F469613
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 257 | 617 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100474374|Ga0070669_1004743741 |
| Length | 182 |
| Sequence | MYSYLKALHIIFVVTWFAGMFYMPRLFIYSTEAADKTEVECNILRSQFKIMMNRLWYGITWPSAILTLIFGPLVMFNGNWNKTILEPEGRWLLIKLIFVVLLYVYHFTLHKIFKQEMNGVYKYTSQQLRMWNEVSTIFLFAIVTLAVVKQSESFLWSLAGLIGFIIVLMSAIKIYKIIRTKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 156 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 174 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 176 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 177 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 178 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 179 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 180 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 183 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 184 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 222 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 223 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 224 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 227 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 228 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 229 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 230 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 231 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 232 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 235 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 240 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 246 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 247 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 248 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 249 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 250 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 251 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 252 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 253 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 254 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 255 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 256 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 257 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.92 |
| Nodule | 0 |
| Rhizoplane | 0.32 |
| Rhizosphere | 94.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10011915 | 3300002077 | Bacteria | 1770 |
| 2 | rootH2_10008684 | 3300003320 | Bacteria | 1333 |
| 3 | rootH2_10237835 | 3300003320 | Bacteria | 1203 |
| 4 | rootL2_10278346 | 3300003322 | Bacteria | 1345 |
| 5 | rootH1_10249806 | 3300003323 | Bacteria | 1005 |
| 6 | Ga0065712_10109465 | 3300005290 | Bacteria | 1854 |
| 7 | Ga0065715_10159058 | 3300005293 | Bacteria | 1647 |
| 8 | Ga0070658_10614478 | 3300005327 | Bacteria | 942 |
| 9 | Ga0070676_10000659 | 3300005328 | Bacteria | 16800 |
| 10 | Ga0070676_10051597 | 3300005328 | Bacteria | 2416 |
| 11 | Ga0070683_100002540 | 3300005329 | Bacteria | 14571 |
| 12 | Ga0070690_100011501 | 3300005330 | Bacteria | 5177 |
| 13 | Ga0070670_100006829 | 3300005331 | Bacteria | 9669 |
| 14 | Ga0070670_100294730 | 3300005331 | Bacteria | 1418 |
| 15 | Ga0070670_100405260 | 3300005331 | Unclassified | 1204 |
| 16 | Ga0068869_100007810 | 3300005334 | Bacteria | 6862 |
| 17 | Ga0068869_100023401 | 3300005334 | Bacteria | 4265 |
| 18 | Ga0068869_100180306 | 3300005334 | Bacteria | 1655 |
| 19 | Ga0070666_10000172 | 3300005335 | Bacteria | 44437 |
| 20 | Ga0070666_10029228 | 3300005335 | Bacteria | 3622 |
| 21 | Ga0070666_10031744 | 3300005335 | Bacteria | 3488 |
| 22 | Ga0070666_10053728 | 3300005335 | Bacteria | 2717 |
| 23 | Ga0070666_10659269 | 3300005335 | Unclassified | 766 |
| 24 | Ga0070680_100001877 | 3300005336 | Bacteria | 15408 |
| 25 | Ga0070682_100003083 | 3300005337 | Bacteria | 9231 |
| 26 | Ga0070682_100104573 | 3300005337 | Bacteria | 1875 |
| 27 | Ga0070682_100225962 | 3300005337 | Bacteria | 1335 |
| 28 | Ga0068868_100000356 | 3300005338 | Bacteria | 31040 |
| 29 | Ga0068868_100020813 | 3300005338 | Bacteria | 4936 |
| 30 | Ga0068868_100188326 | 3300005338 | Bacteria | 1715 |
| 31 | Ga0070660_100090473 | 3300005339 | Bacteria | 2413 |
| 32 | Ga0070660_100486178 | 3300005339 | Bacteria | 1026 |
| 33 | Ga0070660_101043146 | 3300005339 | Bacteria | 691 |
| 34 | Ga0070689_100042918 | 3300005340 | Unclassified | 3474 |
| 35 | Ga0070689_100083467 | 3300005340 | Bacteria | 2511 |
| 36 | Ga0070689_100183206 | 3300005340 | Bacteria | 1702 |
| 37 | Ga0070691_10007560 | 3300005341 | Bacteria | 4982 |
| 38 | Ga0070691_10441532 | 3300005341 | Bacteria | 741 |
| 39 | Ga0070691_10655863 | 3300005341 | Bacteria | 625 |
| 40 | Ga0070687_100008497 | 3300005343 | Bacteria | 4356 |
| 41 | Ga0070661_100001916 | 3300005344 | Bacteria | 14406 |
| 42 | Ga0070661_100037243 | 3300005344 | Bacteria | 3538 |
| 43 | Ga0070661_100277099 | 3300005344 | Bacteria | 1300 |
| 44 | Ga0070668_100000169 | 3300005347 | Bacteria | 41705 |
| 45 | Ga0070668_100513652 | 3300005347 | Bacteria | 1039 |
| 46 | Ga0070668_100627894 | 3300005347 | Unclassified | 942 |
| 47 | Ga0070668_100736509 | 3300005347 | Bacteria | 872 |
| 48 | Ga0070669_100001327 | 3300005353 | Bacteria | 17836 |
| 49 | Ga0070669_100090722 | 3300005353 | Bacteria | 2291 |
| 50 | Ga0070669_100474374 | 3300005353 | Bacteria | 1034 |
| 51 | Ga0070669_101025489 | 3300005353 | Unclassified | 709 |
| 52 | Ga0070669_101189009 | 3300005353 | Bacteria | 658 |
| 53 | Ga0070675_100128445 | 3300005354 | Bacteria | 2158 |
| 54 | Ga0070675_100187688 | 3300005354 | Bacteria | 1790 |
| 55 | Ga0070675_100431633 | 3300005354 | Bacteria | 1179 |
| 56 | Ga0070671_100030828 | 3300005355 | Bacteria | 4426 |
| 57 | Ga0070671_100042930 | 3300005355 | Bacteria | 3760 |
| 58 | Ga0070671_100227060 | 3300005355 | Bacteria | 1584 |
| 59 | Ga0070671_100327674 | 3300005355 | Bacteria | 1305 |
| 60 | Ga0070674_100006130 | 3300005356 | Bacteria | 6989 |
| 61 | Ga0070674_100010282 | 3300005356 | Bacteria | 5649 |
| 62 | Ga0070674_100993312 | 3300005356 | Bacteria | 736 |
| 63 | Ga0070673_100001347 | 3300005364 | Bacteria | 14334 |
| 64 | Ga0070673_100030855 | 3300005364 | Bacteria | 4017 |
| 65 | Ga0070673_100266783 | 3300005364 | Bacteria | 1497 |
| 66 | Ga0070673_100644748 | 3300005364 | Bacteria | 969 |
| 67 | Ga0070688_100001808 | 3300005365 | Bacteria | 10715 |
| 68 | Ga0070688_100090472 | 3300005365 | Bacteria | 1998 |
| 69 | Ga0070688_100670563 | 3300005365 | Bacteria | 800 |
| 70 | Ga0070659_101386648 | 3300005366 | Bacteria | 624 |
| 71 | Ga0070667_100000553 | 3300005367 | Bacteria | 37217 |
| 72 | Ga0070667_100059329 | 3300005367 | Bacteria | 3237 |
| 73 | Ga0070667_100082513 | 3300005367 | Unclassified | 2753 |
| 74 | Ga0070667_100127719 | 3300005367 | Unclassified | 2217 |
| 75 | Ga0070667_100251887 | 3300005367 | Bacteria | 1579 |
| 76 | Ga0070701_10026912 | 3300005438 | Bacteria | 2811 |
| 77 | Ga0070701_10032532 | 3300005438 | Bacteria | 2598 |
| 78 | Ga0070700_100043718 | 3300005441 | Bacteria | 2757 |
| 79 | Ga0070663_100468579 | 3300005455 | Bacteria | 1041 |
| 80 | Ga0070678_100059276 | 3300005456 | Bacteria | 2813 |
| 81 | Ga0070678_100079700 | 3300005456 | Bacteria | 2478 |
| 82 | Ga0070678_100609324 | 3300005456 | Bacteria | 976 |
| 83 | Ga0070662_100003420 | 3300005457 | Bacteria | 9898 |
| 84 | Ga0070681_10802155 | 3300005458 | Bacteria | 859 |
| 85 | Ga0068867_100001171 | 3300005459 | Bacteria | 17945 |
| 86 | Ga0068867_100059198 | 3300005459 | Bacteria | 2840 |
| 87 | Ga0068867_100147246 | 3300005459 | Unclassified | 1847 |
| 88 | Ga0068867_100204462 | 3300005459 | Unclassified | 1582 |
| 89 | Ga0068867_100637648 | 3300005459 | Unclassified | 933 |
| 90 | Ga0068867_100892596 | 3300005459 | Unclassified | 799 |
| 91 | Ga0070685_10334066 | 3300005466 | Bacteria | 1031 |
| 92 | Ga0070685_10647254 | 3300005466 | Bacteria | 765 |
| 93 | Ga0070679_100000762 | 3300005530 | Bacteria | 27934 |
| 94 | Ga0070679_100513209 | 3300005530 | Bacteria | 1142 |
| 95 | Ga0070679_100807505 | 3300005530 | Bacteria | 881 |
| 96 | Ga0070679_101001923 | 3300005530 | Bacteria | 779 |
| 97 | Ga0070684_100003871 | 3300005535 | Bacteria | 11326 |
| 98 | Ga0070684_100030321 | 3300005535 | Bacteria | 4593 |
| 99 | Ga0070684_100263330 | 3300005535 | Bacteria | 1577 |
| 100 | Ga0070684_100635040 | 3300005535 | Bacteria | 994 |
| 101 | Ga0068853_100000272 | 3300005539 | Bacteria | 36612 |
| 102 | Ga0068853_100003026 | 3300005539 | Bacteria | 12842 |
| 103 | Ga0068853_100003946 | 3300005539 | Bacteria | 11393 |
| 104 | Ga0068853_100014981 | 3300005539 | Bacteria | 6369 |
| 105 | Ga0068853_100033225 | 3300005539 | Bacteria | 4375 |
| 106 | Ga0068853_100195409 | 3300005539 | Bacteria | 1840 |
| 107 | Ga0068853_100353312 | 3300005539 | Bacteria | 1368 |
| 108 | Ga0070672_100000061 | 3300005543 | Bacteria | 49701 |
| 109 | Ga0070672_100059193 | 3300005543 | Bacteria | 3013 |
| 110 | Ga0070672_100144375 | 3300005543 | Bacteria | 1966 |
| 111 | Ga0070672_100627817 | 3300005543 | Bacteria | 937 |
| 112 | Ga0070672_101171752 | 3300005543 | Bacteria | 684 |
| 113 | Ga0070686_100004012 | 3300005544 | Bacteria | 8092 |
| 114 | Ga0070686_100005276 | 3300005544 | Bacteria | 7143 |
| 115 | Ga0070693_100073096 | 3300005547 | Bacteria | 2025 |
| 116 | Ga0070693_100256007 | 3300005547 | Bacteria | 1162 |
| 117 | Ga0070665_100000612 | 3300005548 | Bacteria | 48973 |
| 118 | Ga0070665_100629066 | 3300005548 | Unclassified | 1086 |
| 119 | Ga0068855_100028833 | 3300005563 | Bacteria | 6642 |
| 120 | Ga0068855_100042026 | 3300005563 | Bacteria | 5417 |
| 121 | Ga0068855_100051852 | 3300005563 | Bacteria | 4832 |
| 122 | Ga0068855_100228984 | 3300005563 | Unclassified | 2082 |
| 123 | Ga0068855_100234182 | 3300005563 | Bacteria | 2054 |
| 124 | Ga0068855_100501009 | 3300005563 | Bacteria | 1320 |
| 125 | Ga0068855_100554906 | 3300005563 | Bacteria | 1243 |
| 126 | Ga0070664_100002009 | 3300005564 | Bacteria | 16315 |
| 127 | Ga0070664_100065677 | 3300005564 | Bacteria | 3097 |
| 128 | Ga0070664_100256201 | 3300005564 | Bacteria | 1574 |
| 129 | Ga0070664_100322192 | 3300005564 | Bacteria | 1401 |
| 130 | Ga0070664_100452665 | 3300005564 | Bacteria | 1179 |
| 131 | Ga0068857_100002332 | 3300005577 | Bacteria | 15434 |
| 132 | Ga0068857_100004209 | 3300005577 | Bacteria | 12120 |
| 133 | Ga0068857_100135791 | 3300005577 | Bacteria | 2221 |
| 134 | Ga0068857_100201802 | 3300005577 | Bacteria | 1813 |
| 135 | Ga0068857_100831217 | 3300005577 | Bacteria | 883 |
| 136 | Ga0068854_100349244 | 3300005578 | Bacteria | 1210 |
| 137 | Ga0068854_100600137 | 3300005578 | Bacteria | 940 |
| 138 | Ga0068854_100731727 | 3300005578 | Bacteria | 857 |
| 139 | Ga0068854_100879606 | 3300005578 | Bacteria | 786 |
| 140 | Ga0068854_101499194 | 3300005578 | Bacteria | 612 |
| 141 | Ga0068856_100093309 | 3300005614 | Unclassified | 2995 |
| 142 | Ga0068856_100122613 | 3300005614 | Bacteria | 2601 |
| 143 | Ga0068852_100001366 | 3300005616 | Bacteria | 16380 |
| 144 | Ga0068852_100010723 | 3300005616 | Bacteria | 6862 |
| 145 | Ga0068852_100037806 | 3300005616 | Bacteria | 4051 |
| 146 | Ga0068852_100438587 | 3300005616 | Bacteria | 1291 |
| 147 | Ga0068852_101486642 | 3300005616 | Bacteria | 700 |
| 148 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 149 | Ga0068859_100000859 | 3300005617 | Bacteria | 30939 |
| 150 | Ga0068859_100036347 | 3300005617 | Unclassified | 4945 |
| 151 | Ga0068859_101206227 | 3300005617 | Bacteria | 833 |
| 152 | Ga0068864_100001631 | 3300005618 | Bacteria | 18493 |
| 153 | Ga0068864_100090627 | 3300005618 | Bacteria | 2696 |
| 154 | Ga0068864_100093958 | 3300005618 | Bacteria | 2649 |
| 155 | Ga0068864_100357736 | 3300005618 | Unclassified | 1379 |
| 156 | Ga0068861_100018572 | 3300005719 | Bacteria | 4954 |
| 157 | Ga0068861_100270920 | 3300005719 | Unclassified | 1458 |
| 158 | Ga0068861_100374350 | 3300005719 | Unclassified | 1256 |
| 159 | Ga0068851_10086913 | 3300005834 | Bacteria | 1641 |
| 160 | Ga0068851_10160689 | 3300005834 | Unclassified | 1234 |
| 161 | Ga0068870_10009345 | 3300005840 | Bacteria | 4455 |
| 162 | Ga0068863_100004540 | 3300005841 | Bacteria | 13688 |
| 163 | Ga0068863_100070683 | 3300005841 | Bacteria | 3301 |
| 164 | Ga0068863_100091351 | 3300005841 | Bacteria | 2887 |
| 165 | Ga0068858_100002842 | 3300005842 | Bacteria | 17411 |
| 166 | Ga0068858_100004312 | 3300005842 | Bacteria | 13973 |
| 167 | Ga0068858_100051614 | 3300005842 | Bacteria | 3805 |
| 168 | Ga0068858_100267988 | 3300005842 | Bacteria | 1624 |
| 169 | Ga0068860_100000591 | 3300005843 | Bacteria | 43327 |
| 170 | Ga0068860_100000759 | 3300005843 | Bacteria | 36404 |
| 171 | Ga0068860_100004454 | 3300005843 | Bacteria | 14291 |
| 172 | Ga0068860_100454305 | 3300005843 | Bacteria | 1274 |
| 173 | Ga0068860_100760529 | 3300005843 | Bacteria | 981 |
| 174 | Ga0068860_101559185 | 3300005843 | Bacteria | 682 |
| 175 | Ga0068862_100002919 | 3300005844 | Bacteria | 14939 |
| 176 | Ga0068862_100420176 | 3300005844 | Bacteria | 1254 |
| 177 | Ga0068862_100960475 | 3300005844 | Bacteria | 843 |
| 178 | Ga0081539_10011193 | 3300005985 | Bacteria | 7142 |
| 179 | Ga0070715_10054110 | 3300006163 | Bacteria | 1737 |
| 180 | Ga0075366_10030210 | 3300006195 | Bacteria | 3184 |
| 181 | Ga0075366_10756499 | 3300006195 | Bacteria | 604 |
| 182 | Ga0097621_100000821 | 3300006237 | Bacteria | 21965 |
| 183 | Ga0097621_100001193 | 3300006237 | Bacteria | 18002 |
| 184 | Ga0097621_100041626 | 3300006237 | Bacteria | 3698 |
| 185 | Ga0068871_100002803 | 3300006358 | Bacteria | 11921 |
| 186 | Ga0068871_100004016 | 3300006358 | Bacteria | 10166 |
| 187 | Ga0068871_100014257 | 3300006358 | Bacteria | 5919 |
| 188 | Ga0068871_100045150 | 3300006358 | Bacteria | 3545 |
| 189 | Ga0068871_100116767 | 3300006358 | Bacteria | 2250 |
| 190 | Ga0068871_100135701 | 3300006358 | Unclassified | 2090 |
| 191 | Ga0068871_100159409 | 3300006358 | Unclassified | 1929 |
| 192 | Ga0068865_100014490 | 3300006881 | Bacteria | 5010 |
| 193 | Ga0068865_100135868 | 3300006881 | Bacteria | 1848 |
| 194 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 195 | Ga0097620_100000859 | 3300006931 | Bacteria | 30939 |
| 196 | Ga0097620_100036347 | 3300006931 | Unclassified | 4945 |
| 197 | Ga0097620_101206365 | 3300006931 | Bacteria | 833 |
| 198 | Ga0105251_10113426 | 3300009011 | Bacteria | 1234 |
| 199 | Ga0105240_10020001 | 3300009093 | Bacteria | 8937 |
| 200 | Ga0105240_10043919 | 3300009093 | Bacteria | 5683 |
| 201 | Ga0105240_10060041 | 3300009093 | Unclassified | 4742 |
| 202 | Ga0105240_10096978 | 3300009093 | Bacteria | 3593 |
| 203 | Ga0105240_10335714 | 3300009093 | Unclassified | 1718 |
| 204 | Ga0105240_10657065 | 3300009093 | Bacteria | 1148 |
| 205 | Ga0111539_10002870 | 3300009094 | Bacteria | 22880 |
| 206 | Ga0111539_10126701 | 3300009094 | Bacteria | 2991 |
| 207 | Ga0111539_10474867 | 3300009094 | Bacteria | 1456 |
| 208 | Ga0105247_10088673 | 3300009101 | Bacteria | 1960 |
| 209 | Ga0114129_10013606 | 3300009147 | Bacteria | 11594 |
| 210 | Ga0105243_10495177 | 3300009148 | Unclassified | 1157 |
| 211 | Ga0105241_10007669 | 3300009174 | Bacteria | 7933 |
| 212 | Ga0105241_10028708 | 3300009174 | Bacteria | 4146 |
| 213 | Ga0105241_10065769 | 3300009174 | Bacteria | 2802 |
| 214 | Ga0105241_10078841 | 3300009174 | Bacteria | 2574 |
| 215 | Ga0105241_10409374 | 3300009174 | Unclassified | 1191 |
| 216 | Ga0105241_10552600 | 3300009174 | Bacteria | 1034 |
| 217 | Ga0105242_10046854 | 3300009176 | Bacteria | 3509 |
| 218 | Ga0105242_10075872 | 3300009176 | Bacteria | 2800 |
| 219 | Ga0105248_11049674 | 3300009177 | Bacteria | 921 |
| 220 | Ga0105248_11200624 | 3300009177 | Bacteria | 858 |
| 221 | Ga0105237_10000783 | 3300009545 | Bacteria | 43494 |
| 222 | Ga0105237_10021003 | 3300009545 | Bacteria | 6719 |
| 223 | Ga0105237_10080474 | 3300009545 | Bacteria | 3248 |
| 224 | Ga0105237_10130840 | 3300009545 | Bacteria | 2504 |
| 225 | Ga0105238_10113628 | 3300009551 | Bacteria | 2687 |
| 226 | Ga0105249_10000382 | 3300009553 | Bacteria | 44030 |
| 227 | Ga0105249_10012057 | 3300009553 | Bacteria | 7608 |
| 228 | Ga0105249_10031497 | 3300009553 | Unclassified | 4797 |
| 229 | Ga0105249_10261437 | 3300009553 | Bacteria | 1720 |
| 230 | Ga0105239_10005033 | 3300010375 | Bacteria | 15606 |
| 231 | Ga0105239_10022820 | 3300010375 | Bacteria | 6899 |
| 232 | Ga0105239_10051119 | 3300010375 | Bacteria | 4531 |
| 233 | Ga0105239_10274624 | 3300010375 | Bacteria | 1896 |
| 234 | Ga0105239_10479181 | 3300010375 | Bacteria | 1414 |
| 235 | Ga0105239_10560448 | 3300010375 | Bacteria | 1301 |
| 236 | Ga0105239_10562102 | 3300010375 | Unclassified | 1300 |
| 237 | Ga0157373_10348979 | 3300013100 | Bacteria | 1055 |
| 238 | Ga0157371_10004208 | 3300013102 | Bacteria | 12666 |
| 239 | Ga0157371_10033076 | 3300013102 | Bacteria | 3717 |
| 240 | Ga0157371_10301283 | 3300013102 | Bacteria | 1160 |
| 241 | Ga0157371_10321055 | 3300013102 | Unclassified | 1124 |
| 242 | Ga0157370_10000526 | 3300013104 | Bacteria | 47828 |
| 243 | Ga0157370_10003149 | 3300013104 | Bacteria | 19547 |
| 244 | Ga0157370_10098956 | 3300013104 | Bacteria | 2734 |
| 245 | Ga0157370_10278657 | 3300013104 | Bacteria | 1545 |
| 246 | Ga0157370_10834577 | 3300013104 | Bacteria | 838 |
| 247 | Ga0157369_10015290 | 3300013105 | Bacteria | 8654 |
| 248 | Ga0157369_10479006 | 3300013105 | Bacteria | 1288 |
| 249 | Ga0157374_10000627 | 3300013296 | Bacteria | 31113 |
| 250 | Ga0157374_10040230 | 3300013296 | Bacteria | 4304 |
| 251 | Ga0157374_10059540 | 3300013296 | Bacteria | 3572 |
| 252 | Ga0157374_10150263 | 3300013296 | Unclassified | 2264 |
| 253 | Ga0157374_10354881 | 3300013296 | Bacteria | 1457 |
| 254 | Ga0157374_10675667 | 3300013296 | Bacteria | 1045 |
| 255 | Ga0157374_11092791 | 3300013296 | Bacteria | 818 |
| 256 | Ga0157378_10005519 | 3300013297 | Bacteria | 11081 |
| 257 | Ga0157378_10060645 | 3300013297 | Bacteria | 3375 |
| 258 | Ga0157378_10142534 | 3300013297 | Bacteria | 2226 |
| 259 | Ga0157378_10374710 | 3300013297 | Unclassified | 1396 |
| 260 | Ga0157378_10536178 | 3300013297 | Unclassified | 1174 |
| 261 | Ga0157378_10693772 | 3300013297 | Bacteria | 1037 |
| 262 | Ga0157378_11647502 | 3300013297 | Bacteria | 688 |
| 263 | Ga0163162_10000752 | 3300013306 | Bacteria | 30172 |
| 264 | Ga0163162_10001770 | 3300013306 | Bacteria | 20242 |
| 265 | Ga0163162_10002582 | 3300013306 | Bacteria | 17141 |
| 266 | Ga0163162_10014638 | 3300013306 | Bacteria | 7663 |
| 267 | Ga0163162_10038942 | 3300013306 | Bacteria | 4747 |
| 268 | Ga0163162_10294261 | 3300013306 | Unclassified | 1755 |
| 269 | Ga0163162_10424049 | 3300013306 | Unclassified | 1462 |
| 270 | Ga0163162_10660586 | 3300013306 | Bacteria | 1169 |
| 271 | Ga0157372_10025872 | 3300013307 | Bacteria | 6382 |
| 272 | Ga0157372_10050274 | 3300013307 | Bacteria | 4637 |
| 273 | Ga0157372_10067425 | 3300013307 | Bacteria | 4021 |
| 274 | Ga0157372_10116837 | 3300013307 | Bacteria | 3059 |
| 275 | Ga0157372_10158595 | 3300013307 | Unclassified | 2614 |
| 276 | Ga0157372_10338705 | 3300013307 | Unclassified | 1752 |
| 277 | Ga0157372_10484414 | 3300013307 | Bacteria | 1442 |
| 278 | Ga0157372_10678028 | 3300013307 | Bacteria | 1200 |
| 279 | Ga0157372_10811678 | 3300013307 | Bacteria | 1087 |
| 280 | Ga0157372_11310325 | 3300013307 | Bacteria | 836 |
| 281 | Ga0157372_11853703 | 3300013307 | Bacteria | 693 |
| 282 | Ga0157375_10000098 | 3300013308 | Bacteria | 88130 |
| 283 | Ga0157375_10025649 | 3300013308 | Bacteria | 5482 |
| 284 | Ga0157375_10038531 | 3300013308 | Bacteria | 4589 |
| 285 | Ga0157375_10065145 | 3300013308 | Unclassified | 3631 |
| 286 | Ga0157375_10105638 | 3300013308 | Unclassified | 2907 |
| 287 | Ga0157375_10115063 | 3300013308 | Bacteria | 2792 |
| 288 | Ga0157375_10179529 | 3300013308 | Bacteria | 2268 |
| 289 | Ga0157375_10319680 | 3300013308 | Unclassified | 1717 |
| 290 | Ga0163163_10000272 | 3300014325 | Bacteria | 51699 |
| 291 | Ga0163163_10007094 | 3300014325 | Bacteria | 9851 |
| 292 | Ga0163163_10045086 | 3300014325 | Bacteria | 4327 |
| 293 | Ga0163163_10114381 | 3300014325 | Bacteria | 2729 |
| 294 | Ga0163163_10758555 | 3300014325 | Bacteria | 1034 |
| 295 | Ga0157380_10001666 | 3300014326 | Bacteria | 14658 |
| 296 | Ga0157380_10005979 | 3300014326 | Bacteria | 8515 |
| 297 | Ga0157380_10641542 | 3300014326 | Bacteria | 1058 |
| 298 | Ga0157377_10000309 | 3300014745 | Bacteria | 22464 |
| 299 | Ga0157377_10002499 | 3300014745 | Bacteria | 8141 |
| 300 | Ga0157377_10011657 | 3300014745 | Bacteria | 4395 |
| 301 | Ga0157377_10075528 | 3300014745 | Unclassified | 1957 |
| 302 | Ga0157379_10000103 | 3300014968 | Bacteria | 58102 |
| 303 | Ga0157379_10009802 | 3300014968 | Bacteria | 8347 |
| 304 | Ga0157379_10072143 | 3300014968 | Unclassified | 3089 |
| 305 | Ga0157379_10176400 | 3300014968 | Bacteria | 1930 |
| 306 | Ga0157376_10000286 | 3300014969 | Bacteria | 34101 |
| 307 | Ga0157376_10055088 | 3300014969 | Unclassified | 3317 |
| 308 | Ga0157376_10218478 | 3300014969 | Bacteria | 1764 |
| 309 | Ga0157376_10226300 | 3300014969 | Bacteria | 1735 |
| 310 | Ga0157376_10226557 | 3300014969 | Bacteria | 1734 |
| 311 | Ga0157376_10227705 | 3300014969 | Unclassified | 1730 |
| 312 | Ga0157376_10650684 | 3300014969 | Bacteria | 1054 |
| 313 | Ga0163161_10014989 | 3300017792 | Bacteria | 5401 |
| 314 | Ga0163161_10054658 | 3300017792 | Bacteria | 2898 |
| 315 | Ga0163161_10062763 | 3300017792 | Bacteria | 2707 |
| 316 | Ga0163161_10074880 | 3300017792 | Bacteria | 2483 |
| 317 | Ga0209646_1002334 | 3300025246 | Bacteria | 4296 |
| 318 | Ga0207656_10000540 | 3300025321 | Bacteria | 12542 |
| 319 | Ga0207656_10040022 | 3300025321 | Bacteria | 1986 |
| 320 | Ga0207682_10092091 | 3300025893 | Bacteria | 1316 |
| 321 | Ga0207710_10252505 | 3300025900 | Bacteria | 882 |
| 322 | Ga0207688_10110052 | 3300025901 | Bacteria | 1598 |
| 323 | Ga0207680_10167578 | 3300025903 | Bacteria | 1477 |
| 324 | Ga0207680_10247035 | 3300025903 | Bacteria | 1231 |
| 325 | Ga0207680_10252699 | 3300025903 | Unclassified | 1218 |
| 326 | Ga0207685_10204161 | 3300025905 | Unclassified | 930 |
| 327 | Ga0207645_10001904 | 3300025907 | Bacteria | 16844 |
| 328 | Ga0207645_10010821 | 3300025907 | Bacteria | 6252 |
| 329 | Ga0207645_10065794 | 3300025907 | Bacteria | 2317 |
| 330 | Ga0207645_10068295 | 3300025907 | Bacteria | 2273 |
| 331 | Ga0207643_10034493 | 3300025908 | Unclassified | 2835 |
| 332 | Ga0207705_10047558 | 3300025909 | Bacteria | 3085 |
| 333 | Ga0207705_10141763 | 3300025909 | Bacteria | 1795 |
| 334 | Ga0207705_10330929 | 3300025909 | Bacteria | 1171 |
| 335 | Ga0207705_10629668 | 3300025909 | Bacteria | 834 |
| 336 | Ga0207654_10032859 | 3300025911 | Bacteria | 2871 |
| 337 | Ga0207654_10241864 | 3300025911 | Unclassified | 1206 |
| 338 | Ga0207654_10347736 | 3300025911 | Bacteria | 1020 |
| 339 | Ga0207654_10906008 | 3300025911 | Unclassified | 639 |
| 340 | Ga0207707_10000160 | 3300025912 | Bacteria | 70695 |
| 341 | Ga0207695_10006273 | 3300025913 | Bacteria | 15478 |
| 342 | Ga0207695_10042989 | 3300025913 | Bacteria | 4819 |
| 343 | Ga0207695_10077416 | 3300025913 | Bacteria | 3378 |
| 344 | Ga0207695_10217270 | 3300025913 | Bacteria | 1820 |
| 345 | Ga0207695_10338890 | 3300025913 | Bacteria | 1391 |
| 346 | Ga0207671_10015537 | 3300025914 | Bacteria | 5954 |
| 347 | Ga0207671_10154433 | 3300025914 | Bacteria | 1775 |
| 348 | Ga0207660_10004570 | 3300025917 | Bacteria | 9015 |
| 349 | Ga0207660_10129544 | 3300025917 | Bacteria | 1919 |
| 350 | Ga0207662_10014592 | 3300025918 | Bacteria | 4411 |
| 351 | Ga0207662_10343136 | 3300025918 | Bacteria | 1001 |
| 352 | Ga0207657_10129481 | 3300025919 | Bacteria | 2070 |
| 353 | Ga0207657_10257925 | 3300025919 | Bacteria | 1388 |
| 354 | Ga0207657_10320349 | 3300025919 | Bacteria | 1226 |
| 355 | Ga0207649_10253094 | 3300025920 | Bacteria | 1269 |
| 356 | Ga0207652_10000108 | 3300025921 | Bacteria | 90141 |
| 357 | Ga0207652_10000346 | 3300025921 | Bacteria | 48060 |
| 358 | Ga0207652_10020113 | 3300025921 | Bacteria | 5497 |
| 359 | Ga0207652_10052631 | 3300025921 | Bacteria | 3495 |
| 360 | Ga0207652_10214910 | 3300025921 | Bacteria | 1732 |
| 361 | Ga0207681_10202264 | 3300025923 | Unclassified | 1526 |
| 362 | Ga0207681_10574780 | 3300025923 | Bacteria | 929 |
| 363 | Ga0207681_10895064 | 3300025923 | Unclassified | 743 |
| 364 | Ga0207694_11301844 | 3300025924 | Unclassified | 615 |
| 365 | Ga0207650_10375590 | 3300025925 | Bacteria | 1173 |
| 366 | Ga0207659_10183491 | 3300025926 | Bacteria | 1660 |
| 367 | Ga0207659_10331637 | 3300025926 | Bacteria | 1258 |
| 368 | Ga0207644_10117256 | 3300025931 | Bacteria | 2022 |
| 369 | Ga0207644_10937546 | 3300025931 | Unclassified | 726 |
| 370 | Ga0207644_11155539 | 3300025931 | Bacteria | 651 |
| 371 | Ga0207644_11347911 | 3300025931 | Bacteria | 599 |
| 372 | Ga0207690_10024864 | 3300025932 | Bacteria | 3755 |
| 373 | Ga0207690_10157582 | 3300025932 | Bacteria | 1689 |
| 374 | Ga0207690_10231282 | 3300025932 | Bacteria | 1419 |
| 375 | Ga0207706_10014866 | 3300025933 | Bacteria | 7048 |
| 376 | Ga0207706_10031145 | 3300025933 | Bacteria | 4754 |
| 377 | Ga0207706_10298912 | 3300025933 | Bacteria | 1403 |
| 378 | Ga0207686_10180685 | 3300025934 | Bacteria | 1496 |
| 379 | Ga0207670_10115994 | 3300025936 | Bacteria | 1938 |
| 380 | Ga0207670_10244675 | 3300025936 | Bacteria | 1383 |
| 381 | Ga0207670_10364625 | 3300025936 | Bacteria | 1147 |
| 382 | Ga0207670_10805275 | 3300025936 | Bacteria | 783 |
| 383 | Ga0207669_10020099 | 3300025937 | Bacteria | 3493 |
| 384 | Ga0207669_11073116 | 3300025937 | Bacteria | 679 |
| 385 | Ga0207704_10031376 | 3300025938 | Bacteria | 2993 |
| 386 | Ga0207704_10134838 | 3300025938 | Bacteria | 1717 |
| 387 | Ga0207691_10000154 | 3300025940 | Bacteria | 64281 |
| 388 | Ga0207691_10049077 | 3300025940 | Bacteria | 3868 |
| 389 | Ga0207691_10055181 | 3300025940 | Unclassified | 3622 |
| 390 | Ga0207711_11201057 | 3300025941 | Bacteria | 700 |
| 391 | Ga0207689_10033435 | 3300025942 | Bacteria | 4273 |
| 392 | Ga0207689_10093738 | 3300025942 | Unclassified | 2466 |
| 393 | Ga0207689_10144577 | 3300025942 | Bacteria | 1959 |
| 394 | Ga0207689_10580097 | 3300025942 | Bacteria | 943 |
| 395 | Ga0207661_10001233 | 3300025944 | Bacteria | 17127 |
| 396 | Ga0207661_10129095 | 3300025944 | Bacteria | 2163 |
| 397 | Ga0207661_10137080 | 3300025944 | Bacteria | 2103 |
| 398 | Ga0207661_10197835 | 3300025944 | Bacteria | 1766 |
| 399 | Ga0207661_11407214 | 3300025944 | Bacteria | 640 |
| 400 | Ga0207679_10000927 | 3300025945 | Bacteria | 18727 |
| 401 | Ga0207679_10049087 | 3300025945 | Bacteria | 3077 |
| 402 | Ga0207679_10086199 | 3300025945 | Bacteria | 2415 |
| 403 | Ga0207679_10180904 | 3300025945 | Bacteria | 1744 |
| 404 | Ga0207679_10427396 | 3300025945 | Bacteria | 1170 |
| 405 | Ga0207679_10433834 | 3300025945 | Bacteria | 1162 |
| 406 | Ga0207667_10005756 | 3300025949 | Bacteria | 15128 |
| 407 | Ga0207667_10029528 | 3300025949 | Bacteria | 5946 |
| 408 | Ga0207667_10188463 | 3300025949 | Unclassified | 2117 |
| 409 | Ga0207667_10297170 | 3300025949 | Bacteria | 1650 |
| 410 | Ga0207651_10002052 | 3300025960 | Bacteria | 9478 |
| 411 | Ga0207651_10140706 | 3300025960 | Bacteria | 1863 |
| 412 | Ga0207651_10343950 | 3300025960 | Bacteria | 1254 |
| 413 | Ga0207712_10025595 | 3300025961 | Unclassified | 3922 |
| 414 | Ga0207712_10124481 | 3300025961 | Bacteria | 1955 |
| 415 | Ga0207712_10287939 | 3300025961 | Unclassified | 1343 |
| 416 | Ga0207668_10001109 | 3300025972 | Bacteria | 16020 |
| 417 | Ga0207668_10088965 | 3300025972 | Bacteria | 2263 |
| 418 | Ga0207668_10102660 | 3300025972 | Bacteria | 2128 |
| 419 | Ga0207668_10120358 | 3300025972 | Bacteria | 1987 |
| 420 | Ga0207668_10381315 | 3300025972 | Bacteria | 1187 |
| 421 | Ga0207640_10577038 | 3300025981 | Bacteria | 949 |
| 422 | Ga0207640_10643628 | 3300025981 | Unclassified | 902 |
| 423 | Ga0207640_10830241 | 3300025981 | Bacteria | 803 |
| 424 | Ga0207658_10000570 | 3300025986 | Bacteria | 33415 |
| 425 | Ga0207658_10022942 | 3300025986 | Bacteria | 4350 |
| 426 | Ga0207658_10204637 | 3300025986 | Bacteria | 1650 |
| 427 | Ga0207658_10223522 | 3300025986 | Bacteria | 1585 |
| 428 | Ga0207658_10234132 | 3300025986 | Bacteria | 1552 |
| 429 | Ga0207677_10015213 | 3300026023 | Bacteria | 4517 |
| 430 | Ga0207677_10073265 | 3300026023 | Bacteria | 2424 |
| 431 | Ga0207677_10139529 | 3300026023 | Bacteria | 1854 |
| 432 | Ga0207677_10163276 | 3300026023 | Bacteria | 1733 |
| 433 | Ga0207677_10202127 | 3300026023 | Unclassified | 1580 |
| 434 | Ga0207703_10000883 | 3300026035 | Bacteria | 29482 |
| 435 | Ga0207703_10032255 | 3300026035 | Bacteria | 4145 |
| 436 | Ga0207639_10000837 | 3300026041 | Bacteria | 20872 |
| 437 | Ga0207639_10003361 | 3300026041 | Bacteria | 10760 |
| 438 | Ga0207639_10004478 | 3300026041 | Bacteria | 9430 |
| 439 | Ga0207639_10046112 | 3300026041 | Bacteria | 3287 |
| 440 | Ga0207639_10057721 | 3300026041 | Bacteria | 2982 |
| 441 | Ga0207639_10215096 | 3300026041 | Bacteria | 1657 |
| 442 | Ga0207639_10490562 | 3300026041 | Bacteria | 1121 |
| 443 | Ga0207678_10180210 | 3300026067 | Unclassified | 1804 |
| 444 | Ga0207678_10901456 | 3300026067 | Bacteria | 782 |
| 445 | Ga0207708_10144907 | 3300026075 | Bacteria | 1866 |
| 446 | Ga0207702_10244763 | 3300026078 | Bacteria | 1682 |
| 447 | Ga0207702_10513438 | 3300026078 | Bacteria | 1169 |
| 448 | Ga0207641_10009123 | 3300026088 | Bacteria | 8191 |
| 449 | Ga0207641_10235769 | 3300026088 | Bacteria | 1703 |
| 450 | Ga0207648_10004750 | 3300026089 | Bacteria | 13885 |
| 451 | Ga0207648_10013015 | 3300026089 | Bacteria | 7761 |
| 452 | Ga0207648_10047452 | 3300026089 | Bacteria | 3765 |
| 453 | Ga0207648_10056597 | 3300026089 | Bacteria | 3422 |
| 454 | Ga0207648_10263192 | 3300026089 | Unclassified | 1539 |
| 455 | Ga0207648_10556297 | 3300026089 | Bacteria | 1054 |
| 456 | Ga0207648_10657785 | 3300026089 | Bacteria | 969 |
| 457 | Ga0207648_10753525 | 3300026089 | Bacteria | 904 |
| 458 | Ga0207676_10000948 | 3300026095 | Bacteria | 22386 |
| 459 | Ga0207676_10136719 | 3300026095 | Bacteria | 2092 |
| 460 | Ga0207674_10004662 | 3300026116 | Bacteria | 16459 |
| 461 | Ga0207674_10009039 | 3300026116 | Bacteria | 11445 |
| 462 | Ga0207674_10034432 | 3300026116 | Bacteria | 5293 |
| 463 | Ga0207674_10369895 | 3300026116 | Bacteria | 1386 |
| 464 | Ga0207674_10398930 | 3300026116 | Bacteria | 1329 |
| 465 | Ga0207675_100000655 | 3300026118 | Bacteria | 34051 |
| 466 | Ga0207675_100228161 | 3300026118 | Bacteria | 1796 |
| 467 | Ga0207675_100378090 | 3300026118 | Unclassified | 1392 |
| 468 | Ga0207675_100816659 | 3300026118 | Bacteria | 946 |
| 469 | Ga0207683_10097030 | 3300026121 | Bacteria | 2628 |
| 470 | Ga0207683_10102963 | 3300026121 | Bacteria | 2550 |
| 471 | Ga0207683_10179196 | 3300026121 | Bacteria | 1921 |
| 472 | Ga0207683_10469333 | 3300026121 | Bacteria | 1161 |
| 473 | Ga0207698_10024765 | 3300026142 | Bacteria | 4218 |
| 474 | Ga0207698_10133092 | 3300026142 | Bacteria | 2128 |
| 475 | Ga0207698_10221436 | 3300026142 | Bacteria | 1710 |
| 476 | Ga0207698_10400217 | 3300026142 | Bacteria | 1312 |
| 477 | Ga0207698_11465172 | 3300026142 | Bacteria | 698 |
| 478 | Ga0207698_11481689 | 3300026142 | Bacteria | 694 |
| 479 | Ga0207428_10314989 | 3300027907 | Bacteria | 1156 |
| 480 | Ga0268266_10000986 | 3300028379 | Bacteria | 35861 |
| 481 | Ga0268266_10475280 | 3300028379 | Unclassified | 1191 |
| 482 | Ga0268265_10065613 | 3300028380 | Unclassified | 2802 |
| 483 | Ga0268265_11264255 | 3300028380 | Bacteria | 737 |
| 484 | Ga0268264_10001126 | 3300028381 | Bacteria | 26251 |
| 485 | Ga0268264_10008368 | 3300028381 | Bacteria | 8599 |
| 486 | Ga0268264_10014848 | 3300028381 | Bacteria | 6397 |
| 487 | Ga0268264_10397215 | 3300028381 | Unclassified | 1324 |
| 488 | Ga0265327_10000022 | 3300031251 | Bacteria | 402724 |
| 489 | Ga0307513_10139436 | 3300031456 | Bacteria | 2354 |
| 490 | Ga0307513_10143280 | 3300031456 | Bacteria | 2312 |
| 491 | Ga0307513_10192880 | 3300031456 | Bacteria | 1887 |
| 492 | Ga0307509_10009531 | 3300031507 | Bacteria | 12104 |
| 493 | Ga0307509_10011098 | 3300031507 | Bacteria | 10971 |
| 494 | Ga0307408_100140067 | 3300031548 | Bacteria | 1898 |
| 495 | Ga0307508_10000181 | 3300031616 | Bacteria | 76433 |
| 496 | Ga0307405_10456026 | 3300031731 | Bacteria | 1015 |
| 497 | Ga0307413_10037934 | 3300031824 | Bacteria | 2788 |
| 498 | Ga0307406_10420835 | 3300031901 | Bacteria | 1064 |
| 499 | Ga0307406_10832403 | 3300031901 | Bacteria | 781 |
| 500 | Ga0307412_10486972 | 3300031911 | Bacteria | 1024 |
| 501 | Ga0307416_100047859 | 3300032002 | Bacteria | 3388 |
| 502 | Ga0307414_10084974 | 3300032004 | Bacteria | 2330 |
| 503 | Ga0307411_10299046 | 3300032005 | Bacteria | 1290 |
| 504 | Ga0373924_0045673 | 3300035410 | Bacteria | 1802 |
| 505 | Ga0373935_0332142 | 3300035692 | Unclassified | 1081 |
| 506 | Ga0373935_0740890 | 3300035692 | Bacteria | 724 |
| 507 | Ga0373937_0110017 | 3300036401 | Bacteria | 2562 |
| 508 | Ga0395899_0018080 | 3300037312 | Bacteria | 5365 |
| 509 | Ga0395899_0018960 | 3300037312 | Bacteria | 5228 |
| 510 | Ga0395900_0000573 | 3300037418 | Bacteria | 50934 |
| 511 | Ga0395900_0006676 | 3300037418 | Bacteria | 11989 |
| 512 | Ga0395900_0787397 | 3300037418 | Bacteria | 879 |
| 513 | Ga0395898_0033959 | 3300037466 | Bacteria | 5088 |
| 514 | Ga0395901_0001343 | 3300038443 | Bacteria | 25786 |
| 515 | Ga0395901_0407643 | 3300038443 | Bacteria | 1396 |
| 516 | Ga0439436_0014062 | 3300041404 | Bacteria | 2419 |
| 517 | Ga0439436_0072307 | 3300041404 | Bacteria | 961 |
| 518 | Ga0451793_1150992 | 3300041452 | Unclassified | 737 |
| 519 | Ga0451847_0935001 | 3300041503 | Bacteria | 694 |
| 520 | Ga0451843_0975489 | 3300041509 | Bacteria | 762 |
| 521 | Ga0439431_0000688 | 3300041997 | Bacteria | 7272 |
| 522 | Ga0439445_0009926 | 3300042004 | Bacteria | 2247 |
| 523 | Ga0439449_0008171 | 3300042007 | Bacteria | 3978 |
| 524 | Ga0439457_000159 | 3300042014 | Bacteria | 17442 |
| 525 | Ga0439457_006130 | 3300042014 | Bacteria | 2968 |
| 526 | Ga0439457_067419 | 3300042014 | Bacteria | 814 |
| 527 | Ga0451577_0077388 | 3300042876 | Unclassified | 2966 |
| 528 | Ga0466969_0002159 | 3300044656 | Bacteria | 10497 |
| 529 | Ga0466972_0004850 | 3300044658 | Bacteria | 6745 |
| 530 | Ga0453683_0024956 | 3300044673 | Unclassified | 3799 |
| 531 | Ga0466966_0000476 | 3300044684 | Bacteria | 25812 |
| 532 | Ga0453684_0001960 | 3300044712 | Bacteria | 53054 |
| 533 | Ga0453684_0020539 | 3300044712 | Bacteria | 9951 |
| 534 | Ga0453684_0036627 | 3300044712 | Bacteria | 6757 |
| 535 | Ga0466971_0284766 | 3300044719 | Bacteria | 791 |
| 536 | Ga0466960_0093685 | 3300044901 | Bacteria | 1535 |
| 537 | Ga0466959_0000196 | 3300045049 | Bacteria | 39994 |
| 538 | Ga0451576_0004672 | 3300045051 | Bacteria | 17636 |
| 539 | Ga0451576_0017853 | 3300045051 | Bacteria | 7793 |
| 540 | Ga0495629_0066297 | 3300046459 | Bacteria | 2520 |
| 541 | Ga0495638_0206055 | 3300046460 | Bacteria | 1107 |
| 542 | Ga0495653_0104419 | 3300046463 | Bacteria | 2048 |
| 543 | Ga0495653_0280283 | 3300046463 | Unclassified | 1094 |
| 544 | Ga0495580_0195549 | 3300046472 | Bacteria | 1394 |
| 545 | Ga0495580_0291319 | 3300046472 | Bacteria | 1113 |
| 546 | Ga0495608_0078140 | 3300046511 | Bacteria | 2154 |
| 547 | Ga0495628_0850492 | 3300046516 | Bacteria | 636 |
| 548 | Ga0495630_0093040 | 3300046517 | Bacteria | 2279 |
| 549 | Ga0495652_0203485 | 3300046529 | Bacteria | 1501 |
| 550 | Ga0495665_0420781 | 3300046531 | Unclassified | 677 |
| 551 | Ga0495587_0067386 | 3300046536 | Bacteria | 2087 |
| 552 | Ga0495667_0090797 | 3300046559 | Bacteria | 1979 |
| 553 | Ga0495668_0004021 | 3300046616 | Bacteria | 10705 |
| 554 | Ga0495634_0459554 | 3300046642 | Bacteria | 750 |
| 555 | Ga0495625_0280655 | 3300046660 | Bacteria | 1072 |
| 556 | Ga0495646_0276153 | 3300046680 | Unclassified | 894 |
| 557 | Ga0495647_0306968 | 3300046681 | Unclassified | 716 |
| 558 | Ga0495658_0007718 | 3300046683 | Bacteria | 5331 |
| 559 | Ga0495600_0074639 | 3300046809 | Bacteria | 2215 |
| 560 | Ga0495636_0000121 | 3300047318 | Bacteria | 32451 |
| 561 | Ga0495674_0242412 | 3300047319 | Bacteria | 1485 |
| 562 | Ga0495674_0475288 | 3300047319 | Bacteria | 1002 |
| 563 | Ga0495672_0026716 | 3300047320 | Bacteria | 3679 |
| 564 | Ga0495672_0030355 | 3300047320 | Bacteria | 3393 |
| 565 | Ga0495684_0801035 | 3300047471 | Unclassified | 615 |
| 566 | Ga0495602_0354147 | 3300048088 | Bacteria | 1059 |
| 567 | Ga0496105_0091693 | 3300048908 | Bacteria | 2509 |
| 568 | Ga0501032_0030108 | 3300049569 | Bacteria | 3723 |
| 569 | Ga0501033_0008685 | 3300049570 | Bacteria | 7859 |
| 570 | Ga0501033_0461063 | 3300049570 | Bacteria | 882 |
| 571 | Ga0501034_0001589 | 3300049571 | Bacteria | 29569 |
| 572 | Ga0501034_0067436 | 3300049571 | Bacteria | 3591 |
| 573 | Ga0501034_0274010 | 3300049571 | Bacteria | 1628 |
| 574 | Ga0501037_0049897 | 3300049573 | Unclassified | 3064 |
| 575 | Ga0501047_0002822 | 3300049581 | Bacteria | 16494 |
| 576 | Ga0501070_0153719 | 3300049586 | Bacteria | 1898 |
| 577 | Ga0501201_009319 | 3300049651 | Bacteria | 954 |
| 578 | Ga0501202_003246 | 3300049652 | Bacteria | 2777 |
| 579 | Ga0501207_004750 | 3300049654 | Bacteria | 1860 |
| 580 | Ga0501223_042946 | 3300049663 | Bacteria | 877 |
| 581 | Ga0501224_016900 | 3300049664 | Bacteria | 1084 |
| 582 | Ga0501235_008052 | 3300049669 | Bacteria | 2298 |
| 583 | Ga0501243_017692 | 3300049675 | Bacteria | 1157 |
| 584 | Ga0501252_021828 | 3300049682 | Bacteria | 842 |
| 585 | Ga0501255_004998 | 3300049684 | Bacteria | 1308 |
| 586 | Ga0501257_116858 | 3300049686 | Bacteria | 711 |
| 587 | Ga0501219_000226 | 3300049703 | Bacteria | 10710 |
| 588 | Ga0501225_0097778 | 3300049705 | Bacteria | 855 |
| 589 | Ga0501234_008456 | 3300049707 | Bacteria | 1603 |
| 590 | Ga0501245_031088 | 3300049708 | Bacteria | 883 |
| 591 | Ga0501083_0057910 | 3300049744 | Bacteria | 2593 |
| 592 | Ga0501266_003887 | 3300049763 | Bacteria | 1850 |
| 593 | Ga0501035_0017448 | 3300049822 | Bacteria | 6621 |
| 594 | Ga0501035_0445353 | 3300049822 | Bacteria | 1072 |
| 595 | Ga0501044_0017697 | 3300049823 | Bacteria | 7644 |
| 596 | Ga0501284_00046 | 3300050005 | Bacteria | 47876 |
| 597 | nmdc:mga0k408_39018_c1 | 3300050493 | Bacteria | 2727 |
| 598 | nmdc:mga05p37_6703_c1 | 3300050507 | Bacteria | 13569 |
| 599 | nmdc:mga06r32_23414_c1 | 3300050510 | Bacteria | 5713 |
| 600 | nmdc:mga08y16_301684_c1 | 3300050511 | Bacteria | 1651 |
| 601 | nmdc:mga08y16_498247_c1 | 3300050511 | Bacteria | 1238 |
| 602 | Ga0495619_0029100 | 3300053085 | Bacteria | 3567 |
| 603 | Ga0500578_0000010 | 3300053086 | Bacteria | 217642 |
| 604 | Ga0500578_0337596 | 3300053086 | Bacteria | 884 |
| 605 | Ga0500644_0051970 | 3300053088 | Bacteria | 1409 |
| 606 | Ga0500581_225637 | 3300053089 | Unclassified | 809 |
| 607 | Ga0500650_0285711 | 3300053098 | Bacteria | 733 |
| 608 | Ga0500556_0191262 | 3300053104 | Bacteria | 809 |
| 609 | Ga0500594_0005606 | 3300053118 | Bacteria | 2787 |
| 610 | Ga0500652_035295 | 3300053131 | Bacteria | 1986 |
| 611 | Ga0500589_047206 | 3300053147 | Bacteria | 2004 |
| 612 | Ga0500604_0018715 | 3300053151 | Bacteria | 1933 |
| 613 | Ga0500622_0129217 | 3300053156 | Bacteria | 1216 |
| 614 | Ga0500639_292754 | 3300053163 | Bacteria | 618 |
| 615 | Ga0500637_0005750 | 3300053178 | Bacteria | 6037 |
| 616 | Ga0500637_0222598 | 3300053178 | Bacteria | 1066 |
| 617 | Ga0500645_082639 | 3300053730 | Unclassified | 916 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047320 | Ga0495672_0026716 | Ga0495672_0026716_392_940 | 165 |
| 2 | 3300005719 | Ga0068861_100270920 | Ga0068861_1002709202 | 166 |
| 3 | 3300014745 | Ga0157377_10075528 | Ga0157377_100755282 | 166 |
| 4 | 3300006237 | Ga0097621_100041626 | Ga0097621_1000416262 | 169 |
| 5 | 3300006358 | Ga0068871_100014257 | Ga0068871_1000142572 | 169 |
| 6 | 3300013297 | Ga0157378_10142534 | Ga0157378_101425342 | 169 |
| 7 | 3300013306 | Ga0163162_10424049 | Ga0163162_104240492 | 169 |
| 8 | 3300013308 | Ga0157375_10105638 | Ga0157375_101056382 | 169 |
| 9 | 3300014968 | Ga0157379_10072143 | Ga0157379_100721432 | 169 |
| 10 | 3300017792 | Ga0163161_10062763 | Ga0163161_100627632 | 169 |
| 11 | 3300005337 | Ga0070682_100225962 | Ga0070682_1002259622 | 173 |
| 12 | 3300005466 | Ga0070685_10334066 | Ga0070685_103340662 | 173 |
| 13 | 3300005616 | Ga0068852_100001366 | Ga0068852_1000013661 | 173 |
| 14 | 3300005617 | Ga0068859_100000006 | Ga0068859_100000006376 | 173 |
| 15 | 3300005618 | Ga0068864_100090627 | Ga0068864_1000906272 | 173 |
| 16 | 3300005834 | Ga0068851_10160689 | Ga0068851_101606892 | 173 |
| 17 | 3300005841 | Ga0068863_100091351 | Ga0068863_1000913512 | 173 |
| 18 | 3300005842 | Ga0068858_100002842 | Ga0068858_1000028428 | 173 |
| 19 | 3300006358 | Ga0068871_100135701 | Ga0068871_1001357013 | 173 |
| 20 | 3300006931 | Ga0097620_100000006 | Ga0097620_100000006376 | 173 |
| 21 | 3300009147 | Ga0114129_10013606 | Ga0114129_100136064 | 173 |
| 22 | 3300009148 | Ga0105243_10495177 | Ga0105243_104951771 | 173 |
| 23 | 3300009545 | Ga0105237_10000783 | Ga0105237_1000078313 | 173 |
| 24 | 3300009553 | Ga0105249_10000382 | Ga0105249_1000038221 | 173 |
| 25 | 3300010375 | Ga0105239_10051119 | Ga0105239_100511192 | 173 |
| 26 | 3300013306 | Ga0163162_10038942 | Ga0163162_100389422 | 173 |
| 27 | 3300013308 | Ga0157375_10115063 | Ga0157375_101150631 | 173 |
| 28 | 3300014325 | Ga0163163_10114381 | Ga0163163_101143812 | 173 |
| 29 | 3300014969 | Ga0157376_10218478 | Ga0157376_102184781 | 173 |
| 30 | 3300050510 | nmdc:mga06r32_23414_c1 | nmdc:mga06r32_23414_c1_108_632 | 173 |
| 31 | 3300003320 | rootH2_10237835 | rootH2_102378351 | 174 |
| 32 | 3300005329 | Ga0070683_100002540 | Ga0070683_1000025408 | 174 |
| 33 | 3300005331 | Ga0070670_100405260 | Ga0070670_1004052602 | 174 |
| 34 | 3300005334 | Ga0068869_100007810 | Ga0068869_1000078105 | 174 |
| 35 | 3300005334 | Ga0068869_100023401 | Ga0068869_1000234012 | 174 |
| 36 | 3300005335 | Ga0070666_10029228 | Ga0070666_100292282 | 174 |
| 37 | 3300005335 | Ga0070666_10053728 | Ga0070666_100537282 | 174 |
| 38 | 3300005337 | Ga0070682_100104573 | Ga0070682_1001045732 | 174 |
| 39 | 3300005338 | Ga0068868_100020813 | Ga0068868_1000208132 | 174 |
| 40 | 3300005339 | Ga0070660_100090473 | Ga0070660_1000904734 | 174 |
| 41 | 3300005339 | Ga0070660_100486178 | Ga0070660_1004861781 | 174 |
| 42 | 3300005340 | Ga0070689_100083467 | Ga0070689_1000834672 | 174 |
| 43 | 3300005341 | Ga0070691_10441532 | Ga0070691_104415321 | 174 |
| 44 | 3300005341 | Ga0070691_10655863 | Ga0070691_106558631 | 174 |
| 45 | 3300005344 | Ga0070661_100001916 | Ga0070661_1000019163 | 174 |
| 46 | 3300005347 | Ga0070668_100513652 | Ga0070668_1005136521 | 174 |
| 47 | 3300005353 | Ga0070669_101025489 | Ga0070669_1010254891 | 174 |
| 48 | 3300005353 | Ga0070669_101189009 | Ga0070669_1011890091 | 174 |
| 49 | 3300005355 | Ga0070671_100030828 | Ga0070671_1000308284 | 174 |
| 50 | 3300005355 | Ga0070671_100227060 | Ga0070671_1002270602 | 174 |
| 51 | 3300005364 | Ga0070673_100266783 | Ga0070673_1002667832 | 174 |
| 52 | 3300005364 | Ga0070673_100644748 | Ga0070673_1006447482 | 174 |
| 53 | 3300005365 | Ga0070688_100090472 | Ga0070688_1000904722 | 174 |
| 54 | 3300005366 | Ga0070659_101386648 | Ga0070659_1013866481 | 174 |
| 55 | 3300005367 | Ga0070667_100059329 | Ga0070667_1000593291 | 174 |
| 56 | 3300005367 | Ga0070667_100082513 | Ga0070667_1000825133 | 174 |
| 57 | 3300005367 | Ga0070667_100127719 | Ga0070667_1001277192 | 174 |
| 58 | 3300005455 | Ga0070663_100468579 | Ga0070663_1004685791 | 174 |
| 59 | 3300005458 | Ga0070681_10802155 | Ga0070681_108021552 | 174 |
| 60 | 3300005459 | Ga0068867_100059198 | Ga0068867_1000591983 | 174 |
| 61 | 3300005459 | Ga0068867_100204462 | Ga0068867_1002044622 | 174 |
| 62 | 3300005459 | Ga0068867_100637648 | Ga0068867_1006376482 | 174 |
| 63 | 3300005466 | Ga0070685_10647254 | Ga0070685_106472541 | 174 |
| 64 | 3300005530 | Ga0070679_100000762 | Ga0070679_10000076212 | 174 |
| 65 | 3300005530 | Ga0070679_100513209 | Ga0070679_1005132092 | 174 |
| 66 | 3300005530 | Ga0070679_100807505 | Ga0070679_1008075052 | 174 |
| 67 | 3300005530 | Ga0070679_101001923 | Ga0070679_1010019231 | 174 |
| 68 | 3300005535 | Ga0070684_100003871 | Ga0070684_1000038717 | 174 |
| 69 | 3300005535 | Ga0070684_100030321 | Ga0070684_1000303212 | 174 |
| 70 | 3300005535 | Ga0070684_100263330 | Ga0070684_1002633302 | 174 |
| 71 | 3300005535 | Ga0070684_100635040 | Ga0070684_1006350401 | 174 |
| 72 | 3300005539 | Ga0068853_100003026 | Ga0068853_1000030268 | 174 |
| 73 | 3300005539 | Ga0068853_100014981 | Ga0068853_1000149817 | 174 |
| 74 | 3300005539 | Ga0068853_100195409 | Ga0068853_1001954093 | 174 |
| 75 | 3300005543 | Ga0070672_100627817 | Ga0070672_1006278172 | 174 |
| 76 | 3300005544 | Ga0070686_100005276 | Ga0070686_1000052762 | 174 |
| 77 | 3300005547 | Ga0070693_100256007 | Ga0070693_1002560072 | 174 |
| 78 | 3300005563 | Ga0068855_100042026 | Ga0068855_1000420262 | 174 |
| 79 | 3300005563 | Ga0068855_100234182 | Ga0068855_1002341824 | 174 |
| 80 | 3300005563 | Ga0068855_100501009 | Ga0068855_1005010091 | 174 |
| 81 | 3300005563 | Ga0068855_100554906 | Ga0068855_1005549063 | 174 |
| 82 | 3300005564 | Ga0070664_100002009 | Ga0070664_10000200911 | 174 |
| 83 | 3300005564 | Ga0070664_100065677 | Ga0070664_1000656772 | 174 |
| 84 | 3300005564 | Ga0070664_100256201 | Ga0070664_1002562011 | 174 |
| 85 | 3300005564 | Ga0070664_100322192 | Ga0070664_1003221922 | 174 |
| 86 | 3300005577 | Ga0068857_100004209 | Ga0068857_1000042097 | 174 |
| 87 | 3300005577 | Ga0068857_100135791 | Ga0068857_1001357912 | 174 |
| 88 | 3300005577 | Ga0068857_100831217 | Ga0068857_1008312172 | 174 |
| 89 | 3300005578 | Ga0068854_100731727 | Ga0068854_1007317271 | 174 |
| 90 | 3300005578 | Ga0068854_100879606 | Ga0068854_1008796061 | 174 |
| 91 | 3300005578 | Ga0068854_101499194 | Ga0068854_1014991941 | 174 |
| 92 | 3300005614 | Ga0068856_100093309 | Ga0068856_1000933093 | 174 |
| 93 | 3300005616 | Ga0068852_100010723 | Ga0068852_1000107232 | 174 |
| 94 | 3300005616 | Ga0068852_100037806 | Ga0068852_1000378062 | 174 |
| 95 | 3300005616 | Ga0068852_100438587 | Ga0068852_1004385872 | 174 |
| 96 | 3300005617 | Ga0068859_100036347 | Ga0068859_1000363475 | 174 |
| 97 | 3300005618 | Ga0068864_100093958 | Ga0068864_1000939582 | 174 |
| 98 | 3300005618 | Ga0068864_100357736 | Ga0068864_1003577361 | 174 |
| 99 | 3300005719 | Ga0068861_100374350 | Ga0068861_1003743502 | 174 |
| 100 | 3300005834 | Ga0068851_10086913 | Ga0068851_100869132 | 174 |
| 101 | 3300005842 | Ga0068858_100267988 | Ga0068858_1002679882 | 174 |
| 102 | 3300005843 | Ga0068860_100000759 | Ga0068860_10000075910 | 174 |
| 103 | 3300005843 | Ga0068860_100454305 | Ga0068860_1004543052 | 174 |
| 104 | 3300005844 | Ga0068862_100002919 | Ga0068862_10000291911 | 174 |
| 105 | 3300005844 | Ga0068862_100960475 | Ga0068862_1009604752 | 174 |
| 106 | 3300006163 | Ga0070715_10054110 | Ga0070715_100541102 | 174 |
| 107 | 3300006358 | Ga0068871_100045150 | Ga0068871_1000451502 | 174 |
| 108 | 3300006931 | Ga0097620_100036347 | Ga0097620_1000363475 | 174 |
| 109 | 3300009011 | Ga0105251_10113426 | Ga0105251_101134262 | 174 |
| 110 | 3300009093 | Ga0105240_10020001 | Ga0105240_100200015 | 174 |
| 111 | 3300009093 | Ga0105240_10335714 | Ga0105240_103357143 | 174 |
| 112 | 3300009174 | Ga0105241_10028708 | Ga0105241_100287085 | 174 |
| 113 | 3300009174 | Ga0105241_10065769 | Ga0105241_100657692 | 174 |
| 114 | 3300009176 | Ga0105242_10075872 | Ga0105242_100758722 | 174 |
| 115 | 3300009545 | Ga0105237_10021003 | Ga0105237_100210032 | 174 |
| 116 | 3300009553 | Ga0105249_10261437 | Ga0105249_102614371 | 174 |
| 117 | 3300010375 | Ga0105239_10005033 | Ga0105239_100050336 | 174 |
| 118 | 3300010375 | Ga0105239_10479181 | Ga0105239_104791812 | 174 |
| 119 | 3300010375 | Ga0105239_10560448 | Ga0105239_105604483 | 174 |
| 120 | 3300010375 | Ga0105239_10562102 | Ga0105239_105621021 | 174 |
| 121 | 3300013100 | Ga0157373_10348979 | Ga0157373_103489791 | 174 |
| 122 | 3300013102 | Ga0157371_10004208 | Ga0157371_1000420813 | 174 |
| 123 | 3300013102 | Ga0157371_10033076 | Ga0157371_100330762 | 174 |
| 124 | 3300013102 | Ga0157371_10301283 | Ga0157371_103012832 | 174 |
| 125 | 3300013102 | Ga0157371_10321055 | Ga0157371_103210551 | 174 |
| 126 | 3300013104 | Ga0157370_10000526 | Ga0157370_1000052613 | 174 |
| 127 | 3300013104 | Ga0157370_10098956 | Ga0157370_100989563 | 174 |
| 128 | 3300013104 | Ga0157370_10278657 | Ga0157370_102786572 | 174 |
| 129 | 3300013104 | Ga0157370_10834577 | Ga0157370_108345771 | 174 |
| 130 | 3300013105 | Ga0157369_10015290 | Ga0157369_100152902 | 174 |
| 131 | 3300013296 | Ga0157374_10040230 | Ga0157374_100402302 | 174 |
| 132 | 3300013296 | Ga0157374_10150263 | Ga0157374_101502632 | 174 |
| 133 | 3300013296 | Ga0157374_10354881 | Ga0157374_103548812 | 174 |
| 134 | 3300013296 | Ga0157374_11092791 | Ga0157374_110927912 | 174 |
| 135 | 3300013297 | Ga0157378_11647502 | Ga0157378_116475021 | 174 |
| 136 | 3300013306 | Ga0163162_10001770 | Ga0163162_100017702 | 174 |
| 137 | 3300013306 | Ga0163162_10294261 | Ga0163162_102942611 | 174 |
| 138 | 3300013306 | Ga0163162_10660586 | Ga0163162_106605862 | 174 |
| 139 | 3300013307 | Ga0157372_10067425 | Ga0157372_100674252 | 174 |
| 140 | 3300013307 | Ga0157372_10116837 | Ga0157372_101168373 | 174 |
| 141 | 3300013307 | Ga0157372_10158595 | Ga0157372_101585953 | 174 |
| 142 | 3300013307 | Ga0157372_10338705 | Ga0157372_103387052 | 174 |
| 143 | 3300013307 | Ga0157372_11310325 | Ga0157372_113103251 | 174 |
| 144 | 3300013308 | Ga0157375_10038531 | Ga0157375_100385315 | 174 |
| 145 | 3300013308 | Ga0157375_10065145 | Ga0157375_100651453 | 174 |
| 146 | 3300013308 | Ga0157375_10179529 | Ga0157375_101795291 | 174 |
| 147 | 3300014325 | Ga0163163_10007094 | Ga0163163_100070944 | 174 |
| 148 | 3300014325 | Ga0163163_10045086 | Ga0163163_100450862 | 174 |
| 149 | 3300014325 | Ga0163163_10758555 | Ga0163163_107585551 | 174 |
| 150 | 3300014326 | Ga0157380_10641542 | Ga0157380_106415421 | 174 |
| 151 | 3300014745 | Ga0157377_10002499 | Ga0157377_100024997 | 174 |
| 152 | 3300014968 | Ga0157379_10009802 | Ga0157379_100098022 | 174 |
| 153 | 3300014968 | Ga0157379_10176400 | Ga0157379_101764002 | 174 |
| 154 | 3300014969 | Ga0157376_10055088 | Ga0157376_100550883 | 174 |
| 155 | 3300014969 | Ga0157376_10227705 | Ga0157376_102277052 | 174 |
| 156 | 3300014969 | Ga0157376_10650684 | Ga0157376_106506841 | 174 |
| 157 | 3300017792 | Ga0163161_10014989 | Ga0163161_100149892 | 174 |
| 158 | 3300017792 | Ga0163161_10054658 | Ga0163161_100546583 | 174 |
| 159 | 3300025321 | Ga0207656_10040022 | Ga0207656_100400222 | 174 |
| 160 | 3300025903 | Ga0207680_10247035 | Ga0207680_102470352 | 174 |
| 161 | 3300025905 | Ga0207685_10204161 | Ga0207685_102041612 | 174 |
| 162 | 3300025907 | Ga0207645_10010821 | Ga0207645_100108212 | 174 |
| 163 | 3300025907 | Ga0207645_10068295 | Ga0207645_100682952 | 174 |
| 164 | 3300025909 | Ga0207705_10047558 | Ga0207705_100475584 | 174 |
| 165 | 3300025909 | Ga0207705_10330929 | Ga0207705_103309292 | 174 |
| 166 | 3300025909 | Ga0207705_10629668 | Ga0207705_106296681 | 174 |
| 167 | 3300025913 | Ga0207695_10006273 | Ga0207695_1000627312 | 174 |
| 168 | 3300025913 | Ga0207695_10217270 | Ga0207695_102172702 | 174 |
| 169 | 3300025913 | Ga0207695_10338890 | Ga0207695_103388902 | 174 |
| 170 | 3300025914 | Ga0207671_10015537 | Ga0207671_100155376 | 174 |
| 171 | 3300025917 | Ga0207660_10129544 | Ga0207660_101295442 | 174 |
| 172 | 3300025918 | Ga0207662_10343136 | Ga0207662_103431361 | 174 |
| 173 | 3300025919 | Ga0207657_10129481 | Ga0207657_101294812 | 174 |
| 174 | 3300025919 | Ga0207657_10257925 | Ga0207657_102579251 | 174 |
| 175 | 3300025920 | Ga0207649_10253094 | Ga0207649_102530942 | 174 |
| 176 | 3300025921 | Ga0207652_10000108 | Ga0207652_1000010815 | 174 |
| 177 | 3300025921 | Ga0207652_10000346 | Ga0207652_100003462 | 174 |
| 178 | 3300025921 | Ga0207652_10052631 | Ga0207652_100526312 | 174 |
| 179 | 3300025921 | Ga0207652_10214910 | Ga0207652_102149102 | 174 |
| 180 | 3300025923 | Ga0207681_10202264 | Ga0207681_102022642 | 174 |
| 181 | 3300025923 | Ga0207681_10895064 | Ga0207681_108950641 | 174 |
| 182 | 3300025926 | Ga0207659_10183491 | Ga0207659_101834912 | 174 |
| 183 | 3300025931 | Ga0207644_10117256 | Ga0207644_101172562 | 174 |
| 184 | 3300025931 | Ga0207644_11155539 | Ga0207644_111555391 | 174 |
| 185 | 3300025932 | Ga0207690_10024864 | Ga0207690_100248642 | 174 |
| 186 | 3300025932 | Ga0207690_10157582 | Ga0207690_101575821 | 174 |
| 187 | 3300025932 | Ga0207690_10231282 | Ga0207690_102312822 | 174 |
| 188 | 3300025933 | Ga0207706_10014866 | Ga0207706_100148662 | 174 |
| 189 | 3300025936 | Ga0207670_10244675 | Ga0207670_102446752 | 174 |
| 190 | 3300025936 | Ga0207670_10805275 | Ga0207670_108052751 | 174 |
| 191 | 3300025941 | Ga0207711_11201057 | Ga0207711_112010571 | 174 |
| 192 | 3300025942 | Ga0207689_10033435 | Ga0207689_100334351 | 174 |
| 193 | 3300025944 | Ga0207661_10001233 | Ga0207661_1000123312 | 174 |
| 194 | 3300025944 | Ga0207661_10129095 | Ga0207661_101290952 | 174 |
| 195 | 3300025944 | Ga0207661_10137080 | Ga0207661_101370802 | 174 |
| 196 | 3300025944 | Ga0207661_10197835 | Ga0207661_101978352 | 174 |
| 197 | 3300025944 | Ga0207661_11407214 | Ga0207661_114072141 | 174 |
| 198 | 3300025945 | Ga0207679_10000927 | Ga0207679_100009279 | 174 |
| 199 | 3300025945 | Ga0207679_10049087 | Ga0207679_100490872 | 174 |
| 200 | 3300025945 | Ga0207679_10086199 | Ga0207679_100861992 | 174 |
| 201 | 3300025945 | Ga0207679_10180904 | Ga0207679_101809042 | 174 |
| 202 | 3300025945 | Ga0207679_10427396 | Ga0207679_104273962 | 174 |
| 203 | 3300025945 | Ga0207679_10433834 | Ga0207679_104338342 | 174 |
| 204 | 3300025949 | Ga0207667_10005756 | Ga0207667_100057561 | 174 |
| 205 | 3300025949 | Ga0207667_10297170 | Ga0207667_102971701 | 174 |
| 206 | 3300025960 | Ga0207651_10343950 | Ga0207651_103439501 | 174 |
| 207 | 3300025961 | Ga0207712_10287939 | Ga0207712_102879392 | 174 |
| 208 | 3300025972 | Ga0207668_10381315 | Ga0207668_103813151 | 174 |
| 209 | 3300025981 | Ga0207640_10577038 | Ga0207640_105770381 | 174 |
| 210 | 3300025986 | Ga0207658_10022942 | Ga0207658_100229422 | 174 |
| 211 | 3300025986 | Ga0207658_10204637 | Ga0207658_102046372 | 174 |
| 212 | 3300025986 | Ga0207658_10234132 | Ga0207658_102341322 | 174 |
| 213 | 3300026023 | Ga0207677_10015213 | Ga0207677_100152133 | 174 |
| 214 | 3300026023 | Ga0207677_10139529 | Ga0207677_101395293 | 174 |
| 215 | 3300026023 | Ga0207677_10202127 | Ga0207677_102021272 | 174 |
| 216 | 3300026035 | Ga0207703_10032255 | Ga0207703_100322553 | 174 |
| 217 | 3300026041 | Ga0207639_10000837 | Ga0207639_1000083712 | 174 |
| 218 | 3300026041 | Ga0207639_10057721 | Ga0207639_100577214 | 174 |
| 219 | 3300026067 | Ga0207678_10180210 | Ga0207678_101802102 | 174 |
| 220 | 3300026067 | Ga0207678_10901456 | Ga0207678_109014561 | 174 |
| 221 | 3300026078 | Ga0207702_10513438 | Ga0207702_105134382 | 174 |
| 222 | 3300026089 | Ga0207648_10056597 | Ga0207648_100565971 | 174 |
| 223 | 3300026089 | Ga0207648_10263192 | Ga0207648_102631922 | 174 |
| 224 | 3300026089 | Ga0207648_10556297 | Ga0207648_105562972 | 174 |
| 225 | 3300026089 | Ga0207648_10753525 | Ga0207648_107535252 | 174 |
| 226 | 3300026095 | Ga0207676_10136719 | Ga0207676_101367192 | 174 |
| 227 | 3300026116 | Ga0207674_10009039 | Ga0207674_100090397 | 174 |
| 228 | 3300026116 | Ga0207674_10034432 | Ga0207674_100344325 | 174 |
| 229 | 3300026116 | Ga0207674_10369895 | Ga0207674_103698953 | 174 |
| 230 | 3300026118 | Ga0207675_100378090 | Ga0207675_1003780902 | 174 |
| 231 | 3300026121 | Ga0207683_10097030 | Ga0207683_100970302 | 174 |
| 232 | 3300026142 | Ga0207698_10024765 | Ga0207698_100247652 | 174 |
| 233 | 3300026142 | Ga0207698_10221436 | Ga0207698_102214362 | 174 |
| 234 | 3300026142 | Ga0207698_10400217 | Ga0207698_104002172 | 174 |
| 235 | 3300026142 | Ga0207698_11465172 | Ga0207698_114651721 | 174 |
| 236 | 3300028380 | Ga0268265_10065613 | Ga0268265_100656132 | 174 |
| 237 | 3300028380 | Ga0268265_11264255 | Ga0268265_112642551 | 174 |
| 238 | 3300028381 | Ga0268264_10014848 | Ga0268264_100148485 | 174 |
| 239 | 3300035410 | Ga0373924_0045673 | Ga0373924_0045673_266_811 | 174 |
| 240 | 3300035692 | Ga0373935_0332142 | Ga0373935_0332142_451_975 | 174 |
| 241 | 3300035692 | Ga0373935_0740890 | Ga0373935_0740890_80_607 | 174 |
| 242 | 3300036401 | Ga0373937_0110017 | Ga0373937_0110017_703_1230 | 174 |
| 243 | 3300037312 | Ga0395899_0018080 | Ga0395899_0018080_1614_2138 | 174 |
| 244 | 3300037312 | Ga0395899_0018960 | Ga0395899_0018960_757_1281 | 174 |
| 245 | 3300037418 | Ga0395900_0000573 | Ga0395900_0000573_15751_16275 | 174 |
| 246 | 3300037418 | Ga0395900_0006676 | Ga0395900_0006676_5066_5590 | 174 |
| 247 | 3300037418 | Ga0395900_0787397 | Ga0395900_0787397_342_866 | 174 |
| 248 | 3300037466 | Ga0395898_0033959 | Ga0395898_0033959_905_1429 | 174 |
| 249 | 3300038443 | Ga0395901_0001343 | Ga0395901_0001343_4024_4548 | 174 |
| 250 | 3300038443 | Ga0395901_0407643 | Ga0395901_0407643_794_1318 | 174 |
| 251 | 3300041404 | Ga0439436_0072307 | Ga0439436_0072307_275_799 | 174 |
| 252 | 3300042007 | Ga0439449_0008171 | Ga0439449_0008171_1054_1578 | 174 |
| 253 | 3300042014 | Ga0439457_006130 | Ga0439457_006130_1303_1827 | 174 |
| 254 | 3300044712 | Ga0453684_0001960 | Ga0453684_0001960_45798_46325 | 174 |
| 255 | 3300045051 | Ga0451576_0004672 | Ga0451576_0004672_11668_12195 | 174 |
| 256 | 3300046459 | Ga0495629_0066297 | Ga0495629_0066297_1185_1709 | 174 |
| 257 | 3300046463 | Ga0495653_0104419 | Ga0495653_0104419_927_1454 | 174 |
| 258 | 3300046463 | Ga0495653_0280283 | Ga0495653_0280283_534_1058 | 174 |
| 259 | 3300046472 | Ga0495580_0195549 | Ga0495580_0195549_172_696 | 174 |
| 260 | 3300046472 | Ga0495580_0291319 | Ga0495580_0291319_507_1037 | 174 |
| 261 | 3300046511 | Ga0495608_0078140 | Ga0495608_0078140_552_1079 | 174 |
| 262 | 3300046516 | Ga0495628_0850492 | Ga0495628_0850492_63_590 | 174 |
| 263 | 3300046517 | Ga0495630_0093040 | Ga0495630_0093040_746_1270 | 174 |
| 264 | 3300046529 | Ga0495652_0203485 | Ga0495652_0203485_372_896 | 174 |
| 265 | 3300046531 | Ga0495665_0420781 | Ga0495665_0420781_46_570 | 174 |
| 266 | 3300046536 | Ga0495587_0067386 | Ga0495587_0067386_271_798 | 174 |
| 267 | 3300046559 | Ga0495667_0090797 | Ga0495667_0090797_70_597 | 174 |
| 268 | 3300046642 | Ga0495634_0459554 | Ga0495634_0459554_13_558 | 174 |
| 269 | 3300046680 | Ga0495646_0276153 | Ga0495646_0276153_199_744 | 174 |
| 270 | 3300046681 | Ga0495647_0306968 | Ga0495647_0306968_90_614 | 174 |
| 271 | 3300046683 | Ga0495658_0007718 | Ga0495658_0007718_3916_4440 | 174 |
| 272 | 3300046809 | Ga0495600_0074639 | Ga0495600_0074639_464_988 | 174 |
| 273 | 3300047319 | Ga0495674_0242412 | Ga0495674_0242412_337_861 | 174 |
| 274 | 3300047471 | Ga0495684_0801035 | Ga0495684_0801035_72_596 | 174 |
| 275 | 3300048088 | Ga0495602_0354147 | Ga0495602_0354147_376_900 | 174 |
| 276 | 3300048908 | Ga0496105_0091693 | Ga0496105_0091693_949_1473 | 174 |
| 277 | 3300049569 | Ga0501032_0030108 | Ga0501032_0030108_1994_2518 | 174 |
| 278 | 3300049570 | Ga0501033_0008685 | Ga0501033_0008685_3504_4028 | 174 |
| 279 | 3300049570 | Ga0501033_0461063 | Ga0501033_0461063_95_619 | 174 |
| 280 | 3300049571 | Ga0501034_0001589 | Ga0501034_0001589_25160_25684 | 174 |
| 281 | 3300049571 | Ga0501034_0274010 | Ga0501034_0274010_217_741 | 174 |
| 282 | 3300049573 | Ga0501037_0049897 | Ga0501037_0049897_2047_2571 | 174 |
| 283 | 3300049581 | Ga0501047_0002822 | Ga0501047_0002822_3158_3724 | 174 |
| 284 | 3300049586 | Ga0501070_0153719 | Ga0501070_0153719_509_1033 | 174 |
| 285 | 3300049822 | Ga0501035_0017448 | Ga0501035_0017448_5465_5989 | 174 |
| 286 | 3300049822 | Ga0501035_0445353 | Ga0501035_0445353_40_564 | 174 |
| 287 | 3300049823 | Ga0501044_0017697 | Ga0501044_0017697_5100_5666 | 174 |
| 288 | 3300053085 | Ga0495619_0029100 | Ga0495619_0029100_1833_2357 | 174 |
| 289 | 3300002077 | JGI24744J21845_10011915 | JGI24744J21845_100119151 | 175 |
| 290 | 3300003320 | rootH2_10008684 | rootH2_100086842 | 175 |
| 291 | 3300003322 | rootL2_10278346 | rootL2_102783461 | 175 |
| 292 | 3300003323 | rootH1_10249806 | rootH1_102498062 | 175 |
| 293 | 3300005290 | Ga0065712_10109465 | Ga0065712_101094652 | 175 |
| 294 | 3300005293 | Ga0065715_10159058 | Ga0065715_101590582 | 175 |
| 295 | 3300005327 | Ga0070658_10614478 | Ga0070658_106144781 | 175 |
| 296 | 3300005328 | Ga0070676_10000659 | Ga0070676_100006592 | 175 |
| 297 | 3300005328 | Ga0070676_10051597 | Ga0070676_100515973 | 175 |
| 298 | 3300005330 | Ga0070690_100011501 | Ga0070690_1000115015 | 175 |
| 299 | 3300005331 | Ga0070670_100006829 | Ga0070670_1000068294 | 175 |
| 300 | 3300005331 | Ga0070670_100294730 | Ga0070670_1002947302 | 175 |
| 301 | 3300005334 | Ga0068869_100180306 | Ga0068869_1001803062 | 175 |
| 302 | 3300005335 | Ga0070666_10000172 | Ga0070666_1000017216 | 175 |
| 303 | 3300005335 | Ga0070666_10031744 | Ga0070666_100317442 | 175 |
| 304 | 3300005335 | Ga0070666_10659269 | Ga0070666_106592691 | 175 |
| 305 | 3300005336 | Ga0070680_100001877 | Ga0070680_1000018771 | 175 |
| 306 | 3300005337 | Ga0070682_100003083 | Ga0070682_1000030833 | 175 |
| 307 | 3300005338 | Ga0068868_100000356 | Ga0068868_1000003563 | 175 |
| 308 | 3300005338 | Ga0068868_100188326 | Ga0068868_1001883263 | 175 |
| 309 | 3300005339 | Ga0070660_101043146 | Ga0070660_1010431461 | 175 |
| 310 | 3300005340 | Ga0070689_100042918 | Ga0070689_1000429183 | 175 |
| 311 | 3300005340 | Ga0070689_100183206 | Ga0070689_1001832061 | 175 |
| 312 | 3300005341 | Ga0070691_10007560 | Ga0070691_100075602 | 175 |
| 313 | 3300005343 | Ga0070687_100008497 | Ga0070687_1000084973 | 175 |
| 314 | 3300005344 | Ga0070661_100037243 | Ga0070661_1000372431 | 175 |
| 315 | 3300005344 | Ga0070661_100277099 | Ga0070661_1002770991 | 175 |
| 316 | 3300005347 | Ga0070668_100000169 | Ga0070668_10000016914 | 175 |
| 317 | 3300005347 | Ga0070668_100627894 | Ga0070668_1006278941 | 175 |
| 318 | 3300005347 | Ga0070668_100736509 | Ga0070668_1007365091 | 175 |
| 319 | 3300005353 | Ga0070669_100001327 | Ga0070669_1000013279 | 175 |
| 320 | 3300005353 | Ga0070669_100090722 | Ga0070669_1000907223 | 175 |
| 321 | 3300005353 | Ga0070669_100474374 | Ga0070669_1004743741 | 175 |
| 322 | 3300005354 | Ga0070675_100128445 | Ga0070675_1001284453 | 175 |
| 323 | 3300005354 | Ga0070675_100187688 | Ga0070675_1001876882 | 175 |
| 324 | 3300005354 | Ga0070675_100431633 | Ga0070675_1004316331 | 175 |
| 325 | 3300005355 | Ga0070671_100042930 | Ga0070671_1000429302 | 175 |
| 326 | 3300005355 | Ga0070671_100327674 | Ga0070671_1003276742 | 175 |
| 327 | 3300005356 | Ga0070674_100006130 | Ga0070674_1000061306 | 175 |
| 328 | 3300005356 | Ga0070674_100010282 | Ga0070674_1000102823 | 175 |
| 329 | 3300005356 | Ga0070674_100993312 | Ga0070674_1009933121 | 175 |
| 330 | 3300005364 | Ga0070673_100001347 | Ga0070673_1000013473 | 175 |
| 331 | 3300005364 | Ga0070673_100030855 | Ga0070673_1000308552 | 175 |
| 332 | 3300005365 | Ga0070688_100001808 | Ga0070688_1000018089 | 175 |
| 333 | 3300005365 | Ga0070688_100670563 | Ga0070688_1006705631 | 175 |
| 334 | 3300005367 | Ga0070667_100000553 | Ga0070667_10000055320 | 175 |
| 335 | 3300005367 | Ga0070667_100251887 | Ga0070667_1002518873 | 175 |
| 336 | 3300005438 | Ga0070701_10026912 | Ga0070701_100269122 | 175 |
| 337 | 3300005438 | Ga0070701_10032532 | Ga0070701_100325323 | 175 |
| 338 | 3300005441 | Ga0070700_100043718 | Ga0070700_1000437183 | 175 |
| 339 | 3300005456 | Ga0070678_100059276 | Ga0070678_1000592762 | 175 |
| 340 | 3300005456 | Ga0070678_100079700 | Ga0070678_1000797003 | 175 |
| 341 | 3300005456 | Ga0070678_100609324 | Ga0070678_1006093242 | 175 |
| 342 | 3300005457 | Ga0070662_100003420 | Ga0070662_1000034204 | 175 |
| 343 | 3300005459 | Ga0068867_100001171 | Ga0068867_10000117116 | 175 |
| 344 | 3300005459 | Ga0068867_100147246 | Ga0068867_1001472462 | 175 |
| 345 | 3300005459 | Ga0068867_100892596 | Ga0068867_1008925961 | 175 |
| 346 | 3300005539 | Ga0068853_100000272 | Ga0068853_10000027224 | 175 |
| 347 | 3300005539 | Ga0068853_100003946 | Ga0068853_1000039464 | 175 |
| 348 | 3300005539 | Ga0068853_100033225 | Ga0068853_1000332254 | 175 |
| 349 | 3300005539 | Ga0068853_100353312 | Ga0068853_1003533121 | 175 |
| 350 | 3300005543 | Ga0070672_100000061 | Ga0070672_10000006131 | 175 |
| 351 | 3300005543 | Ga0070672_100059193 | Ga0070672_1000591934 | 175 |
| 352 | 3300005543 | Ga0070672_100144375 | Ga0070672_1001443752 | 175 |
| 353 | 3300005543 | Ga0070672_101171752 | Ga0070672_1011717521 | 175 |
| 354 | 3300005544 | Ga0070686_100004012 | Ga0070686_1000040123 | 175 |
| 355 | 3300005547 | Ga0070693_100073096 | Ga0070693_1000730962 | 175 |
| 356 | 3300005548 | Ga0070665_100000612 | Ga0070665_10000061221 | 175 |
| 357 | 3300005548 | Ga0070665_100629066 | Ga0070665_1006290662 | 175 |
| 358 | 3300005563 | Ga0068855_100028833 | Ga0068855_1000288334 | 175 |
| 359 | 3300005563 | Ga0068855_100051852 | Ga0068855_1000518522 | 175 |
| 360 | 3300005563 | Ga0068855_100228984 | Ga0068855_1002289841 | 175 |
| 361 | 3300005564 | Ga0070664_100452665 | Ga0070664_1004526652 | 175 |
| 362 | 3300005577 | Ga0068857_100002332 | Ga0068857_10000233216 | 175 |
| 363 | 3300005577 | Ga0068857_100201802 | Ga0068857_1002018021 | 175 |
| 364 | 3300005578 | Ga0068854_100349244 | Ga0068854_1003492442 | 175 |
| 365 | 3300005578 | Ga0068854_100600137 | Ga0068854_1006001372 | 175 |
| 366 | 3300005614 | Ga0068856_100122613 | Ga0068856_1001226132 | 175 |
| 367 | 3300005616 | Ga0068852_101486642 | Ga0068852_1014866421 | 175 |
| 368 | 3300005617 | Ga0068859_100000859 | Ga0068859_10000085918 | 175 |
| 369 | 3300005617 | Ga0068859_101206227 | Ga0068859_1012062272 | 175 |
| 370 | 3300005618 | Ga0068864_100001631 | Ga0068864_1000016318 | 175 |
| 371 | 3300005719 | Ga0068861_100018572 | Ga0068861_1000185722 | 175 |
| 372 | 3300005840 | Ga0068870_10009345 | Ga0068870_100093456 | 175 |
| 373 | 3300005841 | Ga0068863_100004540 | Ga0068863_1000045406 | 175 |
| 374 | 3300005841 | Ga0068863_100070683 | Ga0068863_1000706833 | 175 |
| 375 | 3300005842 | Ga0068858_100004312 | Ga0068858_10000431210 | 175 |
| 376 | 3300005842 | Ga0068858_100051614 | Ga0068858_1000516142 | 175 |
| 377 | 3300005843 | Ga0068860_100000591 | Ga0068860_10000059127 | 175 |
| 378 | 3300005843 | Ga0068860_100004454 | Ga0068860_1000044544 | 175 |
| 379 | 3300005843 | Ga0068860_100760529 | Ga0068860_1007605291 | 175 |
| 380 | 3300005843 | Ga0068860_101559185 | Ga0068860_1015591851 | 175 |
| 381 | 3300005844 | Ga0068862_100420176 | Ga0068862_1004201761 | 175 |
| 382 | 3300005985 | Ga0081539_10011193 | Ga0081539_100111932 | 175 |
| 383 | 3300006195 | Ga0075366_10030210 | Ga0075366_100302101 | 175 |
| 384 | 3300006195 | Ga0075366_10756499 | Ga0075366_107564991 | 175 |
| 385 | 3300006237 | Ga0097621_100000821 | Ga0097621_10000082121 | 175 |
| 386 | 3300006237 | Ga0097621_100001193 | Ga0097621_1000011932 | 175 |
| 387 | 3300006358 | Ga0068871_100002803 | Ga0068871_1000028032 | 175 |
| 388 | 3300006358 | Ga0068871_100004016 | Ga0068871_1000040166 | 175 |
| 389 | 3300006358 | Ga0068871_100116767 | Ga0068871_1001167671 | 175 |
| 390 | 3300006358 | Ga0068871_100159409 | Ga0068871_1001594093 | 175 |
| 391 | 3300006881 | Ga0068865_100014490 | Ga0068865_1000144903 | 175 |
| 392 | 3300006881 | Ga0068865_100135868 | Ga0068865_1001358682 | 175 |
| 393 | 3300006931 | Ga0097620_100000859 | Ga0097620_10000085918 | 175 |
| 394 | 3300006931 | Ga0097620_101206365 | Ga0097620_1012063651 | 175 |
| 395 | 3300009093 | Ga0105240_10043919 | Ga0105240_100439192 | 175 |
| 396 | 3300009093 | Ga0105240_10060041 | Ga0105240_100600415 | 175 |
| 397 | 3300009093 | Ga0105240_10096978 | Ga0105240_100969782 | 175 |
| 398 | 3300009093 | Ga0105240_10657065 | Ga0105240_106570651 | 175 |
| 399 | 3300009094 | Ga0111539_10002870 | Ga0111539_1000287010 | 175 |
| 400 | 3300009094 | Ga0111539_10126701 | Ga0111539_101267011 | 175 |
| 401 | 3300009094 | Ga0111539_10474867 | Ga0111539_104748672 | 175 |
| 402 | 3300009101 | Ga0105247_10088673 | Ga0105247_100886732 | 175 |
| 403 | 3300009174 | Ga0105241_10007669 | Ga0105241_100076698 | 175 |
| 404 | 3300009174 | Ga0105241_10078841 | Ga0105241_100788411 | 175 |
| 405 | 3300009174 | Ga0105241_10409374 | Ga0105241_104093742 | 175 |
| 406 | 3300009174 | Ga0105241_10552600 | Ga0105241_105526001 | 175 |
| 407 | 3300009176 | Ga0105242_10046854 | Ga0105242_100468543 | 175 |
| 408 | 3300009177 | Ga0105248_11049674 | Ga0105248_110496741 | 175 |
| 409 | 3300009177 | Ga0105248_11200624 | Ga0105248_112006241 | 175 |
| 410 | 3300009545 | Ga0105237_10080474 | Ga0105237_100804742 | 175 |
| 411 | 3300009545 | Ga0105237_10130840 | Ga0105237_101308402 | 175 |
| 412 | 3300009551 | Ga0105238_10113628 | Ga0105238_101136283 | 175 |
| 413 | 3300009553 | Ga0105249_10012057 | Ga0105249_100120575 | 175 |
| 414 | 3300009553 | Ga0105249_10031497 | Ga0105249_100314974 | 175 |
| 415 | 3300010375 | Ga0105239_10022820 | Ga0105239_100228204 | 175 |
| 416 | 3300010375 | Ga0105239_10274624 | Ga0105239_102746242 | 175 |
| 417 | 3300013104 | Ga0157370_10003149 | Ga0157370_1000314913 | 175 |
| 418 | 3300013105 | Ga0157369_10479006 | Ga0157369_104790062 | 175 |
| 419 | 3300013296 | Ga0157374_10000627 | Ga0157374_1000062726 | 175 |
| 420 | 3300013296 | Ga0157374_10059540 | Ga0157374_100595403 | 175 |
| 421 | 3300013296 | Ga0157374_10675667 | Ga0157374_106756672 | 175 |
| 422 | 3300013297 | Ga0157378_10005519 | Ga0157378_100055196 | 175 |
| 423 | 3300013297 | Ga0157378_10060645 | Ga0157378_100606452 | 175 |
| 424 | 3300013297 | Ga0157378_10374710 | Ga0157378_103747102 | 175 |
| 425 | 3300013297 | Ga0157378_10536178 | Ga0157378_105361782 | 175 |
| 426 | 3300013297 | Ga0157378_10693772 | Ga0157378_106937722 | 175 |
| 427 | 3300013306 | Ga0163162_10000752 | Ga0163162_1000075226 | 175 |
| 428 | 3300013306 | Ga0163162_10002582 | Ga0163162_100025822 | 175 |
| 429 | 3300013306 | Ga0163162_10014638 | Ga0163162_100146382 | 175 |
| 430 | 3300013307 | Ga0157372_10025872 | Ga0157372_100258726 | 175 |
| 431 | 3300013307 | Ga0157372_10050274 | Ga0157372_100502742 | 175 |
| 432 | 3300013307 | Ga0157372_10484414 | Ga0157372_104844142 | 175 |
| 433 | 3300013307 | Ga0157372_10678028 | Ga0157372_106780282 | 175 |
| 434 | 3300013307 | Ga0157372_10811678 | Ga0157372_108116782 | 175 |
| 435 | 3300013307 | Ga0157372_11853703 | Ga0157372_118537032 | 175 |
| 436 | 3300013308 | Ga0157375_10000098 | Ga0157375_1000009861 | 175 |
| 437 | 3300013308 | Ga0157375_10025649 | Ga0157375_100256494 | 175 |
| 438 | 3300013308 | Ga0157375_10319680 | Ga0157375_103196803 | 175 |
| 439 | 3300014325 | Ga0163163_10000272 | Ga0163163_1000027230 | 175 |
| 440 | 3300014326 | Ga0157380_10001666 | Ga0157380_1000166611 | 175 |
| 441 | 3300014326 | Ga0157380_10005979 | Ga0157380_100059792 | 175 |
| 442 | 3300014745 | Ga0157377_10000309 | Ga0157377_1000030914 | 175 |
| 443 | 3300014745 | Ga0157377_10011657 | Ga0157377_100116577 | 175 |
| 444 | 3300014968 | Ga0157379_10000103 | Ga0157379_1000010331 | 175 |
| 445 | 3300014969 | Ga0157376_10000286 | Ga0157376_1000028626 | 175 |
| 446 | 3300014969 | Ga0157376_10226300 | Ga0157376_102263001 | 175 |
| 447 | 3300014969 | Ga0157376_10226557 | Ga0157376_102265571 | 175 |
| 448 | 3300017792 | Ga0163161_10074880 | Ga0163161_100748801 | 175 |
| 449 | 3300025246 | Ga0209646_1002334 | Ga0209646_10023342 | 175 |
| 450 | 3300025321 | Ga0207656_10000540 | Ga0207656_1000054010 | 175 |
| 451 | 3300025893 | Ga0207682_10092091 | Ga0207682_100920912 | 175 |
| 452 | 3300025900 | Ga0207710_10252505 | Ga0207710_102525051 | 175 |
| 453 | 3300025901 | Ga0207688_10110052 | Ga0207688_101100523 | 175 |
| 454 | 3300025903 | Ga0207680_10167578 | Ga0207680_101675782 | 175 |
| 455 | 3300025903 | Ga0207680_10252699 | Ga0207680_102526992 | 175 |
| 456 | 3300025907 | Ga0207645_10001904 | Ga0207645_100019042 | 175 |
| 457 | 3300025907 | Ga0207645_10065794 | Ga0207645_100657943 | 175 |
| 458 | 3300025908 | Ga0207643_10034493 | Ga0207643_100344932 | 175 |
| 459 | 3300025909 | Ga0207705_10141763 | Ga0207705_101417632 | 175 |
| 460 | 3300025911 | Ga0207654_10032859 | Ga0207654_100328591 | 175 |
| 461 | 3300025911 | Ga0207654_10241864 | Ga0207654_102418641 | 175 |
| 462 | 3300025911 | Ga0207654_10347736 | Ga0207654_103477362 | 175 |
| 463 | 3300025911 | Ga0207654_10906008 | Ga0207654_109060082 | 175 |
| 464 | 3300025912 | Ga0207707_10000160 | Ga0207707_1000016042 | 175 |
| 465 | 3300025913 | Ga0207695_10042989 | Ga0207695_100429894 | 175 |
| 466 | 3300025913 | Ga0207695_10077416 | Ga0207695_100774161 | 175 |
| 467 | 3300025914 | Ga0207671_10154433 | Ga0207671_101544332 | 175 |
| 468 | 3300025917 | Ga0207660_10004570 | Ga0207660_100045705 | 175 |
| 469 | 3300025918 | Ga0207662_10014592 | Ga0207662_100145922 | 175 |
| 470 | 3300025919 | Ga0207657_10320349 | Ga0207657_103203491 | 175 |
| 471 | 3300025921 | Ga0207652_10020113 | Ga0207652_100201132 | 175 |
| 472 | 3300025923 | Ga0207681_10574780 | Ga0207681_105747802 | 175 |
| 473 | 3300025924 | Ga0207694_11301844 | Ga0207694_113018441 | 175 |
| 474 | 3300025925 | Ga0207650_10375590 | Ga0207650_103755901 | 175 |
| 475 | 3300025926 | Ga0207659_10331637 | Ga0207659_103316372 | 175 |
| 476 | 3300025931 | Ga0207644_10937546 | Ga0207644_109375461 | 175 |
| 477 | 3300025931 | Ga0207644_11347911 | Ga0207644_113479111 | 175 |
| 478 | 3300025933 | Ga0207706_10031145 | Ga0207706_100311455 | 175 |
| 479 | 3300025933 | Ga0207706_10298912 | Ga0207706_102989121 | 175 |
| 480 | 3300025934 | Ga0207686_10180685 | Ga0207686_101806852 | 175 |
| 481 | 3300025936 | Ga0207670_10115994 | Ga0207670_101159942 | 175 |
| 482 | 3300025936 | Ga0207670_10364625 | Ga0207670_103646252 | 175 |
| 483 | 3300025937 | Ga0207669_10020099 | Ga0207669_100200992 | 175 |
| 484 | 3300025937 | Ga0207669_11073116 | Ga0207669_110731161 | 175 |
| 485 | 3300025938 | Ga0207704_10031376 | Ga0207704_100313762 | 175 |
| 486 | 3300025938 | Ga0207704_10134838 | Ga0207704_101348381 | 175 |
| 487 | 3300025940 | Ga0207691_10000154 | Ga0207691_1000015427 | 175 |
| 488 | 3300025940 | Ga0207691_10049077 | Ga0207691_100490772 | 175 |
| 489 | 3300025940 | Ga0207691_10055181 | Ga0207691_100551813 | 175 |
| 490 | 3300025942 | Ga0207689_10093738 | Ga0207689_100937383 | 175 |
| 491 | 3300025942 | Ga0207689_10144577 | Ga0207689_101445771 | 175 |
| 492 | 3300025942 | Ga0207689_10580097 | Ga0207689_105800971 | 175 |
| 493 | 3300025949 | Ga0207667_10029528 | Ga0207667_100295282 | 175 |
| 494 | 3300025949 | Ga0207667_10188463 | Ga0207667_101884632 | 175 |
| 495 | 3300025960 | Ga0207651_10002052 | Ga0207651_100020526 | 175 |
| 496 | 3300025960 | Ga0207651_10140706 | Ga0207651_101407063 | 175 |
| 497 | 3300025961 | Ga0207712_10025595 | Ga0207712_100255953 | 175 |
| 498 | 3300025961 | Ga0207712_10124481 | Ga0207712_101244812 | 175 |
| 499 | 3300025972 | Ga0207668_10001109 | Ga0207668_1000110913 | 175 |
| 500 | 3300025972 | Ga0207668_10088965 | Ga0207668_100889653 | 175 |
| 501 | 3300025972 | Ga0207668_10102660 | Ga0207668_101026603 | 175 |
| 502 | 3300025972 | Ga0207668_10120358 | Ga0207668_101203582 | 175 |
| 503 | 3300025981 | Ga0207640_10643628 | Ga0207640_106436281 | 175 |
| 504 | 3300025981 | Ga0207640_10830241 | Ga0207640_108302412 | 175 |
| 505 | 3300025986 | Ga0207658_10000570 | Ga0207658_1000057027 | 175 |
| 506 | 3300025986 | Ga0207658_10223522 | Ga0207658_102235223 | 175 |
| 507 | 3300026023 | Ga0207677_10073265 | Ga0207677_100732652 | 175 |
| 508 | 3300026023 | Ga0207677_10163276 | Ga0207677_101632761 | 175 |
| 509 | 3300026035 | Ga0207703_10000883 | Ga0207703_100008836 | 175 |
| 510 | 3300026041 | Ga0207639_10003361 | Ga0207639_100033614 | 175 |
| 511 | 3300026041 | Ga0207639_10004478 | Ga0207639_100044789 | 175 |
| 512 | 3300026041 | Ga0207639_10046112 | Ga0207639_100461122 | 175 |
| 513 | 3300026041 | Ga0207639_10215096 | Ga0207639_102150962 | 175 |
| 514 | 3300026041 | Ga0207639_10490562 | Ga0207639_104905622 | 175 |
| 515 | 3300026075 | Ga0207708_10144907 | Ga0207708_101449071 | 175 |
| 516 | 3300026078 | Ga0207702_10244763 | Ga0207702_102447632 | 175 |
| 517 | 3300026088 | Ga0207641_10009123 | Ga0207641_100091237 | 175 |
| 518 | 3300026088 | Ga0207641_10235769 | Ga0207641_102357692 | 175 |
| 519 | 3300026089 | Ga0207648_10004750 | Ga0207648_100047509 | 175 |
| 520 | 3300026089 | Ga0207648_10013015 | Ga0207648_100130152 | 175 |
| 521 | 3300026089 | Ga0207648_10047452 | Ga0207648_100474522 | 175 |
| 522 | 3300026089 | Ga0207648_10657785 | Ga0207648_106577851 | 175 |
| 523 | 3300026095 | Ga0207676_10000948 | Ga0207676_1000094823 | 175 |
| 524 | 3300026116 | Ga0207674_10004662 | Ga0207674_100046623 | 175 |
| 525 | 3300026116 | Ga0207674_10398930 | Ga0207674_103989302 | 175 |
| 526 | 3300026118 | Ga0207675_100000655 | Ga0207675_10000065523 | 175 |
| 527 | 3300026118 | Ga0207675_100228161 | Ga0207675_1002281611 | 175 |
| 528 | 3300026118 | Ga0207675_100816659 | Ga0207675_1008166591 | 175 |
| 529 | 3300026121 | Ga0207683_10102963 | Ga0207683_101029632 | 175 |
| 530 | 3300026121 | Ga0207683_10179196 | Ga0207683_101791962 | 175 |
| 531 | 3300026121 | Ga0207683_10469333 | Ga0207683_104693331 | 175 |
| 532 | 3300026142 | Ga0207698_10133092 | Ga0207698_101330921 | 175 |
| 533 | 3300026142 | Ga0207698_11481689 | Ga0207698_114816891 | 175 |
| 534 | 3300027907 | Ga0207428_10314989 | Ga0207428_103149892 | 175 |
| 535 | 3300028379 | Ga0268266_10000986 | Ga0268266_1000098628 | 175 |
| 536 | 3300028379 | Ga0268266_10475280 | Ga0268266_104752801 | 175 |
| 537 | 3300028381 | Ga0268264_10001126 | Ga0268264_1000112610 | 175 |
| 538 | 3300028381 | Ga0268264_10008368 | Ga0268264_100083682 | 175 |
| 539 | 3300028381 | Ga0268264_10397215 | Ga0268264_103972152 | 175 |
| 540 | 3300031251 | Ga0265327_10000022 | Ga0265327_10000022139 | 175 |
| 541 | 3300031456 | Ga0307513_10139436 | Ga0307513_101394362 | 175 |
| 542 | 3300031456 | Ga0307513_10143280 | Ga0307513_101432802 | 175 |
| 543 | 3300031456 | Ga0307513_10192880 | Ga0307513_101928801 | 175 |
| 544 | 3300031507 | Ga0307509_10009531 | Ga0307509_1000953111 | 175 |
| 545 | 3300031507 | Ga0307509_10011098 | Ga0307509_100110985 | 175 |
| 546 | 3300031548 | Ga0307408_100140067 | Ga0307408_1001400671 | 175 |
| 547 | 3300031616 | Ga0307508_10000181 | Ga0307508_1000018162 | 175 |
| 548 | 3300031731 | Ga0307405_10456026 | Ga0307405_104560262 | 175 |
| 549 | 3300031824 | Ga0307413_10037934 | Ga0307413_100379343 | 175 |
| 550 | 3300031901 | Ga0307406_10420835 | Ga0307406_104208352 | 175 |
| 551 | 3300031901 | Ga0307406_10832403 | Ga0307406_108324031 | 175 |
| 552 | 3300031911 | Ga0307412_10486972 | Ga0307412_104869722 | 175 |
| 553 | 3300032002 | Ga0307416_100047859 | Ga0307416_1000478593 | 175 |
| 554 | 3300032004 | Ga0307414_10084974 | Ga0307414_100849744 | 175 |
| 555 | 3300032005 | Ga0307411_10299046 | Ga0307411_102990462 | 175 |
| 556 | 3300041404 | Ga0439436_0014062 | Ga0439436_0014062_1669_2196 | 175 |
| 557 | 3300041452 | Ga0451793_1150992 | Ga0451793_1150992_173_700 | 175 |
| 558 | 3300041503 | Ga0451847_0935001 | Ga0451847_0935001_149_676 | 175 |
| 559 | 3300041509 | Ga0451843_0975489 | Ga0451843_0975489_96_656 | 175 |
| 560 | 3300041997 | Ga0439431_0000688 | Ga0439431_0000688_2281_2814 | 175 |
| 561 | 3300042004 | Ga0439445_0009926 | Ga0439445_0009926_668_1201 | 175 |
| 562 | 3300042014 | Ga0439457_000159 | Ga0439457_000159_49_576 | 175 |
| 563 | 3300042014 | Ga0439457_067419 | Ga0439457_067419_63_590 | 175 |
| 564 | 3300042876 | Ga0451577_0077388 | Ga0451577_0077388_945_1472 | 175 |
| 565 | 3300044656 | Ga0466969_0002159 | Ga0466969_0002159_3794_4330 | 175 |
| 566 | 3300044658 | Ga0466972_0004850 | Ga0466972_0004850_2152_2685 | 175 |
| 567 | 3300044673 | Ga0453683_0024956 | Ga0453683_0024956_1740_2267 | 175 |
| 568 | 3300044684 | Ga0466966_0000476 | Ga0466966_0000476_22861_23397 | 175 |
| 569 | 3300044712 | Ga0453684_0020539 | Ga0453684_0020539_2452_2979 | 175 |
| 570 | 3300044712 | Ga0453684_0036627 | Ga0453684_0036627_440_970 | 175 |
| 571 | 3300044719 | Ga0466971_0284766 | Ga0466971_0284766_192_722 | 175 |
| 572 | 3300044901 | Ga0466960_0093685 | Ga0466960_0093685_989_1516 | 175 |
| 573 | 3300045049 | Ga0466959_0000196 | Ga0466959_0000196_18573_19109 | 175 |
| 574 | 3300045051 | Ga0451576_0017853 | Ga0451576_0017853_3867_4394 | 175 |
| 575 | 3300046460 | Ga0495638_0206055 | Ga0495638_0206055_368_895 | 175 |
| 576 | 3300046616 | Ga0495668_0004021 | Ga0495668_0004021_3925_4458 | 175 |
| 577 | 3300046660 | Ga0495625_0280655 | Ga0495625_0280655_198_725 | 175 |
| 578 | 3300047318 | Ga0495636_0000121 | Ga0495636_0000121_21187_21720 | 175 |
| 579 | 3300047319 | Ga0495674_0475288 | Ga0495674_0475288_228_776 | 175 |
| 580 | 3300047320 | Ga0495672_0030355 | Ga0495672_0030355_2055_2585 | 175 |
| 581 | 3300049571 | Ga0501034_0067436 | Ga0501034_0067436_366_899 | 175 |
| 582 | 3300049651 | Ga0501201_009319 | Ga0501201_009319_145_675 | 175 |
| 583 | 3300049652 | Ga0501202_003246 | Ga0501202_003246_324_854 | 175 |
| 584 | 3300049654 | Ga0501207_004750 | Ga0501207_004750_1301_1831 | 175 |
| 585 | 3300049663 | Ga0501223_042946 | Ga0501223_042946_27_557 | 175 |
| 586 | 3300049664 | Ga0501224_016900 | Ga0501224_016900_120_650 | 175 |
| 587 | 3300049669 | Ga0501235_008052 | Ga0501235_008052_1488_2018 | 175 |
| 588 | 3300049675 | Ga0501243_017692 | Ga0501243_017692_73_603 | 175 |
| 589 | 3300049682 | Ga0501252_021828 | Ga0501252_021828_230_760 | 175 |
| 590 | 3300049684 | Ga0501255_004998 | Ga0501255_004998_325_855 | 175 |
| 591 | 3300049686 | Ga0501257_116858 | Ga0501257_116858_99_629 | 175 |
| 592 | 3300049703 | Ga0501219_000226 | Ga0501219_000226_5508_6035 | 175 |
| 593 | 3300049705 | Ga0501225_0097778 | Ga0501225_0097778_67_597 | 175 |
| 594 | 3300049707 | Ga0501234_008456 | Ga0501234_008456_15_545 | 175 |
| 595 | 3300049708 | Ga0501245_031088 | Ga0501245_031088_112_642 | 175 |
| 596 | 3300049744 | Ga0501083_0057910 | Ga0501083_0057910_202_732 | 175 |
| 597 | 3300049763 | Ga0501266_003887 | Ga0501266_003887_99_629 | 175 |
| 598 | 3300050005 | Ga0501284_00046 | Ga0501284_00046_24369_24896 | 175 |
| 599 | 3300050493 | nmdc:mga0k408_39018_c1 | nmdc:mga0k408_39018_c1_1290_1817 | 175 |
| 600 | 3300050507 | nmdc:mga05p37_6703_c1 | nmdc:mga05p37_6703_c1_3675_4202 | 175 |
| 601 | 3300050511 | nmdc:mga08y16_301684_c1 | nmdc:mga08y16_301684_c1_493_1026 | 175 |
| 602 | 3300050511 | nmdc:mga08y16_498247_c1 | nmdc:mga08y16_498247_c1_97_624 | 175 |
| 603 | 3300053086 | Ga0500578_0000010 | Ga0500578_0000010_111613_112266 | 175 |
| 604 | 3300053086 | Ga0500578_0337596 | Ga0500578_0337596_107_634 | 175 |
| 605 | 3300053088 | Ga0500644_0051970 | Ga0500644_0051970_642_1175 | 175 |
| 606 | 3300053089 | Ga0500581_225637 | Ga0500581_225637_165_698 | 175 |
| 607 | 3300053098 | Ga0500650_0285711 | Ga0500650_0285711_17_550 | 175 |
| 608 | 3300053104 | Ga0500556_0191262 | Ga0500556_0191262_55_582 | 175 |
| 609 | 3300053118 | Ga0500594_0005606 | Ga0500594_0005606_1297_1827 | 175 |
| 610 | 3300053131 | Ga0500652_035295 | Ga0500652_035295_827_1354 | 175 |
| 611 | 3300053147 | Ga0500589_047206 | Ga0500589_047206_1195_1722 | 175 |
| 612 | 3300053151 | Ga0500604_0018715 | Ga0500604_0018715_1237_1764 | 175 |
| 613 | 3300053156 | Ga0500622_0129217 | Ga0500622_0129217_448_975 | 175 |
| 614 | 3300053163 | Ga0500639_292754 | Ga0500639_292754_63_602 | 175 |
| 615 | 3300053178 | Ga0500637_0005750 | Ga0500637_0005750_4056_4583 | 175 |
| 616 | 3300053178 | Ga0500637_0222598 | Ga0500637_0222598_425_964 | 175 |
| 617 | 3300053730 | Ga0500645_082639 | Ga0500645_082639_287_814 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4czz-assembly1.cif.gz_A | histone demethylase lsd1(kdm1a)-corest3 complex | 0.8404 | 2 | 83 |
| 4tx5-assembly1.cif.gz_B | crystal structure of smac-diablo (in space group p65) | 0.5371 | 2 | 129 |
| 6bbi-assembly1.cif.gz_A | the crac channel orai in an unlatched-closed conformation; k163w loss-of-function mutation; p42212 crystal form | 0.5359 | 45 | 171 |
| 7xge-assembly3.cif.gz_E | crystal structure of mcl-1 in complex with computationally designed inhibitor protein | 0.5149 | 5 | 135 |
| 4akk-assembly1.cif.gz_B | structure of the nasr transcription antiterminator | 0.5071 | 15 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P31826_13_350_1.20.1560.10 | Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain | 0.893 | 2 | 77 | 1.20.1560.10 |
| af_B6TL61_1_296_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.8565 | 2 | 71 | 1.25.10.10 |
| 2uxnA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain | 0.8506 | 2 | 83 | 1.10.287.80 |
| 2iw5A03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain | 0.8505 | 2 | 83 | 1.10.287.80 |
| 4uvbA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain | 0.8477 | 2 | 83 | 1.10.287.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A355B7I5-F1-model_v4 | Protoporphyrinogen IX oxidase | 0.9869 | 2 | 111 |
GO:0005886
GO:0006782 GO:0016491 GO:0046872 |
| AF-A0A832H0H3-F1-model_v4 | Protoporphyrinogen IX oxidase | 0.979 | 2 | 72 |
GO:0005886
GO:0006782 GO:0016491 GO:0046872 |
| AF-A0A519V1Q3-F1-model_v4 | Protoporphyrinogen IX oxidase | 0.9784 | 2 | 133 |
GO:0005886
GO:0006782 GO:0016491 GO:0046872 |
| AF-A0A2L2XJM0-F1-model_v4 | Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) | 0.9671 | 2 | 174 |
GO:0005886
GO:0006782 GO:0046872 GO:0070818 |
| AF-A0A3C0NHS3-F1-model_v4 | Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) | 0.9632 | 2 | 174 |
GO:0005886
GO:0006782 GO:0046872 GO:0070818 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar