
420 Ga0207670_10040201 3300025936 Bacteria 3068
421 Ga0207670_10042908 3300025936 Bacteria 2984
422 Ga0207670_10154405 3300025936 Bacteria 1707
423 Ga0207704_10114880 3300025938 Bacteria 1828
424 Ga0207665_10000003 3300025939 Bacteria 220666
425 Ga0207665_10013668 3300025939 Bacteria 5340
426 Ga0207691_10001073 3300025940 Bacteria 27194
427 Ga0207691_10002338 3300025940 Bacteria 18568
428 Ga0207691_10146569 3300025940 Bacteria 2078
429 Ga0207711_10030145 3300025941 Bacteria 4575
430 Ga0207711_10043325 3300025941 Unclassified 3838
431 Ga0207711_10105857 3300025941 Unclassified 2495
432 Ga0207711_10278604 3300025941 Bacteria 1540
433 Ga0207689_10016936 3300025942 Bacteria 6166
434 Ga0207689_10079018 3300025942 Bacteria 2704
435 Ga0207679_10001508 3300025945 Bacteria 14562
436 Ga0207679_10013504 3300025945 Bacteria 5354
437 Ga0207679_10024680 3300025945 Bacteria 4124
438 Ga0207679_10131335 3300025945 Bacteria 2010
439 Ga0207679_10135457 3300025945 Bacteria 1983
440 Ga0207651_10022531 3300025960 Bacteria 3853
441 Ga0207651_10023628 3300025960 Bacteria 3786
442 Ga0207651_10039540 3300025960 Bacteria 3111
443 Ga0207712_10000092 3300025961 Bacteria 103502
444 Ga0207712_10001316 3300025961 Bacteria 17028
445 Ga0207712_10042625 3300025961 Bacteria 3127
446 Ga0207712_10096586 3300025961 Bacteria 2187
447 Ga0207677_10047340 3300026023 Bacteria 2886
448 Ga0207703_10000114 3300026035 Bacteria 96051
449 Ga0207703_10027628 3300026035 Bacteria 4467
450 Ga0207703_10038520 3300026035 Bacteria 3816
451 Ga0207703_10048450 3300026035 Bacteria 3430
452 Ga0207703_10066432 3300026035 Bacteria 2967
453 Ga0207703_10109336 3300026035 Bacteria 2356
454 Ga0207703_10195954 3300026035 Bacteria 1792
455 Ga0207703_10213351 3300026035 Bacteria 1722
456 Ga0207703_10313666 3300026035 Bacteria 1434
457 Ga0207639_10047062 3300026041 Bacteria 3258
458 Ga0207708_10000061 3300026075 Bacteria 92741
459 Ga0207708_10003750 3300026075 Bacteria 11198
460 Ga0207708_10007717 3300026075 Bacteria 7966
461 Ga0207708_10008864 3300026075 Bacteria 7446
462 Ga0207708_10015579 3300026075 Bacteria 5700
463 Ga0207708_10021804 3300026075 Bacteria 4833
464 Ga0207708_10049853 3300026075 Bacteria 3188
465 Ga0207708_10062504 3300026075 Bacteria 2845
466 Ga0207641_10042420 3300026088 Unclassified 3817
467 Ga0207641_10053703 3300026088 Bacteria 3416
468 Ga0207641_10053775 3300026088 Bacteria 3415
469 Ga0207641_10160596 3300026088 Bacteria 2043
470 Ga0207648_10000198 3300026089 Bacteria 63567
471 Ga0207648_10019380 3300026089 Bacteria 6141
472 Ga0207648_10030025 3300026089 Unclassified 4820
473 Ga0207648_10065461 3300026089 Bacteria 3169
474 Ga0207648_10085888 3300026089 Bacteria 2745
475 Ga0207648_10276191 3300026089 Bacteria 1502
476 Ga0207676_10013542 3300026095 Bacteria 5855
477 Ga0207676_10085370 3300026095 Bacteria 2576
478 Ga0207676_10173177 3300026095 Bacteria 1882
479 Ga0207676_10254246 3300026095 Bacteria 1583
480 Ga0207676_10282788 3300026095 Bacteria 1507
481 Ga0207674_10000391 3300026116 Bacteria 56809
482 Ga0207674_10022424 3300026116 Bacteria 6780
483 Ga0207674_10025098 3300026116 Bacteria 6361
484 Ga0207674_10054802 3300026116 Bacteria 4058
485 Ga0207674_10142023 3300026116 Bacteria 2360
486 Ga0207674_10159062 3300026116 Bacteria 2214
487 Ga0207675_100001562 3300026118 Bacteria 22957
488 Ga0207675_100002633 3300026118 Bacteria 17724
489 Ga0207675_100004195 3300026118 Bacteria 13950
490 Ga0207675_100020228 3300026118 Bacteria 6205
491 Ga0207675_100024330 3300026118 Bacteria 5632
492 Ga0207675_100163753 3300026118 Bacteria 2123
493 Ga0207675_100228659 3300026118 Bacteria 1794
494 Ga0207675_100235753 3300026118 Bacteria 1767
495 Ga0207675_100281738 3300026118 Bacteria 1615
496 Ga0207683_10008527 3300026121 Bacteria 8772
497 Ga0207683_10065549 3300026121 Bacteria 3202
498 Ga0207683_10124355 3300026121 Bacteria 2317
499 Ga0207698_10104523 3300026142 Bacteria 2357
500 Ga0207428_10000743 3300027907 Bacteria 37326
501 Ga0207428_10000850 3300027907 Bacteria 34425
502 Ga0207428_10001780 3300027907 Bacteria 22062
503 Ga0207428_10001878 3300027907 Bacteria 21392
504 Ga0207428_10002782 3300027907 Bacteria 17368
505 Ga0207428_10009032 3300027907 Bacteria 8975
506 Ga0207428_10013700 3300027907 Bacteria 7071
507 Ga0207428_10021724 3300027907 Bacteria 5429
508 Ga0207428_10075834 3300027907 Bacteria 2635
509 Ga0268265_10101368 3300028380 Bacteria 2326
510 Ga0268265_10290447 3300028380 Bacteria 1467
511 Ga0268264_10005447 3300028381 Bacteria 10782
512 Ga0268264_10316907 3300028381 Bacteria 1473
513 Ga0307410_10002981 3300031852 Bacteria 8355
514 Ga0307406_10016376 3300031901 Bacteria 4308
515 Ga0307406_10020257 3300031901 Bacteria 3914
516 Ga0307412_10017758 3300031911 Bacteria 4263
517 Ga0307412_10038816 3300031911 Unclassified 3069
518 Ga0307409_100076051 3300031995 Bacteria 2691
519 Ga0307409_100382422 3300031995 Bacteria 1339
520 Ga0307416_100003105 3300032002 Bacteria 9723
521 Ga0307416_100013056 3300032002 Bacteria 5630
522 Ga0307414_10014119 3300032004 Bacteria 4774
523 Ga0307411_10006049 3300032005 Bacteria 6017
524 Ga0307415_100002999 3300032126 Bacteria 8496
525 Ga0307415_100007605 3300032126 Bacteria 5938
526 Ga0373946_0013645 3300035171 Bacteria 3056
527 Ga0373924_0000558 3300035410 Bacteria 11455
528 Ga0373935_0099140 3300035692 Bacteria 1918
529 Ga0373947_0013606 3300035725 Bacteria 4662
530 Ga0373937_0180527 3300036401 Bacteria 1982
531 Ga0373925_0089048 3300037068 Bacteria 2357
532 Ga0395899_0177760 3300037312 Bacteria 1496
533 Ga0395905_0124218 3300037471 Bacteria 2427
534 Ga0395901_0062871 3300038443 Bacteria 3863
535 Ga0395901_0424536 3300038443 Bacteria 1363
536 Ga0436365_1311852 3300039437 Bacteria 65317
537 Ga0439446_0009991 3300042156 Bacteria 2549
538 Ga0439446_0022889 3300042156 Bacteria 1774
539 Ga0439458_0009498 3300042157 Bacteria 2166
540 Ga0451576_0103053 3300045051 Bacteria 2968
541 Ga0451576_0238818 3300045051 Bacteria 1898
542 Ga0495662_0062973 3300046476 Bacteria 1792
543 Ga0495630_0124710 3300046517 Bacteria 1954
544 Ga0495643_0006534 3300046522 Bacteria 7670
545 Ga0495663_0000584 3300046525 Bacteria 12778
546 Ga0495598_0000117 3300046537 Bacteria 13212
547 Ga0495621_0000086 3300046539 Bacteria 19252
548 Ga0495656_0006465 3300046615 Bacteria 4114
549 Ga0495658_0029002 3300046683 Bacteria 2991
550 Ga0495674_0104558 3300047319 Bacteria 2407
551 Ga0495672_0021628 3300047320 Bacteria 4193
552 Ga0495684_0000307 3300047471 Bacteria 39937
553 Ga0496102_0214674 3300048905 Bacteria 1813
554 Ga0496106_0001061 3300048909 Bacteria 20265
555 Ga0496108_0159000 3300048911 Unclassified 1952
556 Ga0496109_0012325 3300048912 Bacteria 7381
557 Ga0496113_0036874 3300048916 Bacteria 3584
558 Ga0501036_0034345 3300049572 Bacteria 4290
559 Ga0501038_0004636 3300049574 Bacteria 12793
560 Ga0501042_0017581 3300049578 Bacteria 4934
561 Ga0501072_0050917 3300049588 Bacteria 3261
562 Ga0501074_0068363 3300049590 Bacteria 2554
563 Ga0501076_0048772 3300049592 Bacteria 3346
564 Ga0501202_019190 3300049652 Unclassified 1349
565 Ga0501217_002428 3300049661 Bacteria 3668
566 Ga0501217_003997 3300049661 Bacteria 3013
567 Ga0501223_003647 3300049663 Bacteria 3328
568 Ga0501223_004378 3300049663 Bacteria 3028
569 Ga0501224_002304 3300049664 Bacteria 2585
570 Ga0501227_003573 3300049665 Unclassified 3368
571 Ga0501233_003064 3300049668 Bacteria 2987
572 Ga0501273_002233 3300049770 Unclassified 1955
573 nmdc:mga05p37_154568_c1 3300050507 Bacteria 2804
574 nmdc:mga05p37_24282_c1 3300050507 Bacteria 7366
575 nmdc:mga05p37_25787_c1 3300050507 Bacteria 7148
576 nmdc:mga05p37_39109_c1 3300050507 Bacteria 5820
577 nmdc:mga05p37_59716_c1 3300050507 Bacteria 4695
578 nmdc:mga05p37_65328_c1 3300050507 Bacteria 4476
579 nmdc:mga05p37_65943_c1 3300050507 Bacteria 4454
580 nmdc:mga05p37_75342_c1 3300050507 Bacteria 4153
581 nmdc:mga05p37_7696_c1 3300050507 Bacteria 12714
582 nmdc:mga09592_17624_c1 3300050508 Bacteria 5852
583 nmdc:mga09592_38447_c1 3300050508 Bacteria 4017
584 nmdc:mga09592_6165_c1 3300050508 Bacteria 9761
585 nmdc:mga0qj67_108001_c1 3300050509 Bacteria 2245
586 nmdc:mga0qj67_113003_c1 3300050509 Bacteria 2193
587 nmdc:mga0qj67_63229_c1 3300050509 Bacteria 2943
588 nmdc:mga08y16_103011_c1 3300050511 Bacteria 2972
589 nmdc:mga08y16_16894_c1 3300050511 Bacteria 7684
590 nmdc:mga08y16_172948_c1 3300050511 Bacteria 2243
591 nmdc:mga08y16_193377_c1 3300050511 Bacteria 2110
592 nmdc:mga08y16_26156_c1 3300050511 Bacteria 6155
593 nmdc:mga08y16_2721_c1 3300050511 Bacteria 18133
594 nmdc:mga08y16_286704_c1 3300050511 Unclassified 1698
595 nmdc:mga08y16_3877_c1 3300050511 Bacteria 15561
596 nmdc:mga08y16_498_c1 3300050511 Bacteria 36164
597 nmdc:mga08y16_60893_c1 3300050511 Bacteria 3942
598 nmdc:mga08y16_786_c1 3300050511 Bacteria 30268
599 nmdc:mga0n895_10497_c1 3300050512 Bacteria 8191
600 nmdc:mga0n895_109375_c1 3300050512 Bacteria 2779
601 nmdc:mga0n895_114576_c1 3300050512 Bacteria 2714
602 nmdc:mga0n895_187020_c1 3300050512 Bacteria 2102
603 nmdc:mga0n895_22835_c1 3300050512 Bacteria 5868
604 nmdc:mga0n895_70704_c1 3300050512 Bacteria 3459
605 nmdc:mga0n895_87829_c1 3300050512 Bacteria 3107
606 nmdc:mga0rr50_3767_c1 3300050513 Bacteria 8793
607 nmdc:mga08x19_17210_c1 3300050514 Bacteria 4420
608 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
609 nmdc:mga0a205_1338_c1 3300050515 Bacteria 20784
610 nmdc:mga0a205_162038_c1 3300050515 Bacteria 2133
611 nmdc:mga0a205_1962_c1 3300050515 Bacteria 17909
612 nmdc:mga0a205_48921_c1 3300050515 Bacteria 4081
613 nmdc:mga0a205_598_c1 3300050515 Bacteria 28678
614 Ga0495601_0007990 3300053077 Bacteria 6231
615 Ga0495619_0120742 3300053085 Bacteria 1797
616 Ga0501082_0083028 3300060353 Bacteria 2764
617 Ga0530510_0045623 3300061734 Bacteria 3166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100005095 Ga0075428_10000509513 402
2 3300006852 Ga0075433_10085679 Ga0075433_100856793 402
3 3300009147 Ga0114129_10000090 Ga0114129_1000009069 402
4 3300050507 nmdc:mga05p37_24282_c1 nmdc:mga05p37_24282_c1_3331_4608 402
5 3300050512 nmdc:mga0n895_22835_c1 nmdc:mga0n895_22835_c1_1938_3215 402
6 3300050515 nmdc:mga0a205_162038_c1 nmdc:mga0a205_162038_c1_381_1658 402
7 3300003203 JGI25406J46586_10003112 JGI25406J46586_100031127 403
8 3300005985 Ga0081539_10000067 Ga0081539_10000067163 403
9 3300005441 Ga0070700_100012944 Ga0070700_1000129442 404
10 3300006852 Ga0075433_10128731 Ga0075433_101287313 405
11 3300009147 Ga0114129_10012668 Ga0114129_100126682 405
12 3300027907 Ga0207428_10009032 Ga0207428_100090324 406
13 3300005337 Ga0070682_100019081 Ga0070682_1000190812 407
14 3300005441 Ga0070700_100028122 Ga0070700_1000281222 407
15 3300005518 Ga0070699_100090207 Ga0070699_1000902072 407
16 3300005615 Ga0070702_100118984 Ga0070702_1001189842 407
17 3300007076 Ga0075435_100040566 Ga0075435_1000405663 407
18 3300009147 Ga0114129_10030304 Ga0114129_100303044 407
19 3300009147 Ga0114129_10050497 Ga0114129_100504972 407
20 3300014326 Ga0157380_10050668 Ga0157380_100506685 407
21 3300038443 Ga0395901_0424536 Ga0395901_0424536_20_1258 407
22 3300009094 Ga0111539_10000140 Ga0111539_1000014051 409
23 3300050511 nmdc:mga08y16_786_c1 nmdc:mga08y16_786_c1_5893_7200 409
24 3300005444 Ga0070694_100054537 Ga0070694_1000545371 410
25 3300009094 Ga0111539_10015540 Ga0111539_1001554010 410
26 3300009553 Ga0105249_10017652 Ga0105249_100176526 410
27 3300013306 Ga0163162_10006022 Ga0163162_1000602212 410
28 3300014968 Ga0157379_10087323 Ga0157379_100873235 410
29 3300045051 Ga0451576_0103053 Ga0451576_0103053_820_2073 410
30 3300050508 nmdc:mga09592_6165_c1 nmdc:mga09592_6165_c1_2537_3790 410
31 3300050511 nmdc:mga08y16_60893_c1 nmdc:mga08y16_60893_c1_132_1385 410
32 3300050512 nmdc:mga0n895_109375_c1 nmdc:mga0n895_109375_c1_1275_2528 410
33 3300050515 nmdc:mga0a205_1962_c1 nmdc:mga0a205_1962_c1_11232_12485 410
34 3300005340 Ga0070689_100017917 Ga0070689_1000179172 412
35 3300005618 Ga0068864_100124151 Ga0068864_1001241511 412
36 3300005842 Ga0068858_100064783 Ga0068858_1000647833 412
37 3300009148 Ga0105243_10000037 Ga0105243_1000003742 412
38 3300009176 Ga0105242_10003928 Ga0105242_100039289 412
39 3300025934 Ga0207686_10000003 Ga0207686_10000003231 412
40 3300025935 Ga0207709_10000017 Ga0207709_10000017290 412
41 3300025936 Ga0207670_10040201 Ga0207670_100402013 412
42 3300026035 Ga0207703_10313666 Ga0207703_103136661 412
43 3300026088 Ga0207641_10160596 Ga0207641_101605961 412
44 3300028381 Ga0268264_10316907 Ga0268264_103169071 412
45 3300005406 Ga0070703_10000049 Ga0070703_100000497 414
46 3300005441 Ga0070700_100001704 Ga0070700_10000170413 414
47 3300005518 Ga0070699_100205819 Ga0070699_1002058191 414
48 3300025885 Ga0207653_10000163 Ga0207653_1000016340 414
49 3300026075 Ga0207708_10008864 Ga0207708_100088646 414
50 3300005293 Ga0065715_10091894 Ga0065715_100918942 415
51 3300005345 Ga0070692_10062411 Ga0070692_100624112 415
52 3300005467 Ga0070706_100105842 Ga0070706_1001058421 415
53 3300005539 Ga0068853_100038122 Ga0068853_1000381224 415
54 3300009551 Ga0105238_10038629 Ga0105238_100386292 415
55 3300025904 Ga0207647_10009657 Ga0207647_100096572 415
56 3300025922 Ga0207646_10022511 Ga0207646_100225117 415
57 3300025924 Ga0207694_10010071 Ga0207694_100100712 415
58 3300026075 Ga0207708_10021804 Ga0207708_100218042 415
59 3300005354 Ga0070675_100000193 Ga0070675_1000001931 417
60 3300005365 Ga0070688_100002654 Ga0070688_1000026547 417
61 3300007265 Ga0099794_10036049 Ga0099794_100360492 417
62 3300009147 Ga0114129_10186624 Ga0114129_101866243 417
63 3300046517 Ga0495630_0124710 Ga0495630_0124710_28_1281 417
64 3300050507 nmdc:mga05p37_154568_c1 nmdc:mga05p37_154568_c1_1203_2462 417
65 3300005330 Ga0070690_100145023 Ga0070690_1001450231 418
66 3300005334 Ga0068869_100065738 Ga0068869_1000657385 418
67 3300005364 Ga0070673_100084377 Ga0070673_1000843772 418
68 3300005365 Ga0070688_100064911 Ga0070688_1000649111 418
69 3300005543 Ga0070672_100028360 Ga0070672_1000283602 418
70 3300005544 Ga0070686_100086483 Ga0070686_1000864832 418
71 3300005548 Ga0070665_100318408 Ga0070665_1003184081 418
72 3300005564 Ga0070664_100011008 Ga0070664_1000110085 418
73 3300005577 Ga0068857_100167290 Ga0068857_1001672902 418
74 3300005615 Ga0070702_100105759 Ga0070702_1001057591 418
75 3300005617 Ga0068859_100034234 Ga0068859_1000342344 418
76 3300005840 Ga0068870_10016453 Ga0068870_100164535 418
77 3300005840 Ga0068870_10019035 Ga0068870_100190354 418
78 3300006852 Ga0075433_10001433 Ga0075433_1000143318 418
79 3300006871 Ga0075434_100006476 Ga0075434_10000647611 418
80 3300006880 Ga0075429_100031336 Ga0075429_1000313365 418
81 3300006931 Ga0097620_100034237 Ga0097620_1000342374 418
82 3300025315 Ga0207697_10001069 Ga0207697_100010692 418
83 3300025893 Ga0207682_10038034 Ga0207682_100380342 418
84 3300025908 Ga0207643_10012169 Ga0207643_100121696 418
85 3300025923 Ga0207681_10073677 Ga0207681_100736772 418
86 3300025940 Ga0207691_10002338 Ga0207691_1000233818 418
87 3300025942 Ga0207689_10079018 Ga0207689_100790185 418
88 3300025960 Ga0207651_10023628 Ga0207651_100236285 418
89 3300026023 Ga0207677_10047340 Ga0207677_100473402 418
90 3300026116 Ga0207674_10025098 Ga0207674_100250987 418
91 3300026116 Ga0207674_10142023 Ga0207674_101420233 418
92 3300026118 Ga0207675_100235753 Ga0207675_1002357532 418
93 3300005293 Ga0065715_10102700 Ga0065715_101027001 419
94 3300005330 Ga0070690_100119923 Ga0070690_1001199231 419
95 3300005340 Ga0070689_100003322 Ga0070689_1000033222 419
96 3300005364 Ga0070673_100043300 Ga0070673_1000433004 419
97 3300005364 Ga0070673_100268589 Ga0070673_1002685891 419
98 3300005544 Ga0070686_100046589 Ga0070686_1000465892 419
99 3300005549 Ga0070704_100136766 Ga0070704_1001367662 419
100 3300005618 Ga0068864_100060210 Ga0068864_1000602102 419
101 3300005843 Ga0068860_100133743 Ga0068860_1001337431 419
102 3300009094 Ga0111539_10265507 Ga0111539_102655072 419
103 3300009177 Ga0105248_10275884 Ga0105248_102758841 419
104 3300013297 Ga0157378_10056817 Ga0157378_100568172 419
105 3300025936 Ga0207670_10042908 Ga0207670_100429082 419
106 3300025960 Ga0207651_10039540 Ga0207651_100395402 419
107 3300026035 Ga0207703_10213351 Ga0207703_102133511 419
108 3300026089 Ga0207648_10065461 Ga0207648_100654612 419
109 3300026095 Ga0207676_10085370 Ga0207676_100853702 419
110 3300026116 Ga0207674_10159062 Ga0207674_101590622 419
111 3300027907 Ga0207428_10075834 Ga0207428_100758343 419
112 3300031995 Ga0307409_100382422 Ga0307409_1003824221 419
113 3300036401 Ga0373937_0180527 Ga0373937_0180527_317_1597 419
114 3300050511 nmdc:mga08y16_103011_c1 nmdc:mga08y16_103011_c1_213_1472 419
115 3300050511 nmdc:mga08y16_193377_c1 nmdc:mga08y16_193377_c1_143_1402 419
116 3300005365 Ga0070688_100010408 Ga0070688_1000104083 420
117 3300005617 Ga0068859_100004693 Ga0068859_1000046938 420
118 3300005719 Ga0068861_100172657 Ga0068861_1001726572 420
119 3300006852 Ga0075433_10083894 Ga0075433_100838942 420
120 3300006871 Ga0075434_100201085 Ga0075434_1002010852 420
121 3300006931 Ga0097620_100004693 Ga0097620_1000046938 420
122 3300049572 Ga0501036_0034345 Ga0501036_0034345_1945_3261 420
123 3300049578 Ga0501042_0017581 Ga0501042_0017581_2005_3330 420
124 3300049588 Ga0501072_0050917 Ga0501072_0050917_1232_2557 420
125 3300049592 Ga0501076_0048772 Ga0501076_0048772_1147_2463 420
126 3300050511 nmdc:mga08y16_172948_c1 nmdc:mga08y16_172948_c1_399_1709 420
127 3300050512 nmdc:mga0n895_114576_c1 nmdc:mga0n895_114576_c1_642_1952 420
128 3300060353 Ga0501082_0083028 Ga0501082_0083028_779_2104 420
129 3300061734 Ga0530510_0045623 Ga0530510_0045623_469_1785 420
130 3300005356 Ga0070674_100104994 Ga0070674_1001049942 421
131 3300005718 Ga0068866_10001191 Ga0068866_100011919 421
132 3300013297 Ga0157378_10032699 Ga0157378_100326993 421
133 3300025899 Ga0207642_10006126 Ga0207642_100061262 421
134 3300027907 Ga0207428_10001878 Ga0207428_1000187810 421
135 3300005295 Ga0065707_10100819 Ga0065707_101008192 422
136 3300005336 Ga0070680_100000737 Ga0070680_10000073716 422
137 3300005438 Ga0070701_10078451 Ga0070701_100784512 422
138 3300005458 Ga0070681_10003816 Ga0070681_100038168 422
139 3300005530 Ga0070679_100000087 Ga0070679_10000008746 422
140 3300005539 Ga0068853_100059676 Ga0068853_1000596762 422
141 3300005614 Ga0068856_100017702 Ga0068856_1000177021 422
142 3300006852 Ga0075433_10013192 Ga0075433_100131923 422
143 3300006852 Ga0075433_10042504 Ga0075433_100425043 422
144 3300006871 Ga0075434_100220687 Ga0075434_1002206872 422
145 3300009147 Ga0114129_10017765 Ga0114129_100177657 422
146 3300013307 Ga0157372_10245011 Ga0157372_102450111 422
147 3300025912 Ga0207707_10000006 Ga0207707_10000006109 422
148 3300025917 Ga0207660_10000124 Ga0207660_1000012424 422
149 3300025921 Ga0207652_10000517 Ga0207652_1000051724 422
150 3300025925 Ga0207650_10087523 Ga0207650_100875233 422
151 3300048905 Ga0496102_0214674 Ga0496102_0214674_457_1728 422
152 3300048911 Ga0496108_0159000 Ga0496108_0159000_618_1889 422
153 3300049574 Ga0501038_0004636 Ga0501038_0004636_5545_6816 422
154 3300049652 Ga0501202_019190 Ga0501202_019190_38_1330 422
155 3300049661 Ga0501217_002428 Ga0501217_002428_1130_2422 422
156 3300049663 Ga0501223_004378 Ga0501223_004378_600_1892 422
157 3300050507 nmdc:mga05p37_75342_c1 nmdc:mga05p37_75342_c1_1442_2713 422
158 3300050507 nmdc:mga05p37_7696_c1 nmdc:mga05p37_7696_c1_1396_2688 422
159 3300002459 JGI24751J29686_10000107 JGI24751J29686_1000010736 423
160 3300005288 Ga0065714_10064435 Ga0065714_1006443541 423
161 3300005290 Ga0065712_10000118 Ga0065712_1000011842 423
162 3300005290 Ga0065712_10009742 Ga0065712_100097421 423
163 3300005293 Ga0065715_10089145 Ga0065715_100891453 423
164 3300005331 Ga0070670_100000172 Ga0070670_10000017225 423
165 3300005331 Ga0070670_100096170 Ga0070670_1000961702 423
166 3300005364 Ga0070673_100028204 Ga0070673_1000282042 423
167 3300005444 Ga0070694_100004871 Ga0070694_1000048713 423
168 3300005444 Ga0070694_100137764 Ga0070694_1001377642 423
169 3300005471 Ga0070698_100047473 Ga0070698_1000474732 423
170 3300005518 Ga0070699_100026519 Ga0070699_1000265193 423
171 3300005539 Ga0068853_100186569 Ga0068853_1001865692 423
172 3300005545 Ga0070695_100063674 Ga0070695_1000636742 423
173 3300005577 Ga0068857_100061601 Ga0068857_1000616014 423
174 3300005577 Ga0068857_100068857 Ga0068857_1000688572 423
175 3300005617 Ga0068859_100000232 Ga0068859_10000023225 423
176 3300005618 Ga0068864_100035645 Ga0068864_1000356452 423
177 3300005840 Ga0068870_10095457 Ga0068870_100954572 423
178 3300005841 Ga0068863_100002518 Ga0068863_10000251813 423
179 3300005841 Ga0068863_100087402 Ga0068863_1000874022 423
180 3300005842 Ga0068858_100032061 Ga0068858_1000320612 423
181 3300005844 Ga0068862_100201585 Ga0068862_1002015852 423
182 3300006846 Ga0075430_100074776 Ga0075430_1000747762 423
183 3300006931 Ga0097620_100000232 Ga0097620_10000023225 423
184 3300009093 Ga0105240_10031817 Ga0105240_100318171 423
185 3300009093 Ga0105240_10153747 Ga0105240_101537474 423
186 3300009094 Ga0111539_10037648 Ga0111539_100376482 423
187 3300009147 Ga0114129_10149755 Ga0114129_101497554 423
188 3300009148 Ga0105243_10002693 Ga0105243_100026936 423
189 3300009176 Ga0105242_10122127 Ga0105242_101221272 423
190 3300009177 Ga0105248_10018980 Ga0105248_100189802 423
191 3300009177 Ga0105248_10405535 Ga0105248_104055352 423
192 3300009545 Ga0105237_10130887 Ga0105237_101308872 423
193 3300009551 Ga0105238_10013295 Ga0105238_100132954 423
194 3300009553 Ga0105249_10013820 Ga0105249_100138204 423
195 3300011119 Ga0105246_10254409 Ga0105246_102544091 423
196 3300013306 Ga0163162_10091360 Ga0163162_100913603 423
197 3300013308 Ga0157375_10009751 Ga0157375_100097514 423
198 3300013308 Ga0157375_10043350 Ga0157375_100433501 423
199 3300013308 Ga0157375_10236400 Ga0157375_102364002 423
200 3300014325 Ga0163163_10000172 Ga0163163_100001728 423
201 3300014325 Ga0163163_10233341 Ga0163163_102333411 423
202 3300014968 Ga0157379_10020546 Ga0157379_100205462 423
203 3300025908 Ga0207643_10001553 Ga0207643_100015532 423
204 3300025910 Ga0207684_10020542 Ga0207684_100205426 423
205 3300025913 Ga0207695_10033246 Ga0207695_100332464 423
206 3300025922 Ga0207646_10125026 Ga0207646_101250262 423
207 3300025924 Ga0207694_10080746 Ga0207694_100807463 423
208 3300025925 Ga0207650_10000001 Ga0207650_10000001485 423
209 3300025925 Ga0207650_10065750 Ga0207650_100657502 423
210 3300025932 Ga0207690_10122641 Ga0207690_101226411 423
211 3300025936 Ga0207670_10000293 Ga0207670_100002937 423
212 3300025936 Ga0207670_10154405 Ga0207670_101544052 423
213 3300025961 Ga0207712_10001316 Ga0207712_100013168 423
214 3300025961 Ga0207712_10042625 Ga0207712_100426253 423
215 3300026035 Ga0207703_10027628 Ga0207703_100276283 423
216 3300026075 Ga0207708_10000061 Ga0207708_1000006170 423
217 3300026088 Ga0207641_10053775 Ga0207641_100537753 423
218 3300026089 Ga0207648_10085888 Ga0207648_100858882 423
219 3300026095 Ga0207676_10254246 Ga0207676_102542461 423
220 3300026095 Ga0207676_10282788 Ga0207676_102827881 423
221 3300026116 Ga0207674_10022424 Ga0207674_100224242 423
222 3300026116 Ga0207674_10054802 Ga0207674_100548024 423
223 3300026142 Ga0207698_10104523 Ga0207698_101045232 423
224 3300027907 Ga0207428_10002782 Ga0207428_100027826 423
225 3300037312 Ga0395899_0177760 Ga0395899_0177760_66_1352 423
226 3300038443 Ga0395901_0062871 Ga0395901_0062871_1530_2816 423
227 3300042157 Ga0439458_0009498 Ga0439458_0009498_348_1634 423
228 3300049770 Ga0501273_002233 Ga0501273_002233_203_1480 423
229 3300050507 nmdc:mga05p37_65328_c1 nmdc:mga05p37_65328_c1_588_1874 423
230 3300050509 nmdc:mga0qj67_113003_c1 nmdc:mga0qj67_113003_c1_195_1481 423
231 3300005334 Ga0068869_100126927 Ga0068869_1001269272 424
232 3300005343 Ga0070687_100000957 Ga0070687_1000009578 424
233 3300005353 Ga0070669_100006367 Ga0070669_1000063672 424
234 3300005364 Ga0070673_100130544 Ga0070673_1001305442 424
235 3300005438 Ga0070701_10092881 Ga0070701_100928811 424
236 3300005456 Ga0070678_100072607 Ga0070678_1000726072 424
237 3300005457 Ga0070662_100092574 Ga0070662_1000925743 424
238 3300005457 Ga0070662_100169917 Ga0070662_1001699172 424
239 3300005458 Ga0070681_10108891 Ga0070681_101088912 424
240 3300005544 Ga0070686_100056114 Ga0070686_1000561142 424
241 3300005545 Ga0070695_100020413 Ga0070695_1000204132 424
242 3300005549 Ga0070704_100006345 Ga0070704_1000063452 424
243 3300005617 Ga0068859_100016624 Ga0068859_1000166248 424
244 3300005618 Ga0068864_100027181 Ga0068864_1000271814 424
245 3300005840 Ga0068870_10009275 Ga0068870_100092752 424
246 3300005843 Ga0068860_100033973 Ga0068860_1000339734 424
247 3300005843 Ga0068860_100083407 Ga0068860_1000834074 424
248 3300005844 Ga0068862_100017072 Ga0068862_1000170726 424
249 3300005985 Ga0081539_10001333 Ga0081539_1000133340 424
250 3300005985 Ga0081539_10002601 Ga0081539_1000260124 424
251 3300006852 Ga0075433_10136870 Ga0075433_101368702 424
252 3300006931 Ga0097620_100016624 Ga0097620_1000166242 424
253 3300009094 Ga0111539_10064865 Ga0111539_100648654 424
254 3300009094 Ga0111539_10077608 Ga0111539_100776082 424
255 3300009148 Ga0105243_10023739 Ga0105243_100237394 424
256 3300013308 Ga0157375_10063344 Ga0157375_100633442 424
257 3300014326 Ga0157380_10105941 Ga0157380_101059413 424
258 3300025908 Ga0207643_10001473 Ga0207643_1000147313 424
259 3300025911 Ga0207654_10011849 Ga0207654_100118492 424
260 3300025912 Ga0207707_10021022 Ga0207707_100210224 424
261 3300025923 Ga0207681_10001192 Ga0207681_1000119212 424
262 3300025933 Ga0207706_10071070 Ga0207706_100710704 424
263 3300025933 Ga0207706_10215850 Ga0207706_102158502 424
264 3300025936 Ga0207670_10002977 Ga0207670_100029777 424
265 3300025945 Ga0207679_10131335 Ga0207679_101313352 424
266 3300026075 Ga0207708_10015579 Ga0207708_100155793 424
267 3300026089 Ga0207648_10000198 Ga0207648_1000019858 424
268 3300026095 Ga0207676_10013542 Ga0207676_100135423 424
269 3300026118 Ga0207675_100004195 Ga0207675_1000041955 424
270 3300027907 Ga0207428_10000850 Ga0207428_1000085022 424
271 3300035410 Ga0373924_0000558 Ga0373924_0000558_2342_3637 424
272 3300039437 Ga0436365_1311852 Ga0436365_1311852_28243_29532 424
273 3300050511 nmdc:mga08y16_26156_c1 nmdc:mga08y16_26156_c1_3455_4768 424
274 3300050512 nmdc:mga0n895_87829_c1 nmdc:mga0n895_87829_c1_1329_2606 424
275 3300005331 Ga0070670_100004889 Ga0070670_1000048896 425
276 3300005340 Ga0070689_100027429 Ga0070689_1000274293 425
277 3300005343 Ga0070687_100010613 Ga0070687_1000106133 425
278 3300005343 Ga0070687_100043168 Ga0070687_1000431681 425
279 3300005344 Ga0070661_100004376 Ga0070661_1000043769 425
280 3300005354 Ga0070675_100011189 Ga0070675_1000111895 425
281 3300005354 Ga0070675_100041159 Ga0070675_1000411592 425
282 3300005356 Ga0070674_100085168 Ga0070674_1000851682 425
283 3300005364 Ga0070673_100183784 Ga0070673_1001837842 425
284 3300005365 Ga0070688_100011822 Ga0070688_1000118225 425
285 3300005440 Ga0070705_100012938 Ga0070705_1000129381 425
286 3300005441 Ga0070700_100028712 Ga0070700_1000287124 425
287 3300005444 Ga0070694_100041853 Ga0070694_1000418531 425
288 3300005459 Ga0068867_100010637 Ga0068867_1000106374 425
289 3300005466 Ga0070685_10071454 Ga0070685_100714541 425
290 3300005545 Ga0070695_100021640 Ga0070695_1000216404 425
291 3300005545 Ga0070695_100170735 Ga0070695_1001707352 425
292 3300005549 Ga0070704_100015082 Ga0070704_1000150822 425
293 3300005564 Ga0070664_100006222 Ga0070664_1000062226 425
294 3300005615 Ga0070702_100020363 Ga0070702_1000203632 425
295 3300005617 Ga0068859_100001031 Ga0068859_1000010315 425
296 3300005617 Ga0068859_100028196 Ga0068859_1000281964 425
297 3300005618 Ga0068864_100098058 Ga0068864_1000980583 425
298 3300005719 Ga0068861_100006887 Ga0068861_1000068875 425
299 3300005841 Ga0068863_100273520 Ga0068863_1002735201 425
300 3300005842 Ga0068858_100056164 Ga0068858_1000561643 425
301 3300005843 Ga0068860_100004608 Ga0068860_1000046089 425
302 3300006358 Ga0068871_100058241 Ga0068871_1000582414 425
303 3300006871 Ga0075434_100000390 Ga0075434_10000039013 425
304 3300006871 Ga0075434_100003485 Ga0075434_10000348511 425
305 3300006931 Ga0097620_100001031 Ga0097620_1000010315 425
306 3300006931 Ga0097620_100028195 Ga0097620_1000281954 425
307 3300009147 Ga0114129_10000618 Ga0114129_100006182 425
308 3300009148 Ga0105243_10038787 Ga0105243_100387874 425
309 3300009553 Ga0105249_10058018 Ga0105249_100580182 425
310 3300014325 Ga0163163_10018637 Ga0163163_100186372 425
311 3300025901 Ga0207688_10000655 Ga0207688_1000065511 425
312 3300025907 Ga0207645_10047455 Ga0207645_100474551 425
313 3300025918 Ga0207662_10018445 Ga0207662_100184453 425
314 3300025918 Ga0207662_10045163 Ga0207662_100451632 425
315 3300025925 Ga0207650_10004680 Ga0207650_100046801 425
316 3300025926 Ga0207659_10001576 Ga0207659_100015762 425
317 3300025926 Ga0207659_10008836 Ga0207659_100088369 425
318 3300025926 Ga0207659_10039733 Ga0207659_100397332 425
319 3300025926 Ga0207659_10202207 Ga0207659_102022071 425
320 3300025935 Ga0207709_10020202 Ga0207709_100202022 425
321 3300025935 Ga0207709_10076425 Ga0207709_100764252 425
322 3300025940 Ga0207691_10001073 Ga0207691_1000107320 425
323 3300025941 Ga0207711_10043325 Ga0207711_100433253 425
324 3300025945 Ga0207679_10001508 Ga0207679_100015082 425
325 3300025945 Ga0207679_10013504 Ga0207679_100135043 425
326 3300026035 Ga0207703_10066432 Ga0207703_100664323 425
327 3300026035 Ga0207703_10195954 Ga0207703_101959542 425
328 3300026075 Ga0207708_10003750 Ga0207708_100037504 425
329 3300026088 Ga0207641_10053703 Ga0207641_100537035 425
330 3300026089 Ga0207648_10019380 Ga0207648_100193802 425
331 3300026118 Ga0207675_100001562 Ga0207675_1000015627 425
332 3300026121 Ga0207683_10008527 Ga0207683_1000852711 425
333 3300026121 Ga0207683_10124355 Ga0207683_101243553 425
334 3300027907 Ga0207428_10013700 Ga0207428_100137005 425
335 3300027907 Ga0207428_10021724 Ga0207428_100217244 425
336 3300028380 Ga0268265_10101368 Ga0268265_101013682 425
337 3300028381 Ga0268264_10005447 Ga0268264_100054474 425
338 3300035171 Ga0373946_0013645 Ga0373946_0013645_426_1724 425
339 3300035692 Ga0373935_0099140 Ga0373935_0099140_230_1528 425
340 3300035725 Ga0373947_0013606 Ga0373947_0013606_2832_4130 425
341 3300037068 Ga0373925_0089048 Ga0373925_0089048_111_1409 425
342 3300045051 Ga0451576_0238818 Ga0451576_0238818_357_1640 425
343 3300046683 Ga0495658_0029002 Ga0495658_0029002_1209_2507 425
344 3300047319 Ga0495674_0104558 Ga0495674_0104558_682_1980 425
345 3300047471 Ga0495684_0000307 Ga0495684_0000307_12080_13378 425
346 3300050511 nmdc:mga08y16_16894_c1 nmdc:mga08y16_16894_c1_3408_4709 425
347 3300050512 nmdc:mga0n895_10497_c1 nmdc:mga0n895_10497_c1_1416_2699 425
348 3300050512 nmdc:mga0n895_70704_c1 nmdc:mga0n895_70704_c1_1037_2320 425
349 3300050515 nmdc:mga0a205_1338_c1 nmdc:mga0a205_1338_c1_10439_11722 425
350 3300050515 nmdc:mga0a205_598_c1 nmdc:mga0a205_598_c1_20103_21386 425
351 3300053077 Ga0495601_0007990 Ga0495601_0007990_3880_5178 425
352 3300053085 Ga0495619_0120742 Ga0495619_0120742_442_1740 425
353 3300005290 Ga0065712_10079650 Ga0065712_100796504 426
354 3300005293 Ga0065715_10103858 Ga0065715_101038582 426
355 3300005331 Ga0070670_100282182 Ga0070670_1002821821 426
356 3300005344 Ga0070661_100055361 Ga0070661_1000553613 426
357 3300005345 Ga0070692_10012305 Ga0070692_100123052 426
358 3300005366 Ga0070659_100008237 Ga0070659_1000082373 426
359 3300005458 Ga0070681_10005160 Ga0070681_100051605 426
360 3300005549 Ga0070704_100104306 Ga0070704_1001043062 426
361 3300005564 Ga0070664_100005418 Ga0070664_1000054183 426
362 3300005618 Ga0068864_100022758 Ga0068864_1000227582 426
363 3300005840 Ga0068870_10087912 Ga0068870_100879121 426
364 3300005844 Ga0068862_100076193 Ga0068862_1000761932 426
365 3300006163 Ga0070715_10000025 Ga0070715_100000256 426
366 3300006844 Ga0075428_100018896 Ga0075428_1000188967 426
367 3300006844 Ga0075428_100115314 Ga0075428_1001153142 426
368 3300006844 Ga0075428_100175343 Ga0075428_1001753432 426
369 3300006852 Ga0075433_10058923 Ga0075433_100589232 426
370 3300006880 Ga0075429_100039075 Ga0075429_1000390753 426
371 3300006880 Ga0075429_100072309 Ga0075429_1000723093 426
372 3300009094 Ga0111539_10001668 Ga0111539_1000166823 426
373 3300009094 Ga0111539_10037073 Ga0111539_100370732 426
374 3300009147 Ga0114129_10053334 Ga0114129_100533344 426
375 3300009147 Ga0114129_10090224 Ga0114129_100902242 426
376 3300009174 Ga0105241_10098172 Ga0105241_100981723 426
377 3300009174 Ga0105241_10178426 Ga0105241_101784261 426
378 3300013100 Ga0157373_10002757 Ga0157373_100027577 426
379 3300013100 Ga0157373_10073086 Ga0157373_100730862 426
380 3300013307 Ga0157372_10121998 Ga0157372_101219982 426
381 3300014325 Ga0163163_10041530 Ga0163163_100415302 426
382 3300025905 Ga0207685_10000008 Ga0207685_1000000852 426
383 3300025912 Ga0207707_10150547 Ga0207707_101505471 426
384 3300025932 Ga0207690_10101956 Ga0207690_101019562 426
385 3300025941 Ga0207711_10278604 Ga0207711_102786042 426
386 3300025945 Ga0207679_10024680 Ga0207679_100246803 426
387 3300026035 Ga0207703_10048450 Ga0207703_100484502 426
388 3300026041 Ga0207639_10047062 Ga0207639_100470623 426
389 3300026095 Ga0207676_10173177 Ga0207676_101731772 426
390 3300026116 Ga0207674_10000391 Ga0207674_100003915 426
391 3300026118 Ga0207675_100228659 Ga0207675_1002286591 426
392 3300027907 Ga0207428_10000743 Ga0207428_1000074310 426
393 3300031901 Ga0307406_10020257 Ga0307406_100202572 426
394 3300031911 Ga0307412_10038816 Ga0307412_100388162 426
395 3300032002 Ga0307416_100013056 Ga0307416_1000130563 426
396 3300032004 Ga0307414_10014119 Ga0307414_100141192 426
397 3300032126 Ga0307415_100002999 Ga0307415_1000029993 426
398 3300049665 Ga0501227_003573 Ga0501227_003573_1210_2508 426
399 3300049668 Ga0501233_003064 Ga0501233_003064_943_2241 426
400 3300050508 nmdc:mga09592_38447_c1 nmdc:mga09592_38447_c1_412_1704 426
401 3300050509 nmdc:mga0qj67_108001_c1 nmdc:mga0qj67_108001_c1_692_1996 426
402 3300050509 nmdc:mga0qj67_63229_c1 nmdc:mga0qj67_63229_c1_390_1682 426
403 3300050511 nmdc:mga08y16_2721_c1 nmdc:mga08y16_2721_c1_15492_16787 426
404 3300050511 nmdc:mga08y16_3877_c1 nmdc:mga08y16_3877_c1_3059_4363 426
405 3300005354 Ga0070675_100016023 Ga0070675_1000160236 427
406 3300005364 Ga0070673_100009349 Ga0070673_1000093494 427
407 3300005617 Ga0068859_100040203 Ga0068859_1000402034 427
408 3300005618 Ga0068864_100101643 Ga0068864_1001016432 427
409 3300005719 Ga0068861_100104377 Ga0068861_1001043772 427
410 3300006173 Ga0070716_100000003 Ga0070716_100000003103 427
411 3300006931 Ga0097620_100040203 Ga0097620_1000402034 427
412 3300009094 Ga0111539_10000155 Ga0111539_1000015521 427
413 3300009094 Ga0111539_10230592 Ga0111539_102305922 427
414 3300009147 Ga0114129_10194573 Ga0114129_101945732 427
415 3300009553 Ga0105249_10131312 Ga0105249_101313123 427
416 3300014745 Ga0157377_10031672 Ga0157377_100316722 427
417 3300025918 Ga0207662_10030137 Ga0207662_100301372 427
418 3300025926 Ga0207659_10010519 Ga0207659_100105196 427
419 3300025939 Ga0207665_10000003 Ga0207665_1000000316 427
420 3300025960 Ga0207651_10022531 Ga0207651_100225312 427
421 3300025961 Ga0207712_10096586 Ga0207712_100965862 427
422 3300031852 Ga0307410_10002981 Ga0307410_100029816 427
423 3300031901 Ga0307406_10016376 Ga0307406_100163764 427
424 3300031911 Ga0307412_10017758 Ga0307412_100177583 427
425 3300031995 Ga0307409_100076051 Ga0307409_1000760513 427
426 3300032002 Ga0307416_100003105 Ga0307416_1000031056 427
427 3300032005 Ga0307411_10006049 Ga0307411_100060493 427
428 3300032126 Ga0307415_100007605 Ga0307415_1000076056 427
429 3300046537 Ga0495598_0000117 Ga0495598_0000117_1578_2861 427
430 3300046539 Ga0495621_0000086 Ga0495621_0000086_8922_10205 427
431 3300048912 Ga0496109_0012325 Ga0496109_0012325_4578_5876 427
432 3300048916 Ga0496113_0036874 Ga0496113_0036874_292_1605 427
433 3300049661 Ga0501217_003997 Ga0501217_003997_1636_2949 427
434 3300049663 Ga0501223_003647 Ga0501223_003647_1623_2936 427
435 3300049664 Ga0501224_002304 Ga0501224_002304_109_1422 427
436 3300050507 nmdc:mga05p37_39109_c1 nmdc:mga05p37_39109_c1_3433_4731 427
437 3300050507 nmdc:mga05p37_65943_c1 nmdc:mga05p37_65943_c1_2684_3997 427
438 3300050511 nmdc:mga08y16_286704_c1 nmdc:mga08y16_286704_c1_227_1540 427
439 3300050511 nmdc:mga08y16_498_c1 nmdc:mga08y16_498_c1_19063_20355 427
440 3300005295 Ga0065707_10093441 Ga0065707_100934413 428
441 3300005328 Ga0070676_10122178 Ga0070676_101221781 428
442 3300005331 Ga0070670_100214063 Ga0070670_1002140632 428
443 3300005334 Ga0068869_100016940 Ga0068869_1000169401 428
444 3300005337 Ga0070682_100000108 Ga0070682_10000010852 428
445 3300005353 Ga0070669_100013346 Ga0070669_1000133464 428
446 3300005354 Ga0070675_100121891 Ga0070675_1001218912 428
447 3300005355 Ga0070671_100086989 Ga0070671_1000869891 428
448 3300005365 Ga0070688_100030646 Ga0070688_1000306462 428
449 3300005367 Ga0070667_100100275 Ga0070667_1001002753 428
450 3300005456 Ga0070678_100078459 Ga0070678_1000784592 428
451 3300005457 Ga0070662_100214020 Ga0070662_1002140201 428
452 3300005459 Ga0068867_100056843 Ga0068867_1000568432 428
453 3300005466 Ga0070685_10169869 Ga0070685_101698691 428
454 3300005471 Ga0070698_100000063 Ga0070698_10000006322 428
455 3300005543 Ga0070672_100024168 Ga0070672_1000241681 428
456 3300005544 Ga0070686_100023399 Ga0070686_1000233994 428
457 3300005564 Ga0070664_100168325 Ga0070664_1001683251 428
458 3300005615 Ga0070702_100017379 Ga0070702_1000173794 428
459 3300005616 Ga0068852_100158210 Ga0068852_1001582102 428
460 3300005718 Ga0068866_10026465 Ga0068866_100264652 428
461 3300005842 Ga0068858_100037723 Ga0068858_1000377236 428
462 3300005842 Ga0068858_100105427 Ga0068858_1001054271 428
463 3300006237 Ga0097621_100110046 Ga0097621_1001100462 428
464 3300006880 Ga0075429_100029032 Ga0075429_1000290322 428
465 3300006881 Ga0068865_100010926 Ga0068865_1000109262 428
466 3300009098 Ga0105245_10015683 Ga0105245_100156833 428
467 3300009148 Ga0105243_10021777 Ga0105243_100217772 428
468 3300009176 Ga0105242_10102935 Ga0105242_101029352 428
469 3300009553 Ga0105249_10199917 Ga0105249_101999171 428
470 3300010375 Ga0105239_10329991 Ga0105239_103299911 428
471 3300011119 Ga0105246_10031954 Ga0105246_100319542 428
472 3300013296 Ga0157374_10164387 Ga0157374_101643872 428
473 3300013297 Ga0157378_10022839 Ga0157378_100228391 428
474 3300014325 Ga0163163_10024520 Ga0163163_100245202 428
475 3300014745 Ga0157377_10059093 Ga0157377_100590932 428
476 3300017792 Ga0163161_10020028 Ga0163161_100200282 428
477 3300025315 Ga0207697_10006224 Ga0207697_100062244 428
478 3300025931 Ga0207644_10151243 Ga0207644_101512432 428
479 3300025938 Ga0207704_10114880 Ga0207704_101148802 428
480 3300025940 Ga0207691_10146569 Ga0207691_101465692 428
481 3300026035 Ga0207703_10038520 Ga0207703_100385205 428
482 3300026075 Ga0207708_10049853 Ga0207708_100498531 428
483 3300026118 Ga0207675_100002633 Ga0207675_1000026331 428
484 3300026121 Ga0207683_10065549 Ga0207683_100655492 428
485 3300028380 Ga0268265_10290447 Ga0268265_102904471 428
486 3300046522 Ga0495643_0006534 Ga0495643_0006534_4251_5540 428
487 3300046525 Ga0495663_0000584 Ga0495663_0000584_9099_10505 428
488 3300046615 Ga0495656_0006465 Ga0495656_0006465_2609_3910 428
489 3300050508 nmdc:mga09592_17624_c1 nmdc:mga09592_17624_c1_1099_2388 428
490 3300005331 Ga0070670_100051937 Ga0070670_1000519372 429
491 3300005355 Ga0070671_100001211 Ga0070671_10000121112 429
492 3300005536 Ga0070697_100000285 Ga0070697_10000028515 429
493 3300005549 Ga0070704_100057420 Ga0070704_1000574201 429
494 3300005617 Ga0068859_100050919 Ga0068859_1000509192 429
495 3300005842 Ga0068858_100036430 Ga0068858_1000364302 429
496 3300005844 Ga0068862_100151114 Ga0068862_1001511142 429
497 3300006237 Ga0097621_100002325 Ga0097621_1000023252 429
498 3300006358 Ga0068871_100062161 Ga0068871_1000621612 429
499 3300006914 Ga0075436_100001719 Ga0075436_1000017195 429
500 3300006931 Ga0097620_100050915 Ga0097620_1000509152 429
501 3300009147 Ga0114129_10002938 Ga0114129_100029384 429
502 3300009147 Ga0114129_10039653 Ga0114129_100396532 429
503 3300013297 Ga0157378_10001819 Ga0157378_100018197 429
504 3300013297 Ga0157378_10060262 Ga0157378_100602621 429
505 3300014325 Ga0163163_10007063 Ga0163163_100070631 429
506 3300014326 Ga0157380_10011393 Ga0157380_100113931 429
507 3300014326 Ga0157380_10047165 Ga0157380_100471651 429
508 3300025923 Ga0207681_10131014 Ga0207681_101310142 429
509 3300025931 Ga0207644_10100301 Ga0207644_101003011 429
510 3300025941 Ga0207711_10030145 Ga0207711_100301452 429
511 3300025945 Ga0207679_10135457 Ga0207679_101354572 429
512 3300026035 Ga0207703_10109336 Ga0207703_101093362 429
513 3300026075 Ga0207708_10062504 Ga0207708_100625043 429
514 3300042156 Ga0439446_0009991 Ga0439446_0009991_668_1960 429
515 3300042156 Ga0439446_0022889 Ga0439446_0022889_194_1498 429
516 3300050507 nmdc:mga05p37_25787_c1 nmdc:mga05p37_25787_c1_5662_6966 429
517 3300050514 nmdc:mga08x19_17210_c1 nmdc:mga08x19_17210_c1_506_1798 429
518 3300005295 Ga0065707_10017420 Ga0065707_100174202 430
519 3300005334 Ga0068869_100009995 Ga0068869_1000099953 430
520 3300005334 Ga0068869_100074136 Ga0068869_1000741362 430
521 3300005353 Ga0070669_100000609 Ga0070669_1000006099 430
522 3300005441 Ga0070700_100028849 Ga0070700_1000288492 430
523 3300005444 Ga0070694_100028066 Ga0070694_1000280662 430
524 3300005445 Ga0070708_100002650 Ga0070708_1000026504 430
525 3300005445 Ga0070708_100043695 Ga0070708_1000436951 430
526 3300005459 Ga0068867_100151206 Ga0068867_1001512061 430
527 3300005467 Ga0070706_100008066 Ga0070706_1000080661 430
528 3300005467 Ga0070706_100030655 Ga0070706_1000306553 430
529 3300005467 Ga0070706_100153744 Ga0070706_1001537442 430
530 3300005468 Ga0070707_100158104 Ga0070707_1001581042 430
531 3300005471 Ga0070698_100031394 Ga0070698_1000313942 430
532 3300005471 Ga0070698_100152548 Ga0070698_1001525481 430
533 3300005471 Ga0070698_100211229 Ga0070698_1002112292 430
534 3300005518 Ga0070699_100003506 Ga0070699_1000035064 430
535 3300005518 Ga0070699_100097043 Ga0070699_1000970432 430
536 3300005536 Ga0070697_100000062 Ga0070697_10000006267 430
537 3300005536 Ga0070697_100212046 Ga0070697_1002120461 430
538 3300005549 Ga0070704_100103510 Ga0070704_1001035102 430
539 3300005618 Ga0068864_100187769 Ga0068864_1001877691 430
540 3300005719 Ga0068861_100003394 Ga0068861_1000033942 430
541 3300005841 Ga0068863_100049491 Ga0068863_1000494912 430
542 3300005844 Ga0068862_100054480 Ga0068862_1000544803 430
543 3300005985 Ga0081539_10000614 Ga0081539_100006143 430
544 3300006358 Ga0068871_100008480 Ga0068871_1000084802 430
545 3300006844 Ga0075428_100226529 Ga0075428_1002265292 430
546 3300006914 Ga0075436_100000002 Ga0075436_100000002223 430
547 3300007076 Ga0075435_100005602 Ga0075435_1000056025 430
548 3300009148 Ga0105243_10187892 Ga0105243_101878921 430
549 3300009553 Ga0105249_10000136 Ga0105249_1000013653 430
550 3300009553 Ga0105249_10002115 Ga0105249_100021154 430
551 3300013297 Ga0157378_10019632 Ga0157378_100196326 430
552 3300013306 Ga0163162_10000001 Ga0163162_10000001433 430
553 3300013308 Ga0157375_10010051 Ga0157375_100100513 430
554 3300014325 Ga0163163_10197229 Ga0163163_101972292 430
555 3300014326 Ga0157380_10001650 Ga0157380_100016509 430
556 3300025910 Ga0207684_10007146 Ga0207684_1000714610 430
557 3300025910 Ga0207684_10128442 Ga0207684_101284421 430
558 3300025910 Ga0207684_10131081 Ga0207684_101310811 430
559 3300025923 Ga0207681_10003950 Ga0207681_100039505 430
560 3300025923 Ga0207681_10021745 Ga0207681_100217452 430
561 3300025925 Ga0207650_10002020 Ga0207650_100020201 430
562 3300025939 Ga0207665_10013668 Ga0207665_100136684 430
563 3300025942 Ga0207689_10016936 Ga0207689_100169363 430
564 3300025961 Ga0207712_10000092 Ga0207712_1000009253 430
565 3300026075 Ga0207708_10007717 Ga0207708_100077173 430
566 3300026088 Ga0207641_10042420 Ga0207641_100424204 430
567 3300026089 Ga0207648_10030025 Ga0207648_100300252 430
568 3300026089 Ga0207648_10276191 Ga0207648_102761911 430
569 3300026118 Ga0207675_100020228 Ga0207675_1000202282 430
570 3300026118 Ga0207675_100163753 Ga0207675_1001637532 430
571 3300026118 Ga0207675_100281738 Ga0207675_1002817382 430
572 3300037471 Ga0395905_0124218 Ga0395905_0124218_434_1729 430
573 3300047320 Ga0495672_0021628 Ga0495672_0021628_2794_4089 430
574 3300049590 Ga0501074_0068363 Ga0501074_0068363_283_1593 430
575 3300050507 nmdc:mga05p37_59716_c1 nmdc:mga05p37_59716_c1_2191_3672 430
576 3300050513 nmdc:mga0rr50_3767_c1 nmdc:mga0rr50_3767_c1_2802_4097 430
577 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_156030_157325 430
578 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001337 431
579 3300002239 JGI24034J26672_10000001 JGI24034J26672_1000000180 431
580 3300005459 Ga0068867_100057391 Ga0068867_1000573912 431
581 3300005468 Ga0070707_100000107 Ga0070707_10000010764 431
582 3300005471 Ga0070698_100033509 Ga0070698_1000335096 431
583 3300005549 Ga0070704_100021490 Ga0070704_1000214903 431
584 3300005842 Ga0068858_100000051 Ga0068858_10000005133 431
585 3300006844 Ga0075428_100083310 Ga0075428_1000833104 431
586 3300006852 Ga0075433_10011848 Ga0075433_100118486 431
587 3300006880 Ga0075429_100008602 Ga0075429_1000086022 431
588 3300009094 Ga0111539_10017779 Ga0111539_100177796 431
589 3300009101 Ga0105247_10000004 Ga0105247_10000004125 431
590 3300009176 Ga0105242_10001013 Ga0105242_1000101317 431
591 3300009177 Ga0105248_10140779 Ga0105248_101407792 431
592 3300010375 Ga0105239_10043633 Ga0105239_100436335 431
593 3300013297 Ga0157378_10000004 Ga0157378_10000004107 431
594 3300013297 Ga0157378_10012428 Ga0157378_100124284 431
595 3300013297 Ga0157378_10259768 Ga0157378_102597681 431
596 3300013308 Ga0157375_10000479 Ga0157375_1000047918 431
597 3300017792 Ga0163161_10013806 Ga0163161_100138064 431
598 3300017792 Ga0163161_10106196 Ga0163161_101061962 431
599 3300025223 Ga0207672_1000002 Ga0207672_10000029 431
600 3300025900 Ga0207710_10000002 Ga0207710_10000002889 431
601 3300025910 Ga0207684_10039653 Ga0207684_100396534 431
602 3300025922 Ga0207646_10000543 Ga0207646_1000054318 431
603 3300025922 Ga0207646_10055587 Ga0207646_100555872 431
604 3300025922 Ga0207646_10206537 Ga0207646_102065371 431
605 3300025925 Ga0207650_10106214 Ga0207650_101062142 431
606 3300025926 Ga0207659_10007898 Ga0207659_100078982 431
607 3300025931 Ga0207644_10000179 Ga0207644_1000017925 431
608 3300025934 Ga0207686_10014087 Ga0207686_100140873 431
609 3300025935 Ga0207709_10003560 Ga0207709_100035605 431
610 3300025941 Ga0207711_10105857 Ga0207711_101058573 431
611 3300026035 Ga0207703_10000114 Ga0207703_1000011439 431
612 3300026118 Ga0207675_100024330 Ga0207675_1000243303 431
613 3300027907 Ga0207428_10001780 Ga0207428_100017802 431
614 3300046476 Ga0495662_0062973 Ga0495662_0062973_123_1421 431
615 3300048909 Ga0496106_0001061 Ga0496106_0001061_9584_10882 431
616 3300050512 nmdc:mga0n895_187020_c1 nmdc:mga0n895_187020_c1_46_1341 431
617 3300050515 nmdc:mga0a205_48921_c1 nmdc:mga0a205_48921_c1_1060_2355 431

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00860

Xan_ur_permease

Permease family

90

467

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iof-assembly1.cif.gz_A structure of the transmembrane domain of the transporter slc26dg 0.7725 9 401
5da0-assembly1.cif.gz_A structure of the the slc26 transporter slc26dg in complex with a nanobody 0.7725 9 401
5iof-assembly1.cif.gz_A structure of the transmembrane domain of the transporter slc26dg 0.756 9 401
7v75-assembly1.cif.gz_A thermostabilized human prestin in complex with salicylate 0.7524 7 401
7v73-assembly1.cif.gz_A thermostabilized human prestin in complex with chloride 0.7487 7 401
ID Description Score Start End Superfamily
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9442 13 420 1.20.1740.10
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.931 13 420 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7175 6 396 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7125 6 396 1.20.1740.10
af_Q6ZIE6_46_504_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.6742 20 415 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A3M2EUS3-F1-model_v4 NCS2 family permease 0.9786 11 424 GO:0005345
GO:0005886
AF-A0A660W739-F1-model_v4 NCS2 family permease 0.9744 55 428 GO:0005345
GO:0005886
GO:0012505
AF-A0A2V8PD25-F1-model_v4 Permease 0.9721 115 431 GO:0005345
GO:0005886
GO:0012505
AF-A0A2E8UEH8-F1-model_v4 Guanine permease 0.9676 92 424 GO:0005886
GO:0012505
GO:0015207
AF-A0A2V8PD25-F1-model_v4 Permease 0.9661 115 431 GO:0005345
GO:0005886
GO:0012505

Feature Viewer

pLDDT pTM Quality
87.43 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map