F469613

General Info

Members Datasets Scaffolds Average Seq Length
617 257 617 178

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100474374|Ga0070669_1004743741
Length 182
Sequence MYSYLKALHIIFVVTWFAGMFYMPRLFIYSTEAADKTEVECNILRSQFKIMMNRLWYGITWPSAILTLIFGPLVMFNGNWNKTILEPEGRWLLIKLIFVVLLYVYHFTLHKIFKQEMNGVYKYTSQQLRMWNEVSTIFLFAIVTLAVVKQSESFLWSLAGLIGFIIVLMSAIKIYKIIRTKK

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
176 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
222 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
223 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
224 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
225 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
226 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
227 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
228 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
229 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
230 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
231 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
232 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
233 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
234 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
246 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
247 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
248 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
249 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
250 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
251 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
252 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
253 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
256 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 0
Rhizoplane 0.32
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10011915 3300002077 Bacteria 1770
2 rootH2_10008684 3300003320 Bacteria 1333
3 rootH2_10237835 3300003320 Bacteria 1203
4 rootL2_10278346 3300003322 Bacteria 1345
5 rootH1_10249806 3300003323 Bacteria 1005
6 Ga0065712_10109465 3300005290 Bacteria 1854
7 Ga0065715_10159058 3300005293 Bacteria 1647
8 Ga0070658_10614478 3300005327 Bacteria 942
9 Ga0070676_10000659 3300005328 Bacteria 16800
10 Ga0070676_10051597 3300005328 Bacteria 2416
11 Ga0070683_100002540 3300005329 Bacteria 14571
12 Ga0070690_100011501 3300005330 Bacteria 5177
13 Ga0070670_100006829 3300005331 Bacteria 9669
14 Ga0070670_100294730 3300005331 Bacteria 1418
15 Ga0070670_100405260 3300005331 Unclassified 1204
16 Ga0068869_100007810 3300005334 Bacteria 6862
17 Ga0068869_100023401 3300005334 Bacteria 4265
18 Ga0068869_100180306 3300005334 Bacteria 1655
19 Ga0070666_10000172 3300005335 Bacteria 44437
20 Ga0070666_10029228 3300005335 Bacteria 3622
21 Ga0070666_10031744 3300005335 Bacteria 3488
22 Ga0070666_10053728 3300005335 Bacteria 2717
23 Ga0070666_10659269 3300005335 Unclassified 766
24 Ga0070680_100001877 3300005336 Bacteria 15408
25 Ga0070682_100003083 3300005337 Bacteria 9231
26 Ga0070682_100104573 3300005337 Bacteria 1875
27 Ga0070682_100225962 3300005337 Bacteria 1335
28 Ga0068868_100000356 3300005338 Bacteria 31040
29 Ga0068868_100020813 3300005338 Bacteria 4936
30 Ga0068868_100188326 3300005338 Bacteria 1715
31 Ga0070660_100090473 3300005339 Bacteria 2413
32 Ga0070660_100486178 3300005339 Bacteria 1026
33 Ga0070660_101043146 3300005339 Bacteria 691
34 Ga0070689_100042918 3300005340 Unclassified 3474
35 Ga0070689_100083467 3300005340 Bacteria 2511
36 Ga0070689_100183206 3300005340 Bacteria 1702
37 Ga0070691_10007560 3300005341 Bacteria 4982
38 Ga0070691_10441532 3300005341 Bacteria 741
39 Ga0070691_10655863 3300005341 Bacteria 625
40 Ga0070687_100008497 3300005343 Bacteria 4356
41 Ga0070661_100001916 3300005344 Bacteria 14406
42 Ga0070661_100037243 3300005344 Bacteria 3538
43 Ga0070661_100277099 3300005344 Bacteria 1300
44 Ga0070668_100000169 3300005347 Bacteria 41705
45 Ga0070668_100513652 3300005347 Bacteria 1039
46 Ga0070668_100627894 3300005347 Unclassified 942
47 Ga0070668_100736509 3300005347 Bacteria 872
48 Ga0070669_100001327 3300005353 Bacteria 17836
49 Ga0070669_100090722 3300005353 Bacteria 2291
50 Ga0070669_100474374 3300005353 Bacteria 1034
51 Ga0070669_101025489 3300005353 Unclassified 709
52 Ga0070669_101189009 3300005353 Bacteria 658
53 Ga0070675_100128445 3300005354 Bacteria 2158
54 Ga0070675_100187688 3300005354 Bacteria 1790
55 Ga0070675_100431633 3300005354 Bacteria 1179
56 Ga0070671_100030828 3300005355 Bacteria 4426
57 Ga0070671_100042930 3300005355 Bacteria 3760
58 Ga0070671_100227060 3300005355 Bacteria 1584
59 Ga0070671_100327674 3300005355 Bacteria 1305
60 Ga0070674_100006130 3300005356 Bacteria 6989
61 Ga0070674_100010282 3300005356 Bacteria 5649
62 Ga0070674_100993312 3300005356 Bacteria 736
63 Ga0070673_100001347 3300005364 Bacteria 14334
64 Ga0070673_100030855 3300005364 Bacteria 4017
65 Ga0070673_100266783 3300005364 Bacteria 1497
66 Ga0070673_100644748 3300005364 Bacteria 969
67 Ga0070688_100001808 3300005365 Bacteria 10715
68 Ga0070688_100090472 3300005365 Bacteria 1998
69 Ga0070688_100670563 3300005365 Bacteria 800
70 Ga0070659_101386648 3300005366 Bacteria 624
71 Ga0070667_100000553 3300005367 Bacteria 37217
72 Ga0070667_100059329 3300005367 Bacteria 3237
73 Ga0070667_100082513 3300005367 Unclassified 2753
74 Ga0070667_100127719 3300005367 Unclassified 2217
75 Ga0070667_100251887 3300005367 Bacteria 1579
76 Ga0070701_10026912 3300005438 Bacteria 2811
77 Ga0070701_10032532 3300005438 Bacteria 2598
78 Ga0070700_100043718 3300005441 Bacteria 2757
79 Ga0070663_100468579 3300005455 Bacteria 1041
80 Ga0070678_100059276 3300005456 Bacteria 2813
81 Ga0070678_100079700 3300005456 Bacteria 2478
82 Ga0070678_100609324 3300005456 Bacteria 976
83 Ga0070662_100003420 3300005457 Bacteria 9898
84 Ga0070681_10802155 3300005458 Bacteria 859
85 Ga0068867_100001171 3300005459 Bacteria 17945
86 Ga0068867_100059198 3300005459 Bacteria 2840
87 Ga0068867_100147246 3300005459 Unclassified 1847
88 Ga0068867_100204462 3300005459 Unclassified 1582
89 Ga0068867_100637648 3300005459 Unclassified 933
90 Ga0068867_100892596 3300005459 Unclassified 799
91 Ga0070685_10334066 3300005466 Bacteria 1031
92 Ga0070685_10647254 3300005466 Bacteria 765
93 Ga0070679_100000762 3300005530 Bacteria 27934
94 Ga0070679_100513209 3300005530 Bacteria 1142
95 Ga0070679_100807505 3300005530 Bacteria 881
96 Ga0070679_101001923 3300005530 Bacteria 779
97 Ga0070684_100003871 3300005535 Bacteria 11326
98 Ga0070684_100030321 3300005535 Bacteria 4593
99 Ga0070684_100263330 3300005535 Bacteria 1577
100 Ga0070684_100635040 3300005535 Bacteria 994
101 Ga0068853_100000272 3300005539 Bacteria 36612
102 Ga0068853_100003026 3300005539 Bacteria 12842
103 Ga0068853_100003946 3300005539 Bacteria 11393
104 Ga0068853_100014981 3300005539 Bacteria 6369
105 Ga0068853_100033225 3300005539 Bacteria 4375
106 Ga0068853_100195409 3300005539 Bacteria 1840
107 Ga0068853_100353312 3300005539 Bacteria 1368
108 Ga0070672_100000061 3300005543 Bacteria 49701
109 Ga0070672_100059193 3300005543 Bacteria 3013
110 Ga0070672_100144375 3300005543 Bacteria 1966
111 Ga0070672_100627817 3300005543 Bacteria 937
112 Ga0070672_101171752 3300005543 Bacteria 684
113 Ga0070686_100004012 3300005544 Bacteria 8092
114 Ga0070686_100005276 3300005544 Bacteria 7143
115 Ga0070693_100073096 3300005547 Bacteria 2025
116 Ga0070693_100256007 3300005547 Bacteria 1162
117 Ga0070665_100000612 3300005548 Bacteria 48973
118 Ga0070665_100629066 3300005548 Unclassified 1086
119 Ga0068855_100028833 3300005563 Bacteria 6642
120 Ga0068855_100042026 3300005563 Bacteria 5417
121 Ga0068855_100051852 3300005563 Bacteria 4832
122 Ga0068855_100228984 3300005563 Unclassified 2082
123 Ga0068855_100234182 3300005563 Bacteria 2054
124 Ga0068855_100501009 3300005563 Bacteria 1320
125 Ga0068855_100554906 3300005563 Bacteria 1243
126 Ga0070664_100002009 3300005564 Bacteria 16315
127 Ga0070664_100065677 3300005564 Bacteria 3097
128 Ga0070664_100256201 3300005564 Bacteria 1574
129 Ga0070664_100322192 3300005564 Bacteria 1401
130 Ga0070664_100452665 3300005564 Bacteria 1179
131 Ga0068857_100002332 3300005577 Bacteria 15434
132 Ga0068857_100004209 3300005577 Bacteria 12120
133 Ga0068857_100135791 3300005577 Bacteria 2221
134 Ga0068857_100201802 3300005577 Bacteria 1813
135 Ga0068857_100831217 3300005577 Bacteria 883
136 Ga0068854_100349244 3300005578 Bacteria 1210
137 Ga0068854_100600137 3300005578 Bacteria 940
138 Ga0068854_100731727 3300005578 Bacteria 857
139 Ga0068854_100879606 3300005578 Bacteria 786
140 Ga0068854_101499194 3300005578 Bacteria 612
141 Ga0068856_100093309 3300005614 Unclassified 2995
142 Ga0068856_100122613 3300005614 Bacteria 2601
143 Ga0068852_100001366 3300005616 Bacteria 16380
144 Ga0068852_100010723 3300005616 Bacteria 6862
145 Ga0068852_100037806 3300005616 Bacteria 4051
146 Ga0068852_100438587 3300005616 Bacteria 1291
147 Ga0068852_101486642 3300005616 Bacteria 700
148 Ga0068859_100000006 3300005617 Bacteria 421509
149 Ga0068859_100000859 3300005617 Bacteria 30939
150 Ga0068859_100036347 3300005617 Unclassified 4945
151 Ga0068859_101206227 3300005617 Bacteria 833
152 Ga0068864_100001631 3300005618 Bacteria 18493
153 Ga0068864_100090627 3300005618 Bacteria 2696
154 Ga0068864_100093958 3300005618 Bacteria 2649
155 Ga0068864_100357736 3300005618 Unclassified 1379
156 Ga0068861_100018572 3300005719 Bacteria 4954
157 Ga0068861_100270920 3300005719 Unclassified 1458
158 Ga0068861_100374350 3300005719 Unclassified 1256
159 Ga0068851_10086913 3300005834 Bacteria 1641
160 Ga0068851_10160689 3300005834 Unclassified 1234
161 Ga0068870_10009345 3300005840 Bacteria 4455
162 Ga0068863_100004540 3300005841 Bacteria 13688
163 Ga0068863_100070683 3300005841 Bacteria 3301
164 Ga0068863_100091351 3300005841 Bacteria 2887
165 Ga0068858_100002842 3300005842 Bacteria 17411
166 Ga0068858_100004312 3300005842 Bacteria 13973
167 Ga0068858_100051614 3300005842 Bacteria 3805
168 Ga0068858_100267988 3300005842 Bacteria 1624
169 Ga0068860_100000591 3300005843 Bacteria 43327
170 Ga0068860_100000759 3300005843 Bacteria 36404
171 Ga0068860_100004454 3300005843 Bacteria 14291
172 Ga0068860_100454305 3300005843 Bacteria 1274
173 Ga0068860_100760529 3300005843 Bacteria 981
174 Ga0068860_101559185 3300005843 Bacteria 682
175 Ga0068862_100002919 3300005844 Bacteria 14939
176 Ga0068862_100420176 3300005844 Bacteria 1254
177 Ga0068862_100960475 3300005844 Bacteria 843
178 Ga0081539_10011193 3300005985 Bacteria 7142
179 Ga0070715_10054110 3300006163 Bacteria 1737
180 Ga0075366_10030210 3300006195 Bacteria 3184
181 Ga0075366_10756499 3300006195 Bacteria 604
182 Ga0097621_100000821 3300006237 Bacteria 21965
183 Ga0097621_100001193 3300006237 Bacteria 18002
184 Ga0097621_100041626 3300006237 Bacteria 3698
185 Ga0068871_100002803 3300006358 Bacteria 11921
186 Ga0068871_100004016 3300006358 Bacteria 10166
187 Ga0068871_100014257 3300006358 Bacteria 5919
188 Ga0068871_100045150 3300006358 Bacteria 3545
189 Ga0068871_100116767 3300006358 Bacteria 2250
190 Ga0068871_100135701 3300006358 Unclassified 2090
191 Ga0068871_100159409 3300006358 Unclassified 1929
192 Ga0068865_100014490 3300006881 Bacteria 5010
193 Ga0068865_100135868 3300006881 Bacteria 1848
194 Ga0097620_100000006 3300006931 Bacteria 421509
195 Ga0097620_100000859 3300006931 Bacteria 30939
196 Ga0097620_100036347 3300006931 Unclassified 4945
197 Ga0097620_101206365 3300006931 Bacteria 833
198 Ga0105251_10113426 3300009011 Bacteria 1234
199 Ga0105240_10020001 3300009093 Bacteria 8937
200 Ga0105240_10043919 3300009093 Bacteria 5683
201 Ga0105240_10060041 3300009093 Unclassified 4742
202 Ga0105240_10096978 3300009093 Bacteria 3593
203 Ga0105240_10335714 3300009093 Unclassified 1718
204 Ga0105240_10657065 3300009093 Bacteria 1148
205 Ga0111539_10002870 3300009094 Bacteria 22880
206 Ga0111539_10126701 3300009094 Bacteria 2991
207 Ga0111539_10474867 3300009094 Bacteria 1456
208 Ga0105247_10088673 3300009101 Bacteria 1960
209 Ga0114129_10013606 3300009147 Bacteria 11594
210 Ga0105243_10495177 3300009148 Unclassified 1157
211 Ga0105241_10007669 3300009174 Bacteria 7933
212 Ga0105241_10028708 3300009174 Bacteria 4146
213 Ga0105241_10065769 3300009174 Bacteria 2802
214 Ga0105241_10078841 3300009174 Bacteria 2574
215 Ga0105241_10409374 3300009174 Unclassified 1191
216 Ga0105241_10552600 3300009174 Bacteria 1034
217 Ga0105242_10046854 3300009176 Bacteria 3509
218 Ga0105242_10075872 3300009176 Bacteria 2800
219 Ga0105248_11049674 3300009177 Bacteria 921
220 Ga0105248_11200624 3300009177 Bacteria 858
221 Ga0105237_10000783 3300009545 Bacteria 43494
222 Ga0105237_10021003 3300009545 Bacteria 6719
223 Ga0105237_10080474 3300009545 Bacteria 3248
224 Ga0105237_10130840 3300009545 Bacteria 2504
225 Ga0105238_10113628 3300009551 Bacteria 2687
226 Ga0105249_10000382 3300009553 Bacteria 44030
227 Ga0105249_10012057 3300009553 Bacteria 7608
228 Ga0105249_10031497 3300009553 Unclassified 4797
229 Ga0105249_10261437 3300009553 Bacteria 1720
230 Ga0105239_10005033 3300010375 Bacteria 15606
231 Ga0105239_10022820 3300010375 Bacteria 6899
232 Ga0105239_10051119 3300010375 Bacteria 4531
233 Ga0105239_10274624 3300010375 Bacteria 1896
234 Ga0105239_10479181 3300010375 Bacteria 1414
235 Ga0105239_10560448 3300010375 Bacteria 1301
236 Ga0105239_10562102 3300010375 Unclassified 1300
237 Ga0157373_10348979 3300013100 Bacteria 1055
238 Ga0157371_10004208 3300013102 Bacteria 12666
239 Ga0157371_10033076 3300013102 Bacteria 3717
240 Ga0157371_10301283 3300013102 Bacteria 1160
241 Ga0157371_10321055 3300013102 Unclassified 1124
242 Ga0157370_10000526 3300013104 Bacteria 47828
243 Ga0157370_10003149 3300013104 Bacteria 19547
244 Ga0157370_10098956 3300013104 Bacteria 2734
245 Ga0157370_10278657 3300013104 Bacteria 1545
246 Ga0157370_10834577 3300013104 Bacteria 838
247 Ga0157369_10015290 3300013105 Bacteria 8654
248 Ga0157369_10479006 3300013105 Bacteria 1288
249 Ga0157374_10000627 3300013296 Bacteria 31113
250 Ga0157374_10040230 3300013296 Bacteria 4304
251 Ga0157374_10059540 3300013296 Bacteria 3572
252 Ga0157374_10150263 3300013296 Unclassified 2264
253 Ga0157374_10354881 3300013296 Bacteria 1457
254 Ga0157374_10675667 3300013296 Bacteria 1045
255 Ga0157374_11092791 3300013296 Bacteria 818
256 Ga0157378_10005519 3300013297 Bacteria 11081
257 Ga0157378_10060645 3300013297 Bacteria 3375
258 Ga0157378_10142534 3300013297 Bacteria 2226
259 Ga0157378_10374710 3300013297 Unclassified 1396
260 Ga0157378_10536178 3300013297 Unclassified 1174
261 Ga0157378_10693772 3300013297 Bacteria 1037
262 Ga0157378_11647502 3300013297 Bacteria 688
263 Ga0163162_10000752 3300013306 Bacteria 30172
264 Ga0163162_10001770 3300013306 Bacteria 20242
265 Ga0163162_10002582 3300013306 Bacteria 17141
266 Ga0163162_10014638 3300013306 Bacteria 7663
267 Ga0163162_10038942 3300013306 Bacteria 4747
268 Ga0163162_10294261 3300013306 Unclassified 1755
269 Ga0163162_10424049 3300013306 Unclassified 1462
270 Ga0163162_10660586 3300013306 Bacteria 1169
271 Ga0157372_10025872 3300013307 Bacteria 6382
272 Ga0157372_10050274 3300013307 Bacteria 4637
273 Ga0157372_10067425 3300013307 Bacteria 4021
274 Ga0157372_10116837 3300013307 Bacteria 3059
275 Ga0157372_10158595 3300013307 Unclassified 2614
276 Ga0157372_10338705 3300013307 Unclassified 1752
277 Ga0157372_10484414 3300013307 Bacteria 1442
278 Ga0157372_10678028 3300013307 Bacteria 1200
279 Ga0157372_10811678 3300013307 Bacteria 1087
280 Ga0157372_11310325 3300013307 Bacteria 836
281 Ga0157372_11853703 3300013307 Bacteria 693
282 Ga0157375_10000098 3300013308 Bacteria 88130
283 Ga0157375_10025649 3300013308 Bacteria 5482
284 Ga0157375_10038531 3300013308 Bacteria 4589
285 Ga0157375_10065145 3300013308 Unclassified 3631
286 Ga0157375_10105638 3300013308 Unclassified 2907
287 Ga0157375_10115063 3300013308 Bacteria 2792
288 Ga0157375_10179529 3300013308 Bacteria 2268
289 Ga0157375_10319680 3300013308 Unclassified 1717
290 Ga0163163_10000272 3300014325 Bacteria 51699
291 Ga0163163_10007094 3300014325 Bacteria 9851
292 Ga0163163_10045086 3300014325 Bacteria 4327
293 Ga0163163_10114381 3300014325 Bacteria 2729
294 Ga0163163_10758555 3300014325 Bacteria 1034
295 Ga0157380_10001666 3300014326 Bacteria 14658
296 Ga0157380_10005979 3300014326 Bacteria 8515
297 Ga0157380_10641542 3300014326 Bacteria 1058
298 Ga0157377_10000309 3300014745 Bacteria 22464
299 Ga0157377_10002499 3300014745 Bacteria 8141
300 Ga0157377_10011657 3300014745 Bacteria 4395
301 Ga0157377_10075528 3300014745 Unclassified 1957
302 Ga0157379_10000103 3300014968 Bacteria 58102
303 Ga0157379_10009802 3300014968 Bacteria 8347
304 Ga0157379_10072143 3300014968 Unclassified 3089
305 Ga0157379_10176400 3300014968 Bacteria 1930
306 Ga0157376_10000286 3300014969 Bacteria 34101
307 Ga0157376_10055088 3300014969 Unclassified 3317
308 Ga0157376_10218478 3300014969 Bacteria 1764
309 Ga0157376_10226300 3300014969 Bacteria 1735
310 Ga0157376_10226557 3300014969 Bacteria 1734
311 Ga0157376_10227705 3300014969 Unclassified 1730
312 Ga0157376_10650684 3300014969 Bacteria 1054
313 Ga0163161_10014989 3300017792 Bacteria 5401
314 Ga0163161_10054658 3300017792 Bacteria 2898
315 Ga0163161_10062763 3300017792 Bacteria 2707
316 Ga0163161_10074880 3300017792 Bacteria 2483
317 Ga0209646_1002334 3300025246 Bacteria 4296
318 Ga0207656_10000540 3300025321 Bacteria 12542
319 Ga0207656_10040022 3300025321 Bacteria 1986
320 Ga0207682_10092091 3300025893 Bacteria 1316
321 Ga0207710_10252505 3300025900 Bacteria 882
322 Ga0207688_10110052 3300025901 Bacteria 1598
323 Ga0207680_10167578 3300025903 Bacteria 1477
324 Ga0207680_10247035 3300025903 Bacteria 1231
325 Ga0207680_10252699 3300025903 Unclassified 1218
326 Ga0207685_10204161 3300025905 Unclassified 930
327 Ga0207645_10001904 3300025907 Bacteria 16844
328 Ga0207645_10010821 3300025907 Bacteria 6252
329 Ga0207645_10065794 3300025907 Bacteria 2317
330 Ga0207645_10068295 3300025907 Bacteria 2273
331 Ga0207643_10034493 3300025908 Unclassified 2835
332 Ga0207705_10047558 3300025909 Bacteria 3085
333 Ga0207705_10141763 3300025909 Bacteria 1795
334 Ga0207705_10330929 3300025909 Bacteria 1171
335 Ga0207705_10629668 3300025909 Bacteria 834
336 Ga0207654_10032859 3300025911 Bacteria 2871
337 Ga0207654_10241864 3300025911 Unclassified 1206
338 Ga0207654_10347736 3300025911 Bacteria 1020
339 Ga0207654_10906008 3300025911 Unclassified 639
340 Ga0207707_10000160 3300025912 Bacteria 70695
341 Ga0207695_10006273 3300025913 Bacteria 15478
342 Ga0207695_10042989 3300025913 Bacteria 4819
343 Ga0207695_10077416 3300025913 Bacteria 3378
344 Ga0207695_10217270 3300025913 Bacteria 1820
345 Ga0207695_10338890 3300025913 Bacteria 1391
346 Ga0207671_10015537 3300025914 Bacteria 5954
347 Ga0207671_10154433 3300025914 Bacteria 1775
348 Ga0207660_10004570 3300025917 Bacteria 9015
349 Ga0207660_10129544 3300025917 Bacteria 1919
350 Ga0207662_10014592 3300025918 Bacteria 4411
351 Ga0207662_10343136 3300025918 Bacteria 1001
352 Ga0207657_10129481 3300025919 Bacteria 2070
353 Ga0207657_10257925 3300025919 Bacteria 1388
354 Ga0207657_10320349 3300025919 Bacteria 1226
355 Ga0207649_10253094 3300025920 Bacteria 1269
356 Ga0207652_10000108 3300025921 Bacteria 90141
357 Ga0207652_10000346 3300025921 Bacteria 48060
358 Ga0207652_10020113 3300025921 Bacteria 5497
359 Ga0207652_10052631 3300025921 Bacteria 3495
360 Ga0207652_10214910 3300025921 Bacteria 1732
361 Ga0207681_10202264 3300025923 Unclassified 1526
362 Ga0207681_10574780 3300025923 Bacteria 929
363 Ga0207681_10895064 3300025923 Unclassified 743
364 Ga0207694_11301844 3300025924 Unclassified 615
365 Ga0207650_10375590 3300025925 Bacteria 1173
366 Ga0207659_10183491 3300025926 Bacteria 1660
367 Ga0207659_10331637 3300025926 Bacteria 1258
368 Ga0207644_10117256 3300025931 Bacteria 2022
369 Ga0207644_10937546 3300025931 Unclassified 726
370 Ga0207644_11155539 3300025931 Bacteria 651
371 Ga0207644_11347911 3300025931 Bacteria 599
372 Ga0207690_10024864 3300025932 Bacteria 3755
373 Ga0207690_10157582 3300025932 Bacteria 1689
374 Ga0207690_10231282 3300025932 Bacteria 1419
375 Ga0207706_10014866 3300025933 Bacteria 7048
376 Ga0207706_10031145 3300025933 Bacteria 4754
377 Ga0207706_10298912 3300025933 Bacteria 1403
378 Ga0207686_10180685 3300025934 Bacteria 1496
379 Ga0207670_10115994 3300025936 Bacteria 1938
380 Ga0207670_10244675 3300025936 Bacteria 1383
381 Ga0207670_10364625 3300025936 Bacteria 1147
382 Ga0207670_10805275 3300025936 Bacteria 783
383 Ga0207669_10020099 3300025937 Bacteria 3493
384 Ga0207669_11073116 3300025937 Bacteria 679
385 Ga0207704_10031376 3300025938 Bacteria 2993
386 Ga0207704_10134838 3300025938 Bacteria 1717
387 Ga0207691_10000154 3300025940 Bacteria 64281
388 Ga0207691_10049077 3300025940 Bacteria 3868
389 Ga0207691_10055181 3300025940 Unclassified 3622
390 Ga0207711_11201057 3300025941 Bacteria 700
391 Ga0207689_10033435 3300025942 Bacteria 4273
392 Ga0207689_10093738 3300025942 Unclassified 2466
393 Ga0207689_10144577 3300025942 Bacteria 1959
394 Ga0207689_10580097 3300025942 Bacteria 943
395 Ga0207661_10001233 3300025944 Bacteria 17127
396 Ga0207661_10129095 3300025944 Bacteria 2163
397 Ga0207661_10137080 3300025944 Bacteria 2103
398 Ga0207661_10197835 3300025944 Bacteria 1766
399 Ga0207661_11407214 3300025944 Bacteria 640
400 Ga0207679_10000927 3300025945 Bacteria 18727
401 Ga0207679_10049087 3300025945 Bacteria 3077
402 Ga0207679_10086199 3300025945 Bacteria 2415
403 Ga0207679_10180904 3300025945 Bacteria 1744
404 Ga0207679_10427396 3300025945 Bacteria 1170
405 Ga0207679_10433834 3300025945 Bacteria 1162
406 Ga0207667_10005756 3300025949 Bacteria 15128
407 Ga0207667_10029528 3300025949 Bacteria 5946
408 Ga0207667_10188463 3300025949 Unclassified 2117
409 Ga0207667_10297170 3300025949 Bacteria 1650
410 Ga0207651_10002052 3300025960 Bacteria 9478
411 Ga0207651_10140706 3300025960 Bacteria 1863
412 Ga0207651_10343950 3300025960 Bacteria 1254
413 Ga0207712_10025595 3300025961 Unclassified 3922
414 Ga0207712_10124481 3300025961 Bacteria 1955
415 Ga0207712_10287939 3300025961 Unclassified 1343
416 Ga0207668_10001109 3300025972 Bacteria 16020
417 Ga0207668_10088965 3300025972 Bacteria 2263
418 Ga0207668_10102660 3300025972 Bacteria 2128
419 Ga0207668_10120358 3300025972 Bacteria 1987
420 Ga0207668_10381315 3300025972 Bacteria 1187
421 Ga0207640_10577038 3300025981 Bacteria 949
422 Ga0207640_10643628 3300025981 Unclassified 902
423 Ga0207640_10830241 3300025981 Bacteria 803
424 Ga0207658_10000570 3300025986 Bacteria 33415
425 Ga0207658_10022942 3300025986 Bacteria 4350
426 Ga0207658_10204637 3300025986 Bacteria 1650
427 Ga0207658_10223522 3300025986 Bacteria 1585
428 Ga0207658_10234132 3300025986 Bacteria 1552
429 Ga0207677_10015213 3300026023 Bacteria 4517
430 Ga0207677_10073265 3300026023 Bacteria 2424
431 Ga0207677_10139529 3300026023 Bacteria 1854
432 Ga0207677_10163276 3300026023 Bacteria 1733
433 Ga0207677_10202127 3300026023 Unclassified 1580
434 Ga0207703_10000883 3300026035 Bacteria 29482
435 Ga0207703_10032255 3300026035 Bacteria 4145
436 Ga0207639_10000837 3300026041 Bacteria 20872
437 Ga0207639_10003361 3300026041 Bacteria 10760
438 Ga0207639_10004478 3300026041 Bacteria 9430
439 Ga0207639_10046112 3300026041 Bacteria 3287
440 Ga0207639_10057721 3300026041 Bacteria 2982
441 Ga0207639_10215096 3300026041 Bacteria 1657
442 Ga0207639_10490562 3300026041 Bacteria 1121
443 Ga0207678_10180210 3300026067 Unclassified 1804
444 Ga0207678_10901456 3300026067 Bacteria 782
445 Ga0207708_10144907 3300026075 Bacteria 1866
446 Ga0207702_10244763 3300026078 Bacteria 1682
447 Ga0207702_10513438 3300026078 Bacteria 1169
448 Ga0207641_10009123 3300026088 Bacteria 8191
449 Ga0207641_10235769 3300026088 Bacteria 1703
450 Ga0207648_10004750 3300026089 Bacteria 13885
451 Ga0207648_10013015 3300026089 Bacteria 7761
452 Ga0207648_10047452 3300026089 Bacteria 3765
453 Ga0207648_10056597 3300026089 Bacteria 3422
454 Ga0207648_10263192 3300026089 Unclassified 1539
455 Ga0207648_10556297 3300026089 Bacteria 1054
456 Ga0207648_10657785 3300026089 Bacteria 969
457 Ga0207648_10753525 3300026089 Bacteria 904
458 Ga0207676_10000948 3300026095 Bacteria 22386
459 Ga0207676_10136719 3300026095 Bacteria 2092
460 Ga0207674_10004662 3300026116 Bacteria 16459
461 Ga0207674_10009039 3300026116 Bacteria 11445
462 Ga0207674_10034432 3300026116 Bacteria 5293
463 Ga0207674_10369895 3300026116 Bacteria 1386
464 Ga0207674_10398930 3300026116 Bacteria 1329
465 Ga0207675_100000655 3300026118 Bacteria 34051
466 Ga0207675_100228161 3300026118 Bacteria 1796
467 Ga0207675_100378090 3300026118 Unclassified 1392
468 Ga0207675_100816659 3300026118 Bacteria 946
469 Ga0207683_10097030 3300026121 Bacteria 2628
470 Ga0207683_10102963 3300026121 Bacteria 2550
471 Ga0207683_10179196 3300026121 Bacteria 1921
472 Ga0207683_10469333 3300026121 Bacteria 1161
473 Ga0207698_10024765 3300026142 Bacteria 4218
474 Ga0207698_10133092 3300026142 Bacteria 2128
475 Ga0207698_10221436 3300026142 Bacteria 1710
476 Ga0207698_10400217 3300026142 Bacteria 1312
477 Ga0207698_11465172 3300026142 Bacteria 698
478 Ga0207698_11481689 3300026142 Bacteria 694
479 Ga0207428_10314989 3300027907 Bacteria 1156
480 Ga0268266_10000986 3300028379 Bacteria 35861
481 Ga0268266_10475280 3300028379 Unclassified 1191
482 Ga0268265_10065613 3300028380 Unclassified 2802
483 Ga0268265_11264255 3300028380 Bacteria 737
484 Ga0268264_10001126 3300028381 Bacteria 26251
485 Ga0268264_10008368 3300028381 Bacteria 8599
486 Ga0268264_10014848 3300028381 Bacteria 6397
487 Ga0268264_10397215 3300028381 Unclassified 1324
488 Ga0265327_10000022 3300031251 Bacteria 402724
489 Ga0307513_10139436 3300031456 Bacteria 2354
490 Ga0307513_10143280 3300031456 Bacteria 2312
491 Ga0307513_10192880 3300031456 Bacteria 1887
492 Ga0307509_10009531 3300031507 Bacteria 12104
493 Ga0307509_10011098 3300031507 Bacteria 10971
494 Ga0307408_100140067 3300031548 Bacteria 1898
495 Ga0307508_10000181 3300031616 Bacteria 76433
496 Ga0307405_10456026 3300031731 Bacteria 1015
497 Ga0307413_10037934 3300031824 Bacteria 2788
498 Ga0307406_10420835 3300031901 Bacteria 1064
499 Ga0307406_10832403 3300031901 Bacteria 781
500 Ga0307412_10486972 3300031911 Bacteria 1024
501 Ga0307416_100047859 3300032002 Bacteria 3388
502 Ga0307414_10084974 3300032004 Bacteria 2330
503 Ga0307411_10299046 3300032005 Bacteria 1290
504 Ga0373924_0045673 3300035410 Bacteria 1802
505 Ga0373935_0332142 3300035692 Unclassified 1081
506 Ga0373935_0740890 3300035692 Bacteria 724
507 Ga0373937_0110017 3300036401 Bacteria 2562
508 Ga0395899_0018080 3300037312 Bacteria 5365
509 Ga0395899_0018960 3300037312 Bacteria 5228
510 Ga0395900_0000573 3300037418 Bacteria 50934
511 Ga0395900_0006676 3300037418 Bacteria 11989
512 Ga0395900_0787397 3300037418 Bacteria 879
513 Ga0395898_0033959 3300037466 Bacteria 5088
514 Ga0395901_0001343 3300038443 Bacteria 25786
515 Ga0395901_0407643 3300038443 Bacteria 1396
516 Ga0439436_0014062 3300041404 Bacteria 2419
517 Ga0439436_0072307 3300041404 Bacteria 961
518 Ga0451793_1150992 3300041452 Unclassified 737
519 Ga0451847_0935001 3300041503 Bacteria 694
520 Ga0451843_0975489 3300041509 Bacteria 762
521 Ga0439431_0000688 3300041997 Bacteria 7272
522 Ga0439445_0009926 3300042004 Bacteria 2247
523 Ga0439449_0008171 3300042007 Bacteria 3978
524 Ga0439457_000159 3300042014 Bacteria 17442
525 Ga0439457_006130 3300042014 Bacteria 2968
526 Ga0439457_067419 3300042014 Bacteria 814
527 Ga0451577_0077388 3300042876 Unclassified 2966
528 Ga0466969_0002159 3300044656 Bacteria 10497
529 Ga0466972_0004850 3300044658 Bacteria 6745
530 Ga0453683_0024956 3300044673 Unclassified 3799
531 Ga0466966_0000476 3300044684 Bacteria 25812
532 Ga0453684_0001960 3300044712 Bacteria 53054
533 Ga0453684_0020539 3300044712 Bacteria 9951
534 Ga0453684_0036627 3300044712 Bacteria 6757
535 Ga0466971_0284766 3300044719 Bacteria 791
536 Ga0466960_0093685 3300044901 Bacteria 1535
537 Ga0466959_0000196 3300045049 Bacteria 39994
538 Ga0451576_0004672 3300045051 Bacteria 17636
539 Ga0451576_0017853 3300045051 Bacteria 7793
540 Ga0495629_0066297 3300046459 Bacteria 2520
541 Ga0495638_0206055 3300046460 Bacteria 1107
542 Ga0495653_0104419 3300046463 Bacteria 2048
543 Ga0495653_0280283 3300046463 Unclassified 1094
544 Ga0495580_0195549 3300046472 Bacteria 1394
545 Ga0495580_0291319 3300046472 Bacteria 1113
546 Ga0495608_0078140 3300046511 Bacteria 2154
547 Ga0495628_0850492 3300046516 Bacteria 636
548 Ga0495630_0093040 3300046517 Bacteria 2279
549 Ga0495652_0203485 3300046529 Bacteria 1501
550 Ga0495665_0420781 3300046531 Unclassified 677
551 Ga0495587_0067386 3300046536 Bacteria 2087
552 Ga0495667_0090797 3300046559 Bacteria 1979
553 Ga0495668_0004021 3300046616 Bacteria 10705
554 Ga0495634_0459554 3300046642 Bacteria 750
555 Ga0495625_0280655 3300046660 Bacteria 1072
556 Ga0495646_0276153 3300046680 Unclassified 894
557 Ga0495647_0306968 3300046681 Unclassified 716
558 Ga0495658_0007718 3300046683 Bacteria 5331
559 Ga0495600_0074639 3300046809 Bacteria 2215
560 Ga0495636_0000121 3300047318 Bacteria 32451
561 Ga0495674_0242412 3300047319 Bacteria 1485
562 Ga0495674_0475288 3300047319 Bacteria 1002
563 Ga0495672_0026716 3300047320 Bacteria 3679
564 Ga0495672_0030355 3300047320 Bacteria 3393
565 Ga0495684_0801035 3300047471 Unclassified 615
566 Ga0495602_0354147 3300048088 Bacteria 1059
567 Ga0496105_0091693 3300048908 Bacteria 2509
568 Ga0501032_0030108 3300049569 Bacteria 3723
569 Ga0501033_0008685 3300049570 Bacteria 7859
570 Ga0501033_0461063 3300049570 Bacteria 882
571 Ga0501034_0001589 3300049571 Bacteria 29569
572 Ga0501034_0067436 3300049571 Bacteria 3591
573 Ga0501034_0274010 3300049571 Bacteria 1628
574 Ga0501037_0049897 3300049573 Unclassified 3064
575 Ga0501047_0002822 3300049581 Bacteria 16494
576 Ga0501070_0153719 3300049586 Bacteria 1898
577 Ga0501201_009319 3300049651 Bacteria 954
578 Ga0501202_003246 3300049652 Bacteria 2777
579 Ga0501207_004750 3300049654 Bacteria 1860
580 Ga0501223_042946 3300049663 Bacteria 877
581 Ga0501224_016900 3300049664 Bacteria 1084
582 Ga0501235_008052 3300049669 Bacteria 2298
583 Ga0501243_017692 3300049675 Bacteria 1157
584 Ga0501252_021828 3300049682 Bacteria 842
585 Ga0501255_004998 3300049684 Bacteria 1308
586 Ga0501257_116858 3300049686 Bacteria 711
587 Ga0501219_000226 3300049703 Bacteria 10710
588 Ga0501225_0097778 3300049705 Bacteria 855
589 Ga0501234_008456 3300049707 Bacteria 1603
590 Ga0501245_031088 3300049708 Bacteria 883
591 Ga0501083_0057910 3300049744 Bacteria 2593
592 Ga0501266_003887 3300049763 Bacteria 1850
593 Ga0501035_0017448 3300049822 Bacteria 6621
594 Ga0501035_0445353 3300049822 Bacteria 1072
595 Ga0501044_0017697 3300049823 Bacteria 7644
596 Ga0501284_00046 3300050005 Bacteria 47876
597 nmdc:mga0k408_39018_c1 3300050493 Bacteria 2727
598 nmdc:mga05p37_6703_c1 3300050507 Bacteria 13569
599 nmdc:mga06r32_23414_c1 3300050510 Bacteria 5713
600 nmdc:mga08y16_301684_c1 3300050511 Bacteria 1651
601 nmdc:mga08y16_498247_c1 3300050511 Bacteria 1238
602 Ga0495619_0029100 3300053085 Bacteria 3567
603 Ga0500578_0000010 3300053086 Bacteria 217642
604 Ga0500578_0337596 3300053086 Bacteria 884
605 Ga0500644_0051970 3300053088 Bacteria 1409
606 Ga0500581_225637 3300053089 Unclassified 809
607 Ga0500650_0285711 3300053098 Bacteria 733
608 Ga0500556_0191262 3300053104 Bacteria 809
609 Ga0500594_0005606 3300053118 Bacteria 2787
610 Ga0500652_035295 3300053131 Bacteria 1986
611 Ga0500589_047206 3300053147 Bacteria 2004
612 Ga0500604_0018715 3300053151 Bacteria 1933
613 Ga0500622_0129217 3300053156 Bacteria 1216
614 Ga0500639_292754 3300053163 Bacteria 618
615 Ga0500637_0005750 3300053178 Bacteria 6037
616 Ga0500637_0222598 3300053178 Bacteria 1066
617 Ga0500645_082639 3300053730 Unclassified 916

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0026716 Ga0495672_0026716_392_940 165
2 3300005719 Ga0068861_100270920 Ga0068861_1002709202 166
3 3300014745 Ga0157377_10075528 Ga0157377_100755282 166
4 3300006237 Ga0097621_100041626 Ga0097621_1000416262 169
5 3300006358 Ga0068871_100014257 Ga0068871_1000142572 169
6 3300013297 Ga0157378_10142534 Ga0157378_101425342 169
7 3300013306 Ga0163162_10424049 Ga0163162_104240492 169
8 3300013308 Ga0157375_10105638 Ga0157375_101056382 169
9 3300014968 Ga0157379_10072143 Ga0157379_100721432 169
10 3300017792 Ga0163161_10062763 Ga0163161_100627632 169
11 3300005337 Ga0070682_100225962 Ga0070682_1002259622 173
12 3300005466 Ga0070685_10334066 Ga0070685_103340662 173
13 3300005616 Ga0068852_100001366 Ga0068852_1000013661 173
14 3300005617 Ga0068859_100000006 Ga0068859_100000006376 173
15 3300005618 Ga0068864_100090627 Ga0068864_1000906272 173
16 3300005834 Ga0068851_10160689 Ga0068851_101606892 173
17 3300005841 Ga0068863_100091351 Ga0068863_1000913512 173
18 3300005842 Ga0068858_100002842 Ga0068858_1000028428 173
19 3300006358 Ga0068871_100135701 Ga0068871_1001357013 173
20 3300006931 Ga0097620_100000006 Ga0097620_100000006376 173
21 3300009147 Ga0114129_10013606 Ga0114129_100136064 173
22 3300009148 Ga0105243_10495177 Ga0105243_104951771 173
23 3300009545 Ga0105237_10000783 Ga0105237_1000078313 173
24 3300009553 Ga0105249_10000382 Ga0105249_1000038221 173
25 3300010375 Ga0105239_10051119 Ga0105239_100511192 173
26 3300013306 Ga0163162_10038942 Ga0163162_100389422 173
27 3300013308 Ga0157375_10115063 Ga0157375_101150631 173
28 3300014325 Ga0163163_10114381 Ga0163163_101143812 173
29 3300014969 Ga0157376_10218478 Ga0157376_102184781 173
30 3300050510 nmdc:mga06r32_23414_c1 nmdc:mga06r32_23414_c1_108_632 173
31 3300003320 rootH2_10237835 rootH2_102378351 174
32 3300005329 Ga0070683_100002540 Ga0070683_1000025408 174
33 3300005331 Ga0070670_100405260 Ga0070670_1004052602 174
34 3300005334 Ga0068869_100007810 Ga0068869_1000078105 174
35 3300005334 Ga0068869_100023401 Ga0068869_1000234012 174
36 3300005335 Ga0070666_10029228 Ga0070666_100292282 174
37 3300005335 Ga0070666_10053728 Ga0070666_100537282 174
38 3300005337 Ga0070682_100104573 Ga0070682_1001045732 174
39 3300005338 Ga0068868_100020813 Ga0068868_1000208132 174
40 3300005339 Ga0070660_100090473 Ga0070660_1000904734 174
41 3300005339 Ga0070660_100486178 Ga0070660_1004861781 174
42 3300005340 Ga0070689_100083467 Ga0070689_1000834672 174
43 3300005341 Ga0070691_10441532 Ga0070691_104415321 174
44 3300005341 Ga0070691_10655863 Ga0070691_106558631 174
45 3300005344 Ga0070661_100001916 Ga0070661_1000019163 174
46 3300005347 Ga0070668_100513652 Ga0070668_1005136521 174
47 3300005353 Ga0070669_101025489 Ga0070669_1010254891 174
48 3300005353 Ga0070669_101189009 Ga0070669_1011890091 174
49 3300005355 Ga0070671_100030828 Ga0070671_1000308284 174
50 3300005355 Ga0070671_100227060 Ga0070671_1002270602 174
51 3300005364 Ga0070673_100266783 Ga0070673_1002667832 174
52 3300005364 Ga0070673_100644748 Ga0070673_1006447482 174
53 3300005365 Ga0070688_100090472 Ga0070688_1000904722 174
54 3300005366 Ga0070659_101386648 Ga0070659_1013866481 174
55 3300005367 Ga0070667_100059329 Ga0070667_1000593291 174
56 3300005367 Ga0070667_100082513 Ga0070667_1000825133 174
57 3300005367 Ga0070667_100127719 Ga0070667_1001277192 174
58 3300005455 Ga0070663_100468579 Ga0070663_1004685791 174
59 3300005458 Ga0070681_10802155 Ga0070681_108021552 174
60 3300005459 Ga0068867_100059198 Ga0068867_1000591983 174
61 3300005459 Ga0068867_100204462 Ga0068867_1002044622 174
62 3300005459 Ga0068867_100637648 Ga0068867_1006376482 174
63 3300005466 Ga0070685_10647254 Ga0070685_106472541 174
64 3300005530 Ga0070679_100000762 Ga0070679_10000076212 174
65 3300005530 Ga0070679_100513209 Ga0070679_1005132092 174
66 3300005530 Ga0070679_100807505 Ga0070679_1008075052 174
67 3300005530 Ga0070679_101001923 Ga0070679_1010019231 174
68 3300005535 Ga0070684_100003871 Ga0070684_1000038717 174
69 3300005535 Ga0070684_100030321 Ga0070684_1000303212 174
70 3300005535 Ga0070684_100263330 Ga0070684_1002633302 174
71 3300005535 Ga0070684_100635040 Ga0070684_1006350401 174
72 3300005539 Ga0068853_100003026 Ga0068853_1000030268 174
73 3300005539 Ga0068853_100014981 Ga0068853_1000149817 174
74 3300005539 Ga0068853_100195409 Ga0068853_1001954093 174
75 3300005543 Ga0070672_100627817 Ga0070672_1006278172 174
76 3300005544 Ga0070686_100005276 Ga0070686_1000052762 174
77 3300005547 Ga0070693_100256007 Ga0070693_1002560072 174
78 3300005563 Ga0068855_100042026 Ga0068855_1000420262 174
79 3300005563 Ga0068855_100234182 Ga0068855_1002341824 174
80 3300005563 Ga0068855_100501009 Ga0068855_1005010091 174
81 3300005563 Ga0068855_100554906 Ga0068855_1005549063 174
82 3300005564 Ga0070664_100002009 Ga0070664_10000200911 174
83 3300005564 Ga0070664_100065677 Ga0070664_1000656772 174
84 3300005564 Ga0070664_100256201 Ga0070664_1002562011 174
85 3300005564 Ga0070664_100322192 Ga0070664_1003221922 174
86 3300005577 Ga0068857_100004209 Ga0068857_1000042097 174
87 3300005577 Ga0068857_100135791 Ga0068857_1001357912 174
88 3300005577 Ga0068857_100831217 Ga0068857_1008312172 174
89 3300005578 Ga0068854_100731727 Ga0068854_1007317271 174
90 3300005578 Ga0068854_100879606 Ga0068854_1008796061 174
91 3300005578 Ga0068854_101499194 Ga0068854_1014991941 174
92 3300005614 Ga0068856_100093309 Ga0068856_1000933093 174
93 3300005616 Ga0068852_100010723 Ga0068852_1000107232 174
94 3300005616 Ga0068852_100037806 Ga0068852_1000378062 174
95 3300005616 Ga0068852_100438587 Ga0068852_1004385872 174
96 3300005617 Ga0068859_100036347 Ga0068859_1000363475 174
97 3300005618 Ga0068864_100093958 Ga0068864_1000939582 174
98 3300005618 Ga0068864_100357736 Ga0068864_1003577361 174
99 3300005719 Ga0068861_100374350 Ga0068861_1003743502 174
100 3300005834 Ga0068851_10086913 Ga0068851_100869132 174
101 3300005842 Ga0068858_100267988 Ga0068858_1002679882 174
102 3300005843 Ga0068860_100000759 Ga0068860_10000075910 174
103 3300005843 Ga0068860_100454305 Ga0068860_1004543052 174
104 3300005844 Ga0068862_100002919 Ga0068862_10000291911 174
105 3300005844 Ga0068862_100960475 Ga0068862_1009604752 174
106 3300006163 Ga0070715_10054110 Ga0070715_100541102 174
107 3300006358 Ga0068871_100045150 Ga0068871_1000451502 174
108 3300006931 Ga0097620_100036347 Ga0097620_1000363475 174
109 3300009011 Ga0105251_10113426 Ga0105251_101134262 174
110 3300009093 Ga0105240_10020001 Ga0105240_100200015 174
111 3300009093 Ga0105240_10335714 Ga0105240_103357143 174
112 3300009174 Ga0105241_10028708 Ga0105241_100287085 174
113 3300009174 Ga0105241_10065769 Ga0105241_100657692 174
114 3300009176 Ga0105242_10075872 Ga0105242_100758722 174
115 3300009545 Ga0105237_10021003 Ga0105237_100210032 174
116 3300009553 Ga0105249_10261437 Ga0105249_102614371 174
117 3300010375 Ga0105239_10005033 Ga0105239_100050336 174
118 3300010375 Ga0105239_10479181 Ga0105239_104791812 174
119 3300010375 Ga0105239_10560448 Ga0105239_105604483 174
120 3300010375 Ga0105239_10562102 Ga0105239_105621021 174
121 3300013100 Ga0157373_10348979 Ga0157373_103489791 174
122 3300013102 Ga0157371_10004208 Ga0157371_1000420813 174
123 3300013102 Ga0157371_10033076 Ga0157371_100330762 174
124 3300013102 Ga0157371_10301283 Ga0157371_103012832 174
125 3300013102 Ga0157371_10321055 Ga0157371_103210551 174
126 3300013104 Ga0157370_10000526 Ga0157370_1000052613 174
127 3300013104 Ga0157370_10098956 Ga0157370_100989563 174
128 3300013104 Ga0157370_10278657 Ga0157370_102786572 174
129 3300013104 Ga0157370_10834577 Ga0157370_108345771 174
130 3300013105 Ga0157369_10015290 Ga0157369_100152902 174
131 3300013296 Ga0157374_10040230 Ga0157374_100402302 174
132 3300013296 Ga0157374_10150263 Ga0157374_101502632 174
133 3300013296 Ga0157374_10354881 Ga0157374_103548812 174
134 3300013296 Ga0157374_11092791 Ga0157374_110927912 174
135 3300013297 Ga0157378_11647502 Ga0157378_116475021 174
136 3300013306 Ga0163162_10001770 Ga0163162_100017702 174
137 3300013306 Ga0163162_10294261 Ga0163162_102942611 174
138 3300013306 Ga0163162_10660586 Ga0163162_106605862 174
139 3300013307 Ga0157372_10067425 Ga0157372_100674252 174
140 3300013307 Ga0157372_10116837 Ga0157372_101168373 174
141 3300013307 Ga0157372_10158595 Ga0157372_101585953 174
142 3300013307 Ga0157372_10338705 Ga0157372_103387052 174
143 3300013307 Ga0157372_11310325 Ga0157372_113103251 174
144 3300013308 Ga0157375_10038531 Ga0157375_100385315 174
145 3300013308 Ga0157375_10065145 Ga0157375_100651453 174
146 3300013308 Ga0157375_10179529 Ga0157375_101795291 174
147 3300014325 Ga0163163_10007094 Ga0163163_100070944 174
148 3300014325 Ga0163163_10045086 Ga0163163_100450862 174
149 3300014325 Ga0163163_10758555 Ga0163163_107585551 174
150 3300014326 Ga0157380_10641542 Ga0157380_106415421 174
151 3300014745 Ga0157377_10002499 Ga0157377_100024997 174
152 3300014968 Ga0157379_10009802 Ga0157379_100098022 174
153 3300014968 Ga0157379_10176400 Ga0157379_101764002 174
154 3300014969 Ga0157376_10055088 Ga0157376_100550883 174
155 3300014969 Ga0157376_10227705 Ga0157376_102277052 174
156 3300014969 Ga0157376_10650684 Ga0157376_106506841 174
157 3300017792 Ga0163161_10014989 Ga0163161_100149892 174
158 3300017792 Ga0163161_10054658 Ga0163161_100546583 174
159 3300025321 Ga0207656_10040022 Ga0207656_100400222 174
160 3300025903 Ga0207680_10247035 Ga0207680_102470352 174
161 3300025905 Ga0207685_10204161 Ga0207685_102041612 174
162 3300025907 Ga0207645_10010821 Ga0207645_100108212 174
163 3300025907 Ga0207645_10068295 Ga0207645_100682952 174
164 3300025909 Ga0207705_10047558 Ga0207705_100475584 174
165 3300025909 Ga0207705_10330929 Ga0207705_103309292 174
166 3300025909 Ga0207705_10629668 Ga0207705_106296681 174
167 3300025913 Ga0207695_10006273 Ga0207695_1000627312 174
168 3300025913 Ga0207695_10217270 Ga0207695_102172702 174
169 3300025913 Ga0207695_10338890 Ga0207695_103388902 174
170 3300025914 Ga0207671_10015537 Ga0207671_100155376 174
171 3300025917 Ga0207660_10129544 Ga0207660_101295442 174
172 3300025918 Ga0207662_10343136 Ga0207662_103431361 174
173 3300025919 Ga0207657_10129481 Ga0207657_101294812 174
174 3300025919 Ga0207657_10257925 Ga0207657_102579251 174
175 3300025920 Ga0207649_10253094 Ga0207649_102530942 174
176 3300025921 Ga0207652_10000108 Ga0207652_1000010815 174
177 3300025921 Ga0207652_10000346 Ga0207652_100003462 174
178 3300025921 Ga0207652_10052631 Ga0207652_100526312 174
179 3300025921 Ga0207652_10214910 Ga0207652_102149102 174
180 3300025923 Ga0207681_10202264 Ga0207681_102022642 174
181 3300025923 Ga0207681_10895064 Ga0207681_108950641 174
182 3300025926 Ga0207659_10183491 Ga0207659_101834912 174
183 3300025931 Ga0207644_10117256 Ga0207644_101172562 174
184 3300025931 Ga0207644_11155539 Ga0207644_111555391 174
185 3300025932 Ga0207690_10024864 Ga0207690_100248642 174
186 3300025932 Ga0207690_10157582 Ga0207690_101575821 174
187 3300025932 Ga0207690_10231282 Ga0207690_102312822 174
188 3300025933 Ga0207706_10014866 Ga0207706_100148662 174
189 3300025936 Ga0207670_10244675 Ga0207670_102446752 174
190 3300025936 Ga0207670_10805275 Ga0207670_108052751 174
191 3300025941 Ga0207711_11201057 Ga0207711_112010571 174
192 3300025942 Ga0207689_10033435 Ga0207689_100334351 174
193 3300025944 Ga0207661_10001233 Ga0207661_1000123312 174
194 3300025944 Ga0207661_10129095 Ga0207661_101290952 174
195 3300025944 Ga0207661_10137080 Ga0207661_101370802 174
196 3300025944 Ga0207661_10197835 Ga0207661_101978352 174
197 3300025944 Ga0207661_11407214 Ga0207661_114072141 174
198 3300025945 Ga0207679_10000927 Ga0207679_100009279 174
199 3300025945 Ga0207679_10049087 Ga0207679_100490872 174
200 3300025945 Ga0207679_10086199 Ga0207679_100861992 174
201 3300025945 Ga0207679_10180904 Ga0207679_101809042 174
202 3300025945 Ga0207679_10427396 Ga0207679_104273962 174
203 3300025945 Ga0207679_10433834 Ga0207679_104338342 174
204 3300025949 Ga0207667_10005756 Ga0207667_100057561 174
205 3300025949 Ga0207667_10297170 Ga0207667_102971701 174
206 3300025960 Ga0207651_10343950 Ga0207651_103439501 174
207 3300025961 Ga0207712_10287939 Ga0207712_102879392 174
208 3300025972 Ga0207668_10381315 Ga0207668_103813151 174
209 3300025981 Ga0207640_10577038 Ga0207640_105770381 174
210 3300025986 Ga0207658_10022942 Ga0207658_100229422 174
211 3300025986 Ga0207658_10204637 Ga0207658_102046372 174
212 3300025986 Ga0207658_10234132 Ga0207658_102341322 174
213 3300026023 Ga0207677_10015213 Ga0207677_100152133 174
214 3300026023 Ga0207677_10139529 Ga0207677_101395293 174
215 3300026023 Ga0207677_10202127 Ga0207677_102021272 174
216 3300026035 Ga0207703_10032255 Ga0207703_100322553 174
217 3300026041 Ga0207639_10000837 Ga0207639_1000083712 174
218 3300026041 Ga0207639_10057721 Ga0207639_100577214 174
219 3300026067 Ga0207678_10180210 Ga0207678_101802102 174
220 3300026067 Ga0207678_10901456 Ga0207678_109014561 174
221 3300026078 Ga0207702_10513438 Ga0207702_105134382 174
222 3300026089 Ga0207648_10056597 Ga0207648_100565971 174
223 3300026089 Ga0207648_10263192 Ga0207648_102631922 174
224 3300026089 Ga0207648_10556297 Ga0207648_105562972 174
225 3300026089 Ga0207648_10753525 Ga0207648_107535252 174
226 3300026095 Ga0207676_10136719 Ga0207676_101367192 174
227 3300026116 Ga0207674_10009039 Ga0207674_100090397 174
228 3300026116 Ga0207674_10034432 Ga0207674_100344325 174
229 3300026116 Ga0207674_10369895 Ga0207674_103698953 174
230 3300026118 Ga0207675_100378090 Ga0207675_1003780902 174
231 3300026121 Ga0207683_10097030 Ga0207683_100970302 174
232 3300026142 Ga0207698_10024765 Ga0207698_100247652 174
233 3300026142 Ga0207698_10221436 Ga0207698_102214362 174
234 3300026142 Ga0207698_10400217 Ga0207698_104002172 174
235 3300026142 Ga0207698_11465172 Ga0207698_114651721 174
236 3300028380 Ga0268265_10065613 Ga0268265_100656132 174
237 3300028380 Ga0268265_11264255 Ga0268265_112642551 174
238 3300028381 Ga0268264_10014848 Ga0268264_100148485 174
239 3300035410 Ga0373924_0045673 Ga0373924_0045673_266_811 174
240 3300035692 Ga0373935_0332142 Ga0373935_0332142_451_975 174
241 3300035692 Ga0373935_0740890 Ga0373935_0740890_80_607 174
242 3300036401 Ga0373937_0110017 Ga0373937_0110017_703_1230 174
243 3300037312 Ga0395899_0018080 Ga0395899_0018080_1614_2138 174
244 3300037312 Ga0395899_0018960 Ga0395899_0018960_757_1281 174
245 3300037418 Ga0395900_0000573 Ga0395900_0000573_15751_16275 174
246 3300037418 Ga0395900_0006676 Ga0395900_0006676_5066_5590 174
247 3300037418 Ga0395900_0787397 Ga0395900_0787397_342_866 174
248 3300037466 Ga0395898_0033959 Ga0395898_0033959_905_1429 174
249 3300038443 Ga0395901_0001343 Ga0395901_0001343_4024_4548 174
250 3300038443 Ga0395901_0407643 Ga0395901_0407643_794_1318 174
251 3300041404 Ga0439436_0072307 Ga0439436_0072307_275_799 174
252 3300042007 Ga0439449_0008171 Ga0439449_0008171_1054_1578 174
253 3300042014 Ga0439457_006130 Ga0439457_006130_1303_1827 174
254 3300044712 Ga0453684_0001960 Ga0453684_0001960_45798_46325 174
255 3300045051 Ga0451576_0004672 Ga0451576_0004672_11668_12195 174
256 3300046459 Ga0495629_0066297 Ga0495629_0066297_1185_1709 174
257 3300046463 Ga0495653_0104419 Ga0495653_0104419_927_1454 174
258 3300046463 Ga0495653_0280283 Ga0495653_0280283_534_1058 174
259 3300046472 Ga0495580_0195549 Ga0495580_0195549_172_696 174
260 3300046472 Ga0495580_0291319 Ga0495580_0291319_507_1037 174
261 3300046511 Ga0495608_0078140 Ga0495608_0078140_552_1079 174
262 3300046516 Ga0495628_0850492 Ga0495628_0850492_63_590 174
263 3300046517 Ga0495630_0093040 Ga0495630_0093040_746_1270 174
264 3300046529 Ga0495652_0203485 Ga0495652_0203485_372_896 174
265 3300046531 Ga0495665_0420781 Ga0495665_0420781_46_570 174
266 3300046536 Ga0495587_0067386 Ga0495587_0067386_271_798 174
267 3300046559 Ga0495667_0090797 Ga0495667_0090797_70_597 174
268 3300046642 Ga0495634_0459554 Ga0495634_0459554_13_558 174
269 3300046680 Ga0495646_0276153 Ga0495646_0276153_199_744 174
270 3300046681 Ga0495647_0306968 Ga0495647_0306968_90_614 174
271 3300046683 Ga0495658_0007718 Ga0495658_0007718_3916_4440 174
272 3300046809 Ga0495600_0074639 Ga0495600_0074639_464_988 174
273 3300047319 Ga0495674_0242412 Ga0495674_0242412_337_861 174
274 3300047471 Ga0495684_0801035 Ga0495684_0801035_72_596 174
275 3300048088 Ga0495602_0354147 Ga0495602_0354147_376_900 174
276 3300048908 Ga0496105_0091693 Ga0496105_0091693_949_1473 174
277 3300049569 Ga0501032_0030108 Ga0501032_0030108_1994_2518 174
278 3300049570 Ga0501033_0008685 Ga0501033_0008685_3504_4028 174
279 3300049570 Ga0501033_0461063 Ga0501033_0461063_95_619 174
280 3300049571 Ga0501034_0001589 Ga0501034_0001589_25160_25684 174
281 3300049571 Ga0501034_0274010 Ga0501034_0274010_217_741 174
282 3300049573 Ga0501037_0049897 Ga0501037_0049897_2047_2571 174
283 3300049581 Ga0501047_0002822 Ga0501047_0002822_3158_3724 174
284 3300049586 Ga0501070_0153719 Ga0501070_0153719_509_1033 174
285 3300049822 Ga0501035_0017448 Ga0501035_0017448_5465_5989 174
286 3300049822 Ga0501035_0445353 Ga0501035_0445353_40_564 174
287 3300049823 Ga0501044_0017697 Ga0501044_0017697_5100_5666 174
288 3300053085 Ga0495619_0029100 Ga0495619_0029100_1833_2357 174
289 3300002077 JGI24744J21845_10011915 JGI24744J21845_100119151 175
290 3300003320 rootH2_10008684 rootH2_100086842 175
291 3300003322 rootL2_10278346 rootL2_102783461 175
292 3300003323 rootH1_10249806 rootH1_102498062 175
293 3300005290 Ga0065712_10109465 Ga0065712_101094652 175
294 3300005293 Ga0065715_10159058 Ga0065715_101590582 175
295 3300005327 Ga0070658_10614478 Ga0070658_106144781 175
296 3300005328 Ga0070676_10000659 Ga0070676_100006592 175
297 3300005328 Ga0070676_10051597 Ga0070676_100515973 175
298 3300005330 Ga0070690_100011501 Ga0070690_1000115015 175
299 3300005331 Ga0070670_100006829 Ga0070670_1000068294 175
300 3300005331 Ga0070670_100294730 Ga0070670_1002947302 175
301 3300005334 Ga0068869_100180306 Ga0068869_1001803062 175
302 3300005335 Ga0070666_10000172 Ga0070666_1000017216 175
303 3300005335 Ga0070666_10031744 Ga0070666_100317442 175
304 3300005335 Ga0070666_10659269 Ga0070666_106592691 175
305 3300005336 Ga0070680_100001877 Ga0070680_1000018771 175
306 3300005337 Ga0070682_100003083 Ga0070682_1000030833 175
307 3300005338 Ga0068868_100000356 Ga0068868_1000003563 175
308 3300005338 Ga0068868_100188326 Ga0068868_1001883263 175
309 3300005339 Ga0070660_101043146 Ga0070660_1010431461 175
310 3300005340 Ga0070689_100042918 Ga0070689_1000429183 175
311 3300005340 Ga0070689_100183206 Ga0070689_1001832061 175
312 3300005341 Ga0070691_10007560 Ga0070691_100075602 175
313 3300005343 Ga0070687_100008497 Ga0070687_1000084973 175
314 3300005344 Ga0070661_100037243 Ga0070661_1000372431 175
315 3300005344 Ga0070661_100277099 Ga0070661_1002770991 175
316 3300005347 Ga0070668_100000169 Ga0070668_10000016914 175
317 3300005347 Ga0070668_100627894 Ga0070668_1006278941 175
318 3300005347 Ga0070668_100736509 Ga0070668_1007365091 175
319 3300005353 Ga0070669_100001327 Ga0070669_1000013279 175
320 3300005353 Ga0070669_100090722 Ga0070669_1000907223 175
321 3300005353 Ga0070669_100474374 Ga0070669_1004743741 175
322 3300005354 Ga0070675_100128445 Ga0070675_1001284453 175
323 3300005354 Ga0070675_100187688 Ga0070675_1001876882 175
324 3300005354 Ga0070675_100431633 Ga0070675_1004316331 175
325 3300005355 Ga0070671_100042930 Ga0070671_1000429302 175
326 3300005355 Ga0070671_100327674 Ga0070671_1003276742 175
327 3300005356 Ga0070674_100006130 Ga0070674_1000061306 175
328 3300005356 Ga0070674_100010282 Ga0070674_1000102823 175
329 3300005356 Ga0070674_100993312 Ga0070674_1009933121 175
330 3300005364 Ga0070673_100001347 Ga0070673_1000013473 175
331 3300005364 Ga0070673_100030855 Ga0070673_1000308552 175
332 3300005365 Ga0070688_100001808 Ga0070688_1000018089 175
333 3300005365 Ga0070688_100670563 Ga0070688_1006705631 175
334 3300005367 Ga0070667_100000553 Ga0070667_10000055320 175
335 3300005367 Ga0070667_100251887 Ga0070667_1002518873 175
336 3300005438 Ga0070701_10026912 Ga0070701_100269122 175
337 3300005438 Ga0070701_10032532 Ga0070701_100325323 175
338 3300005441 Ga0070700_100043718 Ga0070700_1000437183 175
339 3300005456 Ga0070678_100059276 Ga0070678_1000592762 175
340 3300005456 Ga0070678_100079700 Ga0070678_1000797003 175
341 3300005456 Ga0070678_100609324 Ga0070678_1006093242 175
342 3300005457 Ga0070662_100003420 Ga0070662_1000034204 175
343 3300005459 Ga0068867_100001171 Ga0068867_10000117116 175
344 3300005459 Ga0068867_100147246 Ga0068867_1001472462 175
345 3300005459 Ga0068867_100892596 Ga0068867_1008925961 175
346 3300005539 Ga0068853_100000272 Ga0068853_10000027224 175
347 3300005539 Ga0068853_100003946 Ga0068853_1000039464 175
348 3300005539 Ga0068853_100033225 Ga0068853_1000332254 175
349 3300005539 Ga0068853_100353312 Ga0068853_1003533121 175
350 3300005543 Ga0070672_100000061 Ga0070672_10000006131 175
351 3300005543 Ga0070672_100059193 Ga0070672_1000591934 175
352 3300005543 Ga0070672_100144375 Ga0070672_1001443752 175
353 3300005543 Ga0070672_101171752 Ga0070672_1011717521 175
354 3300005544 Ga0070686_100004012 Ga0070686_1000040123 175
355 3300005547 Ga0070693_100073096 Ga0070693_1000730962 175
356 3300005548 Ga0070665_100000612 Ga0070665_10000061221 175
357 3300005548 Ga0070665_100629066 Ga0070665_1006290662 175
358 3300005563 Ga0068855_100028833 Ga0068855_1000288334 175
359 3300005563 Ga0068855_100051852 Ga0068855_1000518522 175
360 3300005563 Ga0068855_100228984 Ga0068855_1002289841 175
361 3300005564 Ga0070664_100452665 Ga0070664_1004526652 175
362 3300005577 Ga0068857_100002332 Ga0068857_10000233216 175
363 3300005577 Ga0068857_100201802 Ga0068857_1002018021 175
364 3300005578 Ga0068854_100349244 Ga0068854_1003492442 175
365 3300005578 Ga0068854_100600137 Ga0068854_1006001372 175
366 3300005614 Ga0068856_100122613 Ga0068856_1001226132 175
367 3300005616 Ga0068852_101486642 Ga0068852_1014866421 175
368 3300005617 Ga0068859_100000859 Ga0068859_10000085918 175
369 3300005617 Ga0068859_101206227 Ga0068859_1012062272 175
370 3300005618 Ga0068864_100001631 Ga0068864_1000016318 175
371 3300005719 Ga0068861_100018572 Ga0068861_1000185722 175
372 3300005840 Ga0068870_10009345 Ga0068870_100093456 175
373 3300005841 Ga0068863_100004540 Ga0068863_1000045406 175
374 3300005841 Ga0068863_100070683 Ga0068863_1000706833 175
375 3300005842 Ga0068858_100004312 Ga0068858_10000431210 175
376 3300005842 Ga0068858_100051614 Ga0068858_1000516142 175
377 3300005843 Ga0068860_100000591 Ga0068860_10000059127 175
378 3300005843 Ga0068860_100004454 Ga0068860_1000044544 175
379 3300005843 Ga0068860_100760529 Ga0068860_1007605291 175
380 3300005843 Ga0068860_101559185 Ga0068860_1015591851 175
381 3300005844 Ga0068862_100420176 Ga0068862_1004201761 175
382 3300005985 Ga0081539_10011193 Ga0081539_100111932 175
383 3300006195 Ga0075366_10030210 Ga0075366_100302101 175
384 3300006195 Ga0075366_10756499 Ga0075366_107564991 175
385 3300006237 Ga0097621_100000821 Ga0097621_10000082121 175
386 3300006237 Ga0097621_100001193 Ga0097621_1000011932 175
387 3300006358 Ga0068871_100002803 Ga0068871_1000028032 175
388 3300006358 Ga0068871_100004016 Ga0068871_1000040166 175
389 3300006358 Ga0068871_100116767 Ga0068871_1001167671 175
390 3300006358 Ga0068871_100159409 Ga0068871_1001594093 175
391 3300006881 Ga0068865_100014490 Ga0068865_1000144903 175
392 3300006881 Ga0068865_100135868 Ga0068865_1001358682 175
393 3300006931 Ga0097620_100000859 Ga0097620_10000085918 175
394 3300006931 Ga0097620_101206365 Ga0097620_1012063651 175
395 3300009093 Ga0105240_10043919 Ga0105240_100439192 175
396 3300009093 Ga0105240_10060041 Ga0105240_100600415 175
397 3300009093 Ga0105240_10096978 Ga0105240_100969782 175
398 3300009093 Ga0105240_10657065 Ga0105240_106570651 175
399 3300009094 Ga0111539_10002870 Ga0111539_1000287010 175
400 3300009094 Ga0111539_10126701 Ga0111539_101267011 175
401 3300009094 Ga0111539_10474867 Ga0111539_104748672 175
402 3300009101 Ga0105247_10088673 Ga0105247_100886732 175
403 3300009174 Ga0105241_10007669 Ga0105241_100076698 175
404 3300009174 Ga0105241_10078841 Ga0105241_100788411 175
405 3300009174 Ga0105241_10409374 Ga0105241_104093742 175
406 3300009174 Ga0105241_10552600 Ga0105241_105526001 175
407 3300009176 Ga0105242_10046854 Ga0105242_100468543 175
408 3300009177 Ga0105248_11049674 Ga0105248_110496741 175
409 3300009177 Ga0105248_11200624 Ga0105248_112006241 175
410 3300009545 Ga0105237_10080474 Ga0105237_100804742 175
411 3300009545 Ga0105237_10130840 Ga0105237_101308402 175
412 3300009551 Ga0105238_10113628 Ga0105238_101136283 175
413 3300009553 Ga0105249_10012057 Ga0105249_100120575 175
414 3300009553 Ga0105249_10031497 Ga0105249_100314974 175
415 3300010375 Ga0105239_10022820 Ga0105239_100228204 175
416 3300010375 Ga0105239_10274624 Ga0105239_102746242 175
417 3300013104 Ga0157370_10003149 Ga0157370_1000314913 175
418 3300013105 Ga0157369_10479006 Ga0157369_104790062 175
419 3300013296 Ga0157374_10000627 Ga0157374_1000062726 175
420 3300013296 Ga0157374_10059540 Ga0157374_100595403 175
421 3300013296 Ga0157374_10675667 Ga0157374_106756672 175
422 3300013297 Ga0157378_10005519 Ga0157378_100055196 175
423 3300013297 Ga0157378_10060645 Ga0157378_100606452 175
424 3300013297 Ga0157378_10374710 Ga0157378_103747102 175
425 3300013297 Ga0157378_10536178 Ga0157378_105361782 175
426 3300013297 Ga0157378_10693772 Ga0157378_106937722 175
427 3300013306 Ga0163162_10000752 Ga0163162_1000075226 175
428 3300013306 Ga0163162_10002582 Ga0163162_100025822 175
429 3300013306 Ga0163162_10014638 Ga0163162_100146382 175
430 3300013307 Ga0157372_10025872 Ga0157372_100258726 175
431 3300013307 Ga0157372_10050274 Ga0157372_100502742 175
432 3300013307 Ga0157372_10484414 Ga0157372_104844142 175
433 3300013307 Ga0157372_10678028 Ga0157372_106780282 175
434 3300013307 Ga0157372_10811678 Ga0157372_108116782 175
435 3300013307 Ga0157372_11853703 Ga0157372_118537032 175
436 3300013308 Ga0157375_10000098 Ga0157375_1000009861 175
437 3300013308 Ga0157375_10025649 Ga0157375_100256494 175
438 3300013308 Ga0157375_10319680 Ga0157375_103196803 175
439 3300014325 Ga0163163_10000272 Ga0163163_1000027230 175
440 3300014326 Ga0157380_10001666 Ga0157380_1000166611 175
441 3300014326 Ga0157380_10005979 Ga0157380_100059792 175
442 3300014745 Ga0157377_10000309 Ga0157377_1000030914 175
443 3300014745 Ga0157377_10011657 Ga0157377_100116577 175
444 3300014968 Ga0157379_10000103 Ga0157379_1000010331 175
445 3300014969 Ga0157376_10000286 Ga0157376_1000028626 175
446 3300014969 Ga0157376_10226300 Ga0157376_102263001 175
447 3300014969 Ga0157376_10226557 Ga0157376_102265571 175
448 3300017792 Ga0163161_10074880 Ga0163161_100748801 175
449 3300025246 Ga0209646_1002334 Ga0209646_10023342 175
450 3300025321 Ga0207656_10000540 Ga0207656_1000054010 175
451 3300025893 Ga0207682_10092091 Ga0207682_100920912 175
452 3300025900 Ga0207710_10252505 Ga0207710_102525051 175
453 3300025901 Ga0207688_10110052 Ga0207688_101100523 175
454 3300025903 Ga0207680_10167578 Ga0207680_101675782 175
455 3300025903 Ga0207680_10252699 Ga0207680_102526992 175
456 3300025907 Ga0207645_10001904 Ga0207645_100019042 175
457 3300025907 Ga0207645_10065794 Ga0207645_100657943 175
458 3300025908 Ga0207643_10034493 Ga0207643_100344932 175
459 3300025909 Ga0207705_10141763 Ga0207705_101417632 175
460 3300025911 Ga0207654_10032859 Ga0207654_100328591 175
461 3300025911 Ga0207654_10241864 Ga0207654_102418641 175
462 3300025911 Ga0207654_10347736 Ga0207654_103477362 175
463 3300025911 Ga0207654_10906008 Ga0207654_109060082 175
464 3300025912 Ga0207707_10000160 Ga0207707_1000016042 175
465 3300025913 Ga0207695_10042989 Ga0207695_100429894 175
466 3300025913 Ga0207695_10077416 Ga0207695_100774161 175
467 3300025914 Ga0207671_10154433 Ga0207671_101544332 175
468 3300025917 Ga0207660_10004570 Ga0207660_100045705 175
469 3300025918 Ga0207662_10014592 Ga0207662_100145922 175
470 3300025919 Ga0207657_10320349 Ga0207657_103203491 175
471 3300025921 Ga0207652_10020113 Ga0207652_100201132 175
472 3300025923 Ga0207681_10574780 Ga0207681_105747802 175
473 3300025924 Ga0207694_11301844 Ga0207694_113018441 175
474 3300025925 Ga0207650_10375590 Ga0207650_103755901 175
475 3300025926 Ga0207659_10331637 Ga0207659_103316372 175
476 3300025931 Ga0207644_10937546 Ga0207644_109375461 175
477 3300025931 Ga0207644_11347911 Ga0207644_113479111 175
478 3300025933 Ga0207706_10031145 Ga0207706_100311455 175
479 3300025933 Ga0207706_10298912 Ga0207706_102989121 175
480 3300025934 Ga0207686_10180685 Ga0207686_101806852 175
481 3300025936 Ga0207670_10115994 Ga0207670_101159942 175
482 3300025936 Ga0207670_10364625 Ga0207670_103646252 175
483 3300025937 Ga0207669_10020099 Ga0207669_100200992 175
484 3300025937 Ga0207669_11073116 Ga0207669_110731161 175
485 3300025938 Ga0207704_10031376 Ga0207704_100313762 175
486 3300025938 Ga0207704_10134838 Ga0207704_101348381 175
487 3300025940 Ga0207691_10000154 Ga0207691_1000015427 175
488 3300025940 Ga0207691_10049077 Ga0207691_100490772 175
489 3300025940 Ga0207691_10055181 Ga0207691_100551813 175
490 3300025942 Ga0207689_10093738 Ga0207689_100937383 175
491 3300025942 Ga0207689_10144577 Ga0207689_101445771 175
492 3300025942 Ga0207689_10580097 Ga0207689_105800971 175
493 3300025949 Ga0207667_10029528 Ga0207667_100295282 175
494 3300025949 Ga0207667_10188463 Ga0207667_101884632 175
495 3300025960 Ga0207651_10002052 Ga0207651_100020526 175
496 3300025960 Ga0207651_10140706 Ga0207651_101407063 175
497 3300025961 Ga0207712_10025595 Ga0207712_100255953 175
498 3300025961 Ga0207712_10124481 Ga0207712_101244812 175
499 3300025972 Ga0207668_10001109 Ga0207668_1000110913 175
500 3300025972 Ga0207668_10088965 Ga0207668_100889653 175
501 3300025972 Ga0207668_10102660 Ga0207668_101026603 175
502 3300025972 Ga0207668_10120358 Ga0207668_101203582 175
503 3300025981 Ga0207640_10643628 Ga0207640_106436281 175
504 3300025981 Ga0207640_10830241 Ga0207640_108302412 175
505 3300025986 Ga0207658_10000570 Ga0207658_1000057027 175
506 3300025986 Ga0207658_10223522 Ga0207658_102235223 175
507 3300026023 Ga0207677_10073265 Ga0207677_100732652 175
508 3300026023 Ga0207677_10163276 Ga0207677_101632761 175
509 3300026035 Ga0207703_10000883 Ga0207703_100008836 175
510 3300026041 Ga0207639_10003361 Ga0207639_100033614 175
511 3300026041 Ga0207639_10004478 Ga0207639_100044789 175
512 3300026041 Ga0207639_10046112 Ga0207639_100461122 175
513 3300026041 Ga0207639_10215096 Ga0207639_102150962 175
514 3300026041 Ga0207639_10490562 Ga0207639_104905622 175
515 3300026075 Ga0207708_10144907 Ga0207708_101449071 175
516 3300026078 Ga0207702_10244763 Ga0207702_102447632 175
517 3300026088 Ga0207641_10009123 Ga0207641_100091237 175
518 3300026088 Ga0207641_10235769 Ga0207641_102357692 175
519 3300026089 Ga0207648_10004750 Ga0207648_100047509 175
520 3300026089 Ga0207648_10013015 Ga0207648_100130152 175
521 3300026089 Ga0207648_10047452 Ga0207648_100474522 175
522 3300026089 Ga0207648_10657785 Ga0207648_106577851 175
523 3300026095 Ga0207676_10000948 Ga0207676_1000094823 175
524 3300026116 Ga0207674_10004662 Ga0207674_100046623 175
525 3300026116 Ga0207674_10398930 Ga0207674_103989302 175
526 3300026118 Ga0207675_100000655 Ga0207675_10000065523 175
527 3300026118 Ga0207675_100228161 Ga0207675_1002281611 175
528 3300026118 Ga0207675_100816659 Ga0207675_1008166591 175
529 3300026121 Ga0207683_10102963 Ga0207683_101029632 175
530 3300026121 Ga0207683_10179196 Ga0207683_101791962 175
531 3300026121 Ga0207683_10469333 Ga0207683_104693331 175
532 3300026142 Ga0207698_10133092 Ga0207698_101330921 175
533 3300026142 Ga0207698_11481689 Ga0207698_114816891 175
534 3300027907 Ga0207428_10314989 Ga0207428_103149892 175
535 3300028379 Ga0268266_10000986 Ga0268266_1000098628 175
536 3300028379 Ga0268266_10475280 Ga0268266_104752801 175
537 3300028381 Ga0268264_10001126 Ga0268264_1000112610 175
538 3300028381 Ga0268264_10008368 Ga0268264_100083682 175
539 3300028381 Ga0268264_10397215 Ga0268264_103972152 175
540 3300031251 Ga0265327_10000022 Ga0265327_10000022139 175
541 3300031456 Ga0307513_10139436 Ga0307513_101394362 175
542 3300031456 Ga0307513_10143280 Ga0307513_101432802 175
543 3300031456 Ga0307513_10192880 Ga0307513_101928801 175
544 3300031507 Ga0307509_10009531 Ga0307509_1000953111 175
545 3300031507 Ga0307509_10011098 Ga0307509_100110985 175
546 3300031548 Ga0307408_100140067 Ga0307408_1001400671 175
547 3300031616 Ga0307508_10000181 Ga0307508_1000018162 175
548 3300031731 Ga0307405_10456026 Ga0307405_104560262 175
549 3300031824 Ga0307413_10037934 Ga0307413_100379343 175
550 3300031901 Ga0307406_10420835 Ga0307406_104208352 175
551 3300031901 Ga0307406_10832403 Ga0307406_108324031 175
552 3300031911 Ga0307412_10486972 Ga0307412_104869722 175
553 3300032002 Ga0307416_100047859 Ga0307416_1000478593 175
554 3300032004 Ga0307414_10084974 Ga0307414_100849744 175
555 3300032005 Ga0307411_10299046 Ga0307411_102990462 175
556 3300041404 Ga0439436_0014062 Ga0439436_0014062_1669_2196 175
557 3300041452 Ga0451793_1150992 Ga0451793_1150992_173_700 175
558 3300041503 Ga0451847_0935001 Ga0451847_0935001_149_676 175
559 3300041509 Ga0451843_0975489 Ga0451843_0975489_96_656 175
560 3300041997 Ga0439431_0000688 Ga0439431_0000688_2281_2814 175
561 3300042004 Ga0439445_0009926 Ga0439445_0009926_668_1201 175
562 3300042014 Ga0439457_000159 Ga0439457_000159_49_576 175
563 3300042014 Ga0439457_067419 Ga0439457_067419_63_590 175
564 3300042876 Ga0451577_0077388 Ga0451577_0077388_945_1472 175
565 3300044656 Ga0466969_0002159 Ga0466969_0002159_3794_4330 175
566 3300044658 Ga0466972_0004850 Ga0466972_0004850_2152_2685 175
567 3300044673 Ga0453683_0024956 Ga0453683_0024956_1740_2267 175
568 3300044684 Ga0466966_0000476 Ga0466966_0000476_22861_23397 175
569 3300044712 Ga0453684_0020539 Ga0453684_0020539_2452_2979 175
570 3300044712 Ga0453684_0036627 Ga0453684_0036627_440_970 175
571 3300044719 Ga0466971_0284766 Ga0466971_0284766_192_722 175
572 3300044901 Ga0466960_0093685 Ga0466960_0093685_989_1516 175
573 3300045049 Ga0466959_0000196 Ga0466959_0000196_18573_19109 175
574 3300045051 Ga0451576_0017853 Ga0451576_0017853_3867_4394 175
575 3300046460 Ga0495638_0206055 Ga0495638_0206055_368_895 175
576 3300046616 Ga0495668_0004021 Ga0495668_0004021_3925_4458 175
577 3300046660 Ga0495625_0280655 Ga0495625_0280655_198_725 175
578 3300047318 Ga0495636_0000121 Ga0495636_0000121_21187_21720 175
579 3300047319 Ga0495674_0475288 Ga0495674_0475288_228_776 175
580 3300047320 Ga0495672_0030355 Ga0495672_0030355_2055_2585 175
581 3300049571 Ga0501034_0067436 Ga0501034_0067436_366_899 175
582 3300049651 Ga0501201_009319 Ga0501201_009319_145_675 175
583 3300049652 Ga0501202_003246 Ga0501202_003246_324_854 175
584 3300049654 Ga0501207_004750 Ga0501207_004750_1301_1831 175
585 3300049663 Ga0501223_042946 Ga0501223_042946_27_557 175
586 3300049664 Ga0501224_016900 Ga0501224_016900_120_650 175
587 3300049669 Ga0501235_008052 Ga0501235_008052_1488_2018 175
588 3300049675 Ga0501243_017692 Ga0501243_017692_73_603 175
589 3300049682 Ga0501252_021828 Ga0501252_021828_230_760 175
590 3300049684 Ga0501255_004998 Ga0501255_004998_325_855 175
591 3300049686 Ga0501257_116858 Ga0501257_116858_99_629 175
592 3300049703 Ga0501219_000226 Ga0501219_000226_5508_6035 175
593 3300049705 Ga0501225_0097778 Ga0501225_0097778_67_597 175
594 3300049707 Ga0501234_008456 Ga0501234_008456_15_545 175
595 3300049708 Ga0501245_031088 Ga0501245_031088_112_642 175
596 3300049744 Ga0501083_0057910 Ga0501083_0057910_202_732 175
597 3300049763 Ga0501266_003887 Ga0501266_003887_99_629 175
598 3300050005 Ga0501284_00046 Ga0501284_00046_24369_24896 175
599 3300050493 nmdc:mga0k408_39018_c1 nmdc:mga0k408_39018_c1_1290_1817 175
600 3300050507 nmdc:mga05p37_6703_c1 nmdc:mga05p37_6703_c1_3675_4202 175
601 3300050511 nmdc:mga08y16_301684_c1 nmdc:mga08y16_301684_c1_493_1026 175
602 3300050511 nmdc:mga08y16_498247_c1 nmdc:mga08y16_498247_c1_97_624 175
603 3300053086 Ga0500578_0000010 Ga0500578_0000010_111613_112266 175
604 3300053086 Ga0500578_0337596 Ga0500578_0337596_107_634 175
605 3300053088 Ga0500644_0051970 Ga0500644_0051970_642_1175 175
606 3300053089 Ga0500581_225637 Ga0500581_225637_165_698 175
607 3300053098 Ga0500650_0285711 Ga0500650_0285711_17_550 175
608 3300053104 Ga0500556_0191262 Ga0500556_0191262_55_582 175
609 3300053118 Ga0500594_0005606 Ga0500594_0005606_1297_1827 175
610 3300053131 Ga0500652_035295 Ga0500652_035295_827_1354 175
611 3300053147 Ga0500589_047206 Ga0500589_047206_1195_1722 175
612 3300053151 Ga0500604_0018715 Ga0500604_0018715_1237_1764 175
613 3300053156 Ga0500622_0129217 Ga0500622_0129217_448_975 175
614 3300053163 Ga0500639_292754 Ga0500639_292754_63_602 175
615 3300053178 Ga0500637_0005750 Ga0500637_0005750_4056_4583 175
616 3300053178 Ga0500637_0222598 Ga0500637_0222598_425_964 175
617 3300053730 Ga0500645_082639 Ga0500645_082639_287_814 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03653

UPF0093

Uncharacterised protein family (UPF0093)

1

151

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4czz-assembly1.cif.gz_A histone demethylase lsd1(kdm1a)-corest3 complex 0.8404 2 83
4tx5-assembly1.cif.gz_B crystal structure of smac-diablo (in space group p65) 0.5371 2 129
6bbi-assembly1.cif.gz_A the crac channel orai in an unlatched-closed conformation; k163w loss-of-function mutation; p42212 crystal form 0.5359 45 171
7xge-assembly3.cif.gz_E crystal structure of mcl-1 in complex with computationally designed inhibitor protein 0.5149 5 135
4akk-assembly1.cif.gz_B structure of the nasr transcription antiterminator 0.5071 15 138
ID Description Score Start End Superfamily
af_P31826_13_350_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.893 2 77 1.20.1560.10
af_B6TL61_1_296_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8565 2 71 1.25.10.10
2uxnA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.8506 2 83 1.10.287.80
2iw5A03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.8505 2 83 1.10.287.80
4uvbA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.8477 2 83 1.10.287.80
ID Description Score Start End GO Terms
AF-A0A355B7I5-F1-model_v4 Protoporphyrinogen IX oxidase 0.9869 2 111 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A832H0H3-F1-model_v4 Protoporphyrinogen IX oxidase 0.979 2 72 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A519V1Q3-F1-model_v4 Protoporphyrinogen IX oxidase 0.9784 2 133 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A2L2XJM0-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9671 2 174 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A3C0NHS3-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9632 2 174 GO:0005886
GO:0006782
GO:0046872
GO:0070818

Feature Viewer

pLDDT pTM Quality
84.58 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map