F469607

General Info

Members Datasets Scaffolds Average Seq Length
617 311 600 257

Family's Representative Sequence

Representative Sequence 3300003762|Ga0055542_1004132|Ga0055542_10041322
Length 302
Sequence MAERLFDKTGSSPLPRPTSRSRVILSGGWAGERAGTAPGKRSSVLSQTGSEAARKLDTIDVRPAFTQAEVDALNARFAGVETLPMLRALFADNILGETAVVSSFGTESAVLLDLISRVAPNTPVVFVDTLKMFPETLAYRDALLDRLGMHNRRTITPNSEVIAAKDATGLRWSYDPDGCCAIRKVEPIARAKQGLDSWFSGRKAFQSQTRANLPRFELEDGRLKVNPLGDWAKDDLDAYFAERDLPRHPLEAEGYLSIGCSPCTSKVMPGEDPRAGRWRGWDKVECGIHTPVDGPSEDDPIF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
6 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
7 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
8 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
9 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
10 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
11 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
12 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
13 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
14 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
15 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
16 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
17 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
206 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
220 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
268 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
269 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
270 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
271 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
272 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
273 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
276 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
277 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
278 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
279 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
280 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
281 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
282 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
283 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
284 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
285 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
286 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
292 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
293 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
294 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
295 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
298 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
299 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
304 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
309 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0.32
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.35
Nodule 0
Rhizoplane 1.78
Rhizosphere 77.31
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2794509 2162886007 Bacteria 1486
2 JGI24741J21665_1005221 3300001915 Bacteria 2753
3 JGI24752J21851_1001572 3300001976 Bacteria 3074
4 JGI24740J21852_10001016 3300001979 Bacteria 12545
5 JGI24740J21852_10012988 3300001979 Bacteria 3124
6 JGI24739J22299_10001067 3300001989 Bacteria 10203
7 JGI24739J22299_10003139 3300001989 Bacteria 6304
8 JGI24739J22299_10012763 3300001989 Bacteria 3080
9 JGI24739J22299_10038747 3300001989 Bacteria 1600
10 JGI24737J22298_10004452 3300001990 Bacteria 4883
11 JGI24737J22298_10005014 3300001990 Bacteria 4587
12 JGI24737J22298_10050336 3300001990 Bacteria 1266
13 JGI24735J21928_10004189 3300002067 Bacteria 4871
14 JGI24735J21928_10004916 3300002067 Bacteria 4455
15 JGI24735J21928_10007068 3300002067 Bacteria 3667
16 JGI24735J21928_10019301 3300002067 Bacteria 2096
17 JGI24750J21931_1010742 3300002070 Bacteria 1197
18 JGI24738J21930_10000464 3300002075 Bacteria 11506
19 JGI24738J21930_10002688 3300002075 Bacteria 4585
20 JGI24751J29686_10007032 3300002459 Bacteria 2299
21 JGI25150J39212_1000213 3300002774 Bacteria 31530
22 JGI25165J46597_1000112 3300003214 Bacteria 147097
23 JGI25153J46596_10000036 3300003215 Bacteria 182205
24 rootH1_10111877 3300003316 Bacteria 1296
25 rootL2_10227911 3300003322 Bacteria 1674
26 Ga0055542_1004132 3300003762 Bacteria 3650
27 Ga0055526_1000948 3300003771 Bacteria 21478
28 Ga0055526_1040803 3300003771 Bacteria 1165
29 Ga0055536_1013054 3300003781 Bacteria 3028
30 Ga0055540_1001281 3300003792 Bacteria 15301
31 JGI25405J52794_10003443 3300003911 Bacteria 2773
32 Ga0065165_1077603 3300005262 Bacteria 869
33 Ga0065704_10072077 3300005289 Bacteria 9198
34 Ga0070658_10000896 3300005327 Bacteria 25520
35 Ga0070658_10005034 3300005327 Bacteria 10754
36 Ga0070658_10006492 3300005327 Bacteria 9479
37 Ga0070658_10081915 3300005327 Bacteria 2651
38 Ga0070676_10000257 3300005328 Bacteria 23128
39 Ga0070670_100042123 3300005331 Bacteria 3924
40 Ga0068869_100004094 3300005334 Bacteria 9028
41 Ga0070666_10000063 3300005335 Bacteria 80378
42 Ga0068868_100000023 3300005338 Bacteria 85334
43 Ga0070660_100000395 3300005339 Bacteria 28996
44 Ga0070660_100049125 3300005339 Bacteria 3242
45 Ga0070660_100084076 3300005339 Bacteria 2501
46 Ga0070660_100217734 3300005339 Bacteria 1551
47 Ga0070661_100036450 3300005344 Bacteria 3575
48 Ga0070661_100042406 3300005344 Bacteria 3321
49 Ga0070661_100123609 3300005344 Bacteria 1940
50 Ga0070668_100000739 3300005347 Bacteria 22344
51 Ga0070668_100013413 3300005347 Bacteria 6116
52 Ga0070668_100088273 3300005347 Bacteria 2441
53 Ga0070669_100000042 3300005353 Bacteria 123396
54 Ga0070671_100000002 3300005355 Bacteria 292733
55 Ga0070671_100043899 3300005355 Bacteria 3715
56 Ga0070671_100162503 3300005355 Bacteria 1888
57 Ga0070671_100182742 3300005355 Bacteria 1776
58 Ga0070674_100068398 3300005356 Bacteria 2502
59 Ga0070673_100000001 3300005364 Bacteria 239842
60 Ga0070673_100335412 3300005364 Bacteria 1339
61 Ga0070659_100017522 3300005366 Bacteria 5394
62 Ga0070659_100021216 3300005366 Bacteria 4942
63 Ga0070659_100056093 3300005366 Bacteria 3106
64 Ga0070659_100137208 3300005366 Bacteria 1989
65 Ga0070667_100000016 3300005367 Bacteria 237028
66 Ga0070667_100000162 3300005367 Bacteria 83150
67 Ga0070667_100035266 3300005367 Bacteria 4190
68 Ga0070714_100262029 3300005435 Bacteria 1601
69 Ga0070663_100012272 3300005455 Bacteria 5413
70 Ga0070663_100013894 3300005455 Bacteria 5150
71 Ga0070662_100002436 3300005457 Bacteria 11448
72 Ga0070662_100009003 3300005457 Bacteria 6513
73 Ga0070662_100039173 3300005457 Bacteria 3371
74 Ga0070662_100067495 3300005457 Bacteria 2626
75 Ga0070662_100206618 3300005457 Bacteria 1561
76 Ga0068867_100000387 3300005459 Bacteria 29397
77 Ga0070679_100008282 3300005530 Bacteria 9782
78 Ga0070679_100274033 3300005530 Bacteria 1641
79 Ga0070684_100042855 3300005535 Bacteria 3908
80 Ga0068853_100013579 3300005539 Bacteria 6655
81 Ga0068853_100018932 3300005539 Bacteria 5702
82 Ga0068853_100209603 3300005539 Bacteria 1776
83 Ga0068853_100364157 3300005539 Bacteria 1347
84 Ga0070672_100093513 3300005543 Bacteria 2429
85 Ga0070686_100160416 3300005544 Bacteria 1583
86 Ga0070665_100000186 3300005548 Bacteria 110750
87 Ga0070665_100105320 3300005548 Bacteria 2822
88 Ga0068855_100000092 3300005563 Bacteria 107195
89 Ga0068855_100008444 3300005563 Bacteria 12453
90 Ga0068855_100014816 3300005563 Bacteria 9389
91 Ga0068855_100034440 3300005563 Bacteria 6040
92 Ga0068855_100144960 3300005563 Bacteria 2704
93 Ga0068855_100299424 3300005563 Bacteria 1781
94 Ga0070664_100011340 3300005564 Bacteria 7233
95 Ga0070664_100013946 3300005564 Bacteria 6552
96 Ga0070664_100025320 3300005564 Bacteria 4917
97 Ga0070664_100255870 3300005564 Bacteria 1575
98 Ga0068857_100051510 3300005577 Bacteria 3653
99 Ga0068857_100056170 3300005577 Bacteria 3494
100 Ga0068857_100283789 3300005577 Bacteria 1523
101 Ga0068857_100502939 3300005577 Bacteria 1137
102 Ga0068854_100001764 3300005578 Bacteria 13172
103 Ga0068854_100013863 3300005578 Bacteria 5301
104 Ga0068854_100019275 3300005578 Bacteria 4595
105 Ga0068854_100114825 3300005578 Bacteria 2036
106 Ga0068856_100011968 3300005614 Bacteria 8401
107 Ga0068856_100033420 3300005614 Bacteria 5036
108 Ga0068856_100322377 3300005614 Bacteria 1562
109 Ga0068852_100001030 3300005616 Bacteria 18351
110 Ga0068852_100080343 3300005616 Bacteria 2890
111 Ga0068852_100538086 3300005616 Bacteria 1167
112 Ga0068852_100722711 3300005616 Bacteria 1007
113 Ga0068859_100002597 3300005617 Bacteria 18383
114 Ga0068864_100000731 3300005618 Bacteria 27480
115 Ga0068864_100537051 3300005618 Bacteria 1129
116 Ga0068866_10042187 3300005718 Bacteria 2269
117 Ga0068861_100000148 3300005719 Bacteria 36127
118 Ga0068851_10011304 3300005834 Bacteria 4185
119 Ga0068851_10012072 3300005834 Bacteria 4067
120 Ga0068863_100000047 3300005841 Bacteria 140249
121 Ga0068863_100003767 3300005841 Bacteria 15004
122 Ga0068863_100010486 3300005841 Bacteria 9007
123 Ga0068863_100014281 3300005841 Bacteria 7649
124 Ga0068858_100000588 3300005842 Bacteria 38216
125 Ga0068858_100003492 3300005842 Bacteria 15587
126 Ga0068860_100000196 3300005843 Bacteria 97096
127 Ga0068860_100008267 3300005843 Bacteria 10356
128 Ga0068860_100023270 3300005843 Bacteria 5987
129 Ga0068860_100036289 3300005843 Bacteria 4724
130 Ga0068862_100000063 3300005844 Bacteria 124662
131 Ga0068862_100007384 3300005844 Bacteria 9116
132 Ga0068862_100924121 3300005844 Bacteria 859
133 Ga0081455_10002546 3300005937 Bacteria 21639
134 Ga0075368_10000252 3300006042 Bacteria 15267
135 Ga0075363_100052875 3300006048 Bacteria 2169
136 Ga0075367_10000054 3300006178 Bacteria 27401
137 Ga0097621_100031374 3300006237 Bacteria 4217
138 Ga0097621_100190058 3300006237 Bacteria 1778
139 Ga0075370_10006098 3300006353 Bacteria 6045
140 Ga0075370_10037579 3300006353 Bacteria 2723
141 Ga0068871_100185845 3300006358 Bacteria 1788
142 Ga0068865_100000072 3300006881 Bacteria 53411
143 Ga0068865_100279800 3300006881 Bacteria 1328
144 Ga0097620_100002597 3300006931 Bacteria 18383
145 Ga0097620_100011775 3300006931 Bacteria 8788
146 Ga0105251_10015352 3300009011 Bacteria 4192
147 Ga0105240_10000959 3300009093 Bacteria 51453
148 Ga0105240_10004825 3300009093 Bacteria 20323
149 Ga0105240_10043982 3300009093 Bacteria 5679
150 Ga0105240_10055391 3300009093 Bacteria 4964
151 Ga0105240_10056021 3300009093 Bacteria 4934
152 Ga0105245_10000991 3300009098 Bacteria 25817
153 Ga0105245_10001709 3300009098 Bacteria 20004
154 Ga0105247_10001115 3300009101 Bacteria 20007
155 Ga0105247_10063313 3300009101 Bacteria 2295
156 Ga0105243_10000737 3300009148 Bacteria 31311
157 Ga0105243_10047869 3300009148 Bacteria 3369
158 Ga0105243_10129062 3300009148 Bacteria 2142
159 Ga0105241_10002409 3300009174 Bacteria 14050
160 Ga0105241_10030503 3300009174 Bacteria 4030
161 Ga0105241_10446330 3300009174 Bacteria 1143
162 Ga0105242_10000178 3300009176 Bacteria 48486
163 Ga0105248_10019155 3300009177 Bacteria 7571
164 Ga0105237_10001281 3300009545 Bacteria 33535
165 Ga0105237_10007067 3300009545 Bacteria 12344
166 Ga0105237_10016910 3300009545 Bacteria 7569
167 Ga0105237_10104848 3300009545 Bacteria 2819
168 Ga0105237_10233537 3300009545 Bacteria 1840
169 Ga0105238_10017266 3300009551 Bacteria 7330
170 Ga0105238_10092272 3300009551 Bacteria 3016
171 Ga0105238_10210877 3300009551 Bacteria 1918
172 Ga0105249_10129922 3300009553 Bacteria 2403
173 Ga0105249_10321312 3300009553 Bacteria 1559
174 Ga0105239_10000156 3300010375 Bacteria 98400
175 Ga0105239_10027427 3300010375 Bacteria 6270
176 Ga0105246_10000632 3300011119 Bacteria 19638
177 Ga0105246_10003219 3300011119 Bacteria 9909
178 Ga0157373_10003358 3300013100 Bacteria 12096
179 Ga0157373_10024990 3300013100 Bacteria 4324
180 Ga0157373_10066548 3300013100 Bacteria 2549
181 Ga0157373_10119605 3300013100 Bacteria 1851
182 Ga0157371_10000030 3300013102 Bacteria 241585
183 Ga0157371_10003665 3300013102 Bacteria 13817
184 Ga0157371_10148248 3300013102 Bacteria 1673
185 Ga0157370_10000213 3300013104 Bacteria 73863
186 Ga0157370_10008634 3300013104 Bacteria 10966
187 Ga0157370_10027202 3300013104 Bacteria 5639
188 Ga0157370_10031556 3300013104 Bacteria 5180
189 Ga0157369_10030780 3300013105 Bacteria 5917
190 Ga0157369_10049579 3300013105 Bacteria 4552
191 Ga0157369_10374014 3300013105 Bacteria 1479
192 Ga0157369_10536632 3300013105 Bacteria 1210
193 Ga0157374_10005847 3300013296 Bacteria 10390
194 Ga0157374_10026073 3300013296 Bacteria 5255
195 Ga0157374_10399118 3300013296 Bacteria 1372
196 Ga0157378_10017190 3300013297 Bacteria 6340
197 Ga0157378_10376366 3300013297 Bacteria 1393
198 Ga0163162_10025996 3300013306 Bacteria 5785
199 Ga0163162_10305216 3300013306 Bacteria 1724
200 Ga0157372_10005904 3300013307 Bacteria 13033
201 Ga0157372_10064731 3300013307 Bacteria 4102
202 Ga0157372_10148749 3300013307 Bacteria 2702
203 Ga0157372_10215277 3300013307 Bacteria 2226
204 Ga0157372_10321430 3300013307 Bacteria 1802
205 Ga0157372_10597749 3300013307 Bacteria 1286
206 Ga0157375_10009597 3300013308 Bacteria 8502
207 Ga0157375_10648450 3300013308 Bacteria 1212
208 Ga0157380_10259177 3300014326 Bacteria 1578
209 Ga0157377_10008193 3300014745 Bacteria 5086
210 Ga0157376_10000287 3300014969 Bacteria 34078
211 Ga0183363_1005 3300015690 Bacteria 403020
212 Ga0163161_10033177 3300017792 Bacteria 3689
213 Ga0206356_10706515 3300020070 Bacteria 975
214 Ga0213875_10000229 3300021388 Bacteria 56654
215 Ga0213875_10091761 3300021388 Bacteria 1417
216 Ga0209147_100491 3300025229 Bacteria 23505
217 Ga0209563_100047 3300025230 Bacteria 366620
218 Ga0207425_1000037 3300025245 Bacteria 224645
219 Ga0209148_1000133 3300025254 Bacteria 171351
220 Ga0209148_1001220 3300025254 Bacteria 14537
221 Ga0209129_1000363 3300025258 Bacteria 37614
222 Ga0209233_1000078 3300025261 Bacteria 348118
223 Ga0209565_1000427 3300025263 Bacteria 34040
224 Ga0209455_1014725 3300025272 Bacteria 1755
225 Ga0209676_1002287 3300025292 Bacteria 13986
226 Ga0209676_1010356 3300025292 Bacteria 3899
227 Ga0209025_1000117 3300025294 Bacteria 215073
228 Ga0209564_1003622 3300025295 Bacteria 10279
229 Ga0209564_1005290 3300025295 Bacteria 7438
230 Ga0209758_1000103 3300025297 Bacteria 223968
231 Ga0209758_1029405 3300025297 Bacteria 2299
232 Ga0209050_1000001 3300025298 Bacteria 3563507
233 Ga0209050_1004951 3300025298 Bacteria 8681
234 Ga0209050_1014423 3300025298 Bacteria 3404
235 Ga0207426_1009119 3300025302 Bacteria 3945
236 Ga0209051_1003509 3300025303 Bacteria 10253
237 Ga0209257_1005036 3300025304 Bacteria 9613
238 Ga0209257_1005111 3300025304 Bacteria 9510
239 Ga0207697_10000130 3300025315 Bacteria 36265
240 Ga0207656_10008971 3300025321 Bacteria 3704
241 Ga0207642_10032946 3300025899 Bacteria 2187
242 Ga0207710_10008193 3300025900 Bacteria 4411
243 Ga0207710_10033001 3300025900 Bacteria 2269
244 Ga0207688_10132857 3300025901 Bacteria 1460
245 Ga0207680_10000033 3300025903 Bacteria 77177
246 Ga0207647_10001366 3300025904 Bacteria 18757
247 Ga0207647_10005723 3300025904 Bacteria 9077
248 Ga0207647_10008063 3300025904 Bacteria 7573
249 Ga0207647_10123078 3300025904 Bacteria 1528
250 Ga0207645_10000520 3300025907 Bacteria 31954
251 Ga0207645_10030776 3300025907 Bacteria 3459
252 Ga0207705_10000018 3300025909 Bacteria 319792
253 Ga0207705_10000163 3300025909 Bacteria 71674
254 Ga0207705_10001877 3300025909 Bacteria 16493
255 Ga0207705_10009458 3300025909 Bacteria 7088
256 Ga0207705_10277494 3300025909 Bacteria 1282
257 Ga0207654_10000852 3300025911 Bacteria 16833
258 Ga0207707_10026421 3300025912 Bacteria 5074
259 Ga0207707_10079378 3300025912 Bacteria 2866
260 Ga0207695_10000521 3300025913 Bacteria 81496
261 Ga0207695_10003499 3300025913 Bacteria 22030
262 Ga0207695_10015077 3300025913 Bacteria 9118
263 Ga0207695_10029492 3300025913 Bacteria 6059
264 Ga0207695_10136608 3300025913 Bacteria 2405
265 Ga0207671_10000607 3300025914 Bacteria 47542
266 Ga0207671_10023761 3300025914 Bacteria 4619
267 Ga0207671_10028062 3300025914 Bacteria 4207
268 Ga0207660_10089146 3300025917 Bacteria 2283
269 Ga0207657_10000408 3300025919 Bacteria 45400
270 Ga0207657_10012810 3300025919 Bacteria 8253
271 Ga0207657_10016065 3300025919 Bacteria 7226
272 Ga0207657_10058219 3300025919 Bacteria 3326
273 Ga0207657_10138453 3300025919 Bacteria 1990
274 Ga0207657_10160254 3300025919 Bacteria 1828
275 Ga0207657_10489385 3300025919 Bacteria 964
276 Ga0207649_10000199 3300025920 Bacteria 49941
277 Ga0207649_10005456 3300025920 Bacteria 6885
278 Ga0207649_10112409 3300025920 Bacteria 1822
279 Ga0207652_10251142 3300025921 Bacteria 1595
280 Ga0207652_10328239 3300025921 Bacteria 1381
281 Ga0207652_10342710 3300025921 Bacteria 1349
282 Ga0207681_10000002 3300025923 Bacteria 985597
283 Ga0207694_10004278 3300025924 Bacteria 11176
284 Ga0207694_10057818 3300025924 Bacteria 3016
285 Ga0207694_10153631 3300025924 Bacteria 1855
286 Ga0207650_10097313 3300025925 Bacteria 2259
287 Ga0207659_10297651 3300025926 Bacteria 1324
288 Ga0207687_10002396 3300025927 Bacteria 12709
289 Ga0207687_10009517 3300025927 Bacteria 6355
290 Ga0207664_10284302 3300025929 Bacteria 1452
291 Ga0207644_10000002 3300025931 Bacteria 942221
292 Ga0207644_10031668 3300025931 Bacteria 3686
293 Ga0207690_10003817 3300025932 Bacteria 8918
294 Ga0207690_10013220 3300025932 Bacteria 4956
295 Ga0207690_10049134 3300025932 Bacteria 2810
296 Ga0207706_10004237 3300025933 Bacteria 13507
297 Ga0207706_10005782 3300025933 Bacteria 11503
298 Ga0207706_10016251 3300025933 Bacteria 6723
299 Ga0207706_10017165 3300025933 Bacteria 6527
300 Ga0207706_10029979 3300025933 Bacteria 4856
301 Ga0207706_10036693 3300025933 Bacteria 4353
302 Ga0207706_10055843 3300025933 Bacteria 3482
303 Ga0207706_10060294 3300025933 Bacteria 3341
304 Ga0207686_10001920 3300025934 Bacteria 11495
305 Ga0207709_10000432 3300025935 Bacteria 40012
306 Ga0207709_10096414 3300025935 Bacteria 1945
307 Ga0207704_10000032 3300025938 Bacteria 108408
308 Ga0207704_10179440 3300025938 Bacteria 1528
309 Ga0207691_10073708 3300025940 Bacteria 3079
310 Ga0207711_10029217 3300025941 Bacteria 4647
311 Ga0207689_10008114 3300025942 Bacteria 9158
312 Ga0207661_10120942 3300025944 Bacteria 2229
313 Ga0207667_10000013 3300025949 Bacteria 435875
314 Ga0207667_10007430 3300025949 Bacteria 13168
315 Ga0207667_10047477 3300025949 Bacteria 4545
316 Ga0207667_10088539 3300025949 Bacteria 3201
317 Ga0207667_10266992 3300025949 Bacteria 1750
318 Ga0207651_10000001 3300025960 Bacteria 516823
319 Ga0207712_10000069 3300025961 Bacteria 127318
320 Ga0207712_10001860 3300025961 Bacteria 13872
321 Ga0207640_10000050 3300025981 Bacteria 96203
322 Ga0207640_10084174 3300025981 Bacteria 2183
323 Ga0207640_10109461 3300025981 Bacteria 1955
324 Ga0207640_10192816 3300025981 Bacteria 1537
325 Ga0207640_10278503 3300025981 Bacteria 1312
326 Ga0207658_10000075 3300025986 Bacteria 109004
327 Ga0207658_10017969 3300025986 Bacteria 4874
328 Ga0207677_10001163 3300026023 Bacteria 14359
329 Ga0207703_10001509 3300026035 Bacteria 21208
330 Ga0207639_10000138 3300026041 Bacteria 54326
331 Ga0207639_10003659 3300026041 Bacteria 10329
332 Ga0207639_10005117 3300026041 Bacteria 8835
333 Ga0207639_10038650 3300026041 Bacteria 3551
334 Ga0207639_10205081 3300026041 Bacteria 1694
335 Ga0207678_10002459 3300026067 Bacteria 16827
336 Ga0207678_10003700 3300026067 Bacteria 13745
337 Ga0207678_10021977 3300026067 Bacteria 5592
338 Ga0207702_10010000 3300026078 Bacteria 7953
339 Ga0207702_10010202 3300026078 Bacteria 7863
340 Ga0207702_10012601 3300026078 Bacteria 7037
341 Ga0207702_10022803 3300026078 Bacteria 5193
342 Ga0207702_10114116 3300026078 Bacteria 2407
343 Ga0207641_10000973 3300026088 Bacteria 29317
344 Ga0207641_10001660 3300026088 Bacteria 21708
345 Ga0207641_10019831 3300026088 Bacteria 5518
346 Ga0207648_10001195 3300026089 Bacteria 29082
347 Ga0207676_10000705 3300026095 Bacteria 26301
348 Ga0207676_10653108 3300026095 Bacteria 1015
349 Ga0207674_10003143 3300026116 Bacteria 20360
350 Ga0207674_10006416 3300026116 Bacteria 13835
351 Ga0207674_10018492 3300026116 Bacteria 7574
352 Ga0207674_10059376 3300026116 Bacteria 3870
353 Ga0207674_10063616 3300026116 Bacteria 3724
354 Ga0207674_10088996 3300026116 Bacteria 3080
355 Ga0207674_10732169 3300026116 Bacteria 954
356 Ga0207675_100000355 3300026118 Bacteria 43840
357 Ga0207683_10004967 3300026121 Bacteria 11438
358 Ga0207683_10268557 3300026121 Bacteria 1558
359 Ga0207698_10000551 3300026142 Bacteria 21787
360 Ga0207698_10033092 3300026142 Bacteria 3753
361 Ga0207698_10174385 3300026142 Bacteria 1897
362 Ga0207698_10179648 3300026142 Bacteria 1873
363 Ga0209813_10000063 3300027866 Bacteria 43741
364 Ga0268266_10000002 3300028379 Bacteria 3059047
365 Ga0268265_10000055 3300028380 Bacteria 158947
366 Ga0268265_10000361 3300028380 Bacteria 49182
367 Ga0268265_10892249 3300028380 Bacteria 872
368 Ga0268264_10000087 3300028381 Bacteria 236696
369 Ga0268264_10000116 3300028381 Bacteria 198591
370 Ga0268264_10000381 3300028381 Bacteria 64651
371 Ga0307517_10019763 3300028786 Bacteria 8619
372 Ga0307517_10082933 3300028786 Bacteria 2716
373 Ga0307408_100024384 3300031548 Bacteria 4130
374 Ga0307413_10033283 3300031824 Bacteria 2933
375 Ga0307410_10093588 3300031852 Bacteria 2139
376 Ga0307410_10125478 3300031852 Bacteria 1878
377 Ga0307406_10101318 3300031901 Bacteria 1962
378 Ga0307406_10179361 3300031901 Bacteria 1540
379 Ga0307412_10000950 3300031911 Bacteria 16577
380 Ga0307412_10023565 3300031911 Bacteria 3789
381 Ga0307412_10086127 3300031911 Bacteria 2185
382 Ga0307412_10186843 3300031911 Bacteria 1563
383 Ga0307409_100135470 3300031995 Bacteria 2113
384 Ga0307409_100412705 3300031995 Bacteria 1293
385 Ga0307409_100736415 3300031995 Bacteria 988
386 Ga0307416_100018666 3300032002 Bacteria 4894
387 Ga0307414_10001891 3300032004 Bacteria 10819
388 Ga0307414_10112675 3300032004 Bacteria 2074
389 Ga0307414_10320199 3300032004 Bacteria 1319
390 Ga0307411_10067422 3300032005 Bacteria 2408
391 Ga0307411_10551386 3300032005 Bacteria 983
392 Ga0373923_0046343 3300035111 Bacteria 1808
393 Ga0316584_0116543 3300036712 Bacteria 1998
394 Ga0395899_0002292 3300037312 Bacteria 15614
395 Ga0395900_0021625 3300037418 Bacteria 6576
396 Ga0395900_0179985 3300037418 Bacteria 2149
397 Ga0395905_0016001 3300037471 Bacteria 7130
398 Ga0395905_0030594 3300037471 Bacteria 5071
399 Ga0395905_0148075 3300037471 Bacteria 2209
400 Ga0395905_0584614 3300037471 Bacteria 1018
401 Ga0395905_0726545 3300037471 Bacteria 895
402 Ga0436364_0413697 3300037853 Bacteria 1944
403 Ga0436364_0530420 3300037853 Bacteria 132998
404 Ga0436365_1704067 3300039437 Bacteria 1313
405 Ga0451793_1365563 3300041452 Bacteria 1797
406 Ga0451802_1527592 3300041460 Bacteria 3233
407 Ga0451806_292367 3300041462 Bacteria 1569
408 Ga0451807_2051197 3300041486 Bacteria 1589
409 Ga0439448_0022377 3300042005 Bacteria 1964
410 Ga0439455_0000137 3300042012 Bacteria 7821
411 Ga0439458_0000756 3300042157 Bacteria 8283
412 Ga0439458_0012507 3300042157 Bacteria 1906
413 Ga0439458_0037728 3300042157 Bacteria 1165
414 Ga0466972_0010998 3300044658 Bacteria 4543
415 Ga0466972_0019619 3300044658 Bacteria 3380
416 Ga0466965_0069761 3300044683 Bacteria 1766
417 Ga0466961_0002427 3300044693 Bacteria 11561
418 Ga0466961_0151817 3300044693 Bacteria 1446
419 Ga0466970_0010891 3300044765 Bacteria 4625
420 Ga0466957_0086515 3300044842 Bacteria 1959
421 Ga0466957_0131832 3300044842 Bacteria 1602
422 Ga0466960_0002678 3300044901 Bacteria 6726
423 Ga0466959_0000595 3300045049 Bacteria 21075
424 Ga0466958_0090108 3300045836 Bacteria 1897
425 Ga0466958_0095266 3300045836 Bacteria 1845
426 Ga0495617_035157 3300046452 Bacteria 1683
427 Ga0495627_000193 3300046453 Bacteria 67253
428 Ga0495627_000478 3300046453 Bacteria 33914
429 Ga0495638_0000011 3300046460 Bacteria 442453
430 Ga0495650_0000373 3300046471 Bacteria 78223
431 Ga0495650_0006527 3300046471 Bacteria 7250
432 Ga0495650_0049726 3300046471 Bacteria 1739
433 Ga0495584_0074512 3300046491 Bacteria 1706
434 Ga0495583_0000305 3300046506 Bacteria 78306
435 Ga0495583_0002224 3300046506 Bacteria 17153
436 Ga0495583_0011527 3300046506 Bacteria 5070
437 Ga0495583_0063366 3300046506 Bacteria 1643
438 Ga0495606_0000591 3300046507 Bacteria 57426
439 Ga0495606_0008930 3300046507 Bacteria 8581
440 Ga0495606_0149671 3300046507 Bacteria 1371
441 Ga0495610_0001092 3300046512 Bacteria 24761
442 Ga0495616_0000018 3300046513 Bacteria 167281
443 Ga0495631_0026785 3300046518 Bacteria 2643
444 Ga0495632_0000042 3300046519 Bacteria 145186
445 Ga0495632_0000538 3300046519 Bacteria 35631
446 Ga0495637_0000626 3300046520 Bacteria 24967
447 Ga0495637_0019775 3300046520 Bacteria 3109
448 Ga0495637_0020613 3300046520 Bacteria 3031
449 Ga0495643_0000005 3300046522 Bacteria 443135
450 Ga0495648_0000023 3300046524 Bacteria 240174
451 Ga0495648_0000115 3300046524 Bacteria 98656
452 Ga0495648_0009282 3300046524 Bacteria 7645
453 Ga0495663_0000015 3300046525 Bacteria 145185
454 Ga0495663_0004526 3300046525 Bacteria 3899
455 Ga0495587_0195933 3300046536 Bacteria 1143
456 Ga0495622_0006174 3300046557 Bacteria 5565
457 Ga0495633_0000197 3300046558 Bacteria 76903
458 Ga0495633_0000262 3300046558 Bacteria 62524
459 Ga0495633_0002581 3300046558 Bacteria 12683
460 Ga0495633_0011568 3300046558 Bacteria 4749
461 Ga0495633_0038543 3300046558 Bacteria 2282
462 Ga0495633_0044808 3300046558 Bacteria 2096
463 Ga0495668_0014245 3300046616 Bacteria 4668
464 Ga0495668_0173497 3300046616 Bacteria 1181
465 Ga0495611_0044505 3300046648 Bacteria 1986
466 Ga0495611_0111175 3300046648 Bacteria 1275
467 Ga0495625_0000959 3300046660 Bacteria 38428
468 Ga0495625_0003788 3300046660 Bacteria 14662
469 Ga0495625_0133328 3300046660 Bacteria 1681
470 Ga0495625_0165586 3300046660 Bacteria 1478
471 Ga0495661_0101759 3300046665 Bacteria 1616
472 Ga0495669_0000268 3300046684 Bacteria 29882
473 Ga0495671_0000007 3300046692 Bacteria 443069
474 Ga0495671_0000012 3300046692 Bacteria 358632
475 Ga0495671_0007760 3300046692 Bacteria 6080
476 Ga0495600_0015371 3300046809 Bacteria 4839
477 Ga0495660_0071088 3300046810 Bacteria 1846
478 Ga0495672_0227828 3300047320 Bacteria 916
479 Ga0495683_0131357 3300047323 Bacteria 1181
480 Ga0495677_0045964 3300047445 Bacteria 1602
481 Ga0495673_0000029 3300047469 Bacteria 471019
482 Ga0495681_0000032 3300047470 Bacteria 127415
483 Ga0495686_0000149 3300047472 Bacteria 135332
484 Ga0495686_0008181 3300047472 Bacteria 7718
485 Ga0495686_0008478 3300047472 Bacteria 7539
486 Ga0495686_0009317 3300047472 Bacteria 7085
487 Ga0495686_0022254 3300047472 Bacteria 4195
488 Ga0495686_0093226 3300047472 Bacteria 1826
489 Ga0495686_0098955 3300047472 Bacteria 1761
490 Ga0495686_0246744 3300047472 Bacteria 1005
491 Ga0496102_0000049 3300048905 Bacteria 179480
492 Ga0496102_0123199 3300048905 Bacteria 2422
493 Ga0496103_0000037 3300048906 Bacteria 179474
494 Ga0496108_0018131 3300048911 Bacteria 5759
495 Ga0496110_0069636 3300048913 Bacteria 3116
496 Ga0496115_0019493 3300048918 Bacteria 5220
497 Ga0496116_0000664 3300048919 Bacteria 44805
498 Ga0496116_0059042 3300048919 Bacteria 2497
499 Ga0496117_0000115 3300048920 Bacteria 179488
500 Ga0496117_0048676 3300048920 Bacteria 3024
501 Ga0496117_0066120 3300048920 Bacteria 2454
502 Ga0496117_0084565 3300048920 Bacteria 2069
503 Ga0496117_0111413 3300048920 Bacteria 1704
504 Ga0496118_0000086 3300048921 Bacteria 179488
505 Ga0496118_0024617 3300048921 Bacteria 5191
506 Ga0496118_0038779 3300048921 Bacteria 3813
507 Ga0496118_0067935 3300048921 Bacteria 2591
508 Ga0496118_0117603 3300048921 Bacteria 1743
509 Ga0496119_0026037 3300048922 Bacteria 4067
510 Ga0496120_0043762 3300048923 Bacteria 2606
511 Ga0496120_0056749 3300048923 Bacteria 2208
512 Ga0496121_0000208 3300048924 Bacteria 129753
513 Ga0496121_0000237 3300048924 Bacteria 118615
514 Ga0496121_0006256 3300048924 Bacteria 14903
515 Ga0496121_0010863 3300048924 Bacteria 10179
516 Ga0496121_0021861 3300048924 Bacteria 6245
517 Ga0496121_0356664 3300048924 Bacteria 972
518 Ga0496122_0000970 3300048925 Bacteria 51487
519 Ga0496122_0009733 3300048925 Bacteria 10045
520 Ga0496122_0010014 3300048925 Bacteria 9863
521 Ga0496122_0046575 3300048925 Bacteria 3357
522 Ga0496122_0049081 3300048925 Bacteria 3238
523 Ga0496123_0000286 3300048926 Bacteria 98752
524 Ga0496123_0004476 3300048926 Bacteria 14656
525 Ga0496123_0010752 3300048926 Bacteria 8036
526 Ga0496123_0014617 3300048926 Bacteria 6490
527 Ga0496123_0015139 3300048926 Bacteria 6347
528 Ga0496124_0000102 3300048927 Bacteria 179488
529 Ga0496124_0000510 3300048927 Bacteria 66863
530 Ga0496124_0002035 3300048927 Bacteria 27471
531 Ga0496124_0002045 3300048927 Bacteria 27415
532 Ga0496124_0009343 3300048927 Bacteria 10103
533 Ga0496124_0027789 3300048927 Bacteria 5069
534 Ga0496124_0054093 3300048927 Bacteria 3399
535 Ga0496124_0070937 3300048927 Bacteria 2889
536 Ga0496124_0090087 3300048927 Bacteria 2503
537 Ga0496124_0154889 3300048927 Bacteria 1793
538 Ga0496125_0022011 3300048928 Bacteria 5928
539 Ga0496125_0128582 3300048928 Bacteria 1789
540 Ga0496126_0047987 3300048929 Bacteria 3907
541 Ga0496126_0317127 3300048929 Bacteria 1282
542 Ga0495678_029037 3300049459 Bacteria 2327
543 Ga0495682_0052089 3300049460 Bacteria 1488
544 Ga0501290_001795 3300049513 Bacteria 2851
545 Ga0501290_005576 3300049513 Bacteria 1570
546 Ga0501292_000008 3300049515 Bacteria 83748
547 Ga0501294_001311 3300049517 Bacteria 2546
548 Ga0501300_000363 3300049523 Bacteria 6905
549 Ga0501335_000124 3300049551 Bacteria 3760
550 Ga0501036_0612885 3300049572 Bacteria 902
551 Ga0501223_000368 3300049663 Bacteria 11106
552 Ga0501233_004089 3300049668 Bacteria 2655
553 Ga0501235_000385 3300049669 Bacteria 8468
554 Ga0501235_001136 3300049669 Bacteria 5577
555 Ga0501236_021268 3300049670 Bacteria 960
556 Ga0501257_001545 3300049686 Bacteria 4799
557 Ga0501257_007205 3300049686 Bacteria 2483
558 Ga0501259_000518 3300049688 Bacteria 6179
559 Ga0501261_000020 3300049690 Bacteria 37889
560 Ga0501225_0000786 3300049705 Bacteria 9925
561 Ga0501279_000002 3300049775 Bacteria 205937
562 Ga0501280_000010 3300049776 Bacteria 63153
563 Ga0501280_004171 3300049776 Bacteria 2145
564 Ga0501282_000295 3300049778 Bacteria 6018
565 Ga0501283_001354 3300049779 Bacteria 3202
566 nmdc:mga03n38_46054_c1 3300050490 Bacteria 1923
567 nmdc:mga06z11_27_c1 3300050494 Bacteria 64010
568 nmdc:mga04h51_147_c1 3300050495 Bacteria 20575
569 nmdc:mga07m45_138208_c1 3300050496 Bacteria 1411
570 nmdc:mga07m45_18564_c1 3300050496 Bacteria 3757
571 Ga0500643_000081 3300053087 Bacteria 101681
572 Ga0500643_000306 3300053087 Bacteria 40712
573 Ga0500643_011202 3300053087 Bacteria 3285
574 Ga0500643_024242 3300053087 Bacteria 1928
575 Ga0500555_000444 3300053103 Bacteria 17141
576 Ga0500556_0000074 3300053104 Bacteria 98799
577 Ga0500562_024231 3300053108 Bacteria 1586
578 Ga0500594_0024835 3300053118 Bacteria 1530
579 Ga0500595_004504 3300053119 Bacteria 6234
580 Ga0500597_018671 3300053120 Bacteria 2693
581 Ga0500608_007974 3300053122 Bacteria 4419
582 Ga0500608_026077 3300053122 Bacteria 2742
583 Ga0500642_0000002 3300053130 Bacteria 795093
584 Ga0500642_0000116 3300053130 Bacteria 37194
585 Ga0500559_0068599 3300053136 Bacteria 1593
586 Ga0500573_0000046 3300053140 Bacteria 98723
587 Ga0500573_0245911 3300053140 Bacteria 925
588 Ga0500616_0007580 3300053153 Bacteria 6865
589 Ga0500624_000044 3300053157 Bacteria 90094
590 Ga0500624_000053 3300053157 Bacteria 74086
591 Ga0500627_0002055 3300053158 Bacteria 5826
592 Ga0500636_0028474 3300053177 Bacteria 3299
593 Ga0500637_0000008 3300053178 Bacteria 89244
594 Ga0500645_000009 3300053730 Bacteria 206177
595 Ga0500645_000439 3300053730 Bacteria 28425
596 Ga0500596_002809 3300053735 Bacteria 3401
597 Ga0500661_000082 3300055283 Bacteria 14988
598 Ga0466962_0008633 3300061719 Bacteria 4885
599 Ga0466962_0158351 3300061719 Bacteria 1100
600 Ga0466962_0182140 3300061719 Bacteria 1024

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049517 Ga0501294_001311 Ga0501294_001311_1473_2192 231
2 3300047472 Ga0495686_0093226 Ga0495686_0093226_653_1417 243
3 iso_pu_bacteria 2599185359 2600226338 247
4 iso_pu_bacteria 2818991466 2819712418 247
5 iso_pu_bacteria 2830075706 2830077902 247
6 iso_pu_bacteria 2928526807 2928526928 247
7 iso_pu_bacteria 2928968154 2928969467 247
8 iso_pu_bacteria 8057101203 8057101752 247
9 3300002774 JGI25150J39212_1000213 JGI25150J39212_100021315 248
10 3300003215 JGI25153J46596_10000036 JGI25153J46596_1000003651 248
11 3300003781 Ga0055536_1013054 Ga0055536_10130544 248
12 3300003792 Ga0055540_1001281 Ga0055540_10012818 248
13 3300005367 Ga0070667_100000016 Ga0070667_10000001699 248
14 3300005841 Ga0068863_100010486 Ga0068863_1000104865 248
15 3300005843 Ga0068860_100000196 Ga0068860_10000019639 248
16 3300025245 Ga0207425_1000037 Ga0207425_1000037103 248
17 3300025258 Ga0209129_1000363 Ga0209129_100036323 248
18 3300025292 Ga0209676_1002287 Ga0209676_100228710 248
19 3300025294 Ga0209025_1000117 Ga0209025_100011769 248
20 3300025297 Ga0209758_1000103 Ga0209758_1000103103 248
21 3300025298 Ga0209050_1000001 Ga0209050_10000013344 248
22 3300025303 Ga0209051_1003509 Ga0209051_10035094 248
23 3300025304 Ga0209257_1005111 Ga0209257_10051118 248
24 3300025986 Ga0207658_10000075 Ga0207658_1000007514 248
25 3300026088 Ga0207641_10000973 Ga0207641_100009738 248
26 3300028381 Ga0268264_10000087 Ga0268264_1000008799 248
27 3300025909 Ga0207705_10277494 Ga0207705_102774941 249
28 3300037471 Ga0395905_0148075 Ga0395905_0148075_1042_1794 249
29 3300037471 Ga0395905_0726545 Ga0395905_0726545_39_791 249
30 3300049513 Ga0501290_001795 Ga0501290_001795_1651_2427 249
31 3300049515 Ga0501292_000008 Ga0501292_000008_35006_35782 249
32 3300049523 Ga0501300_000363 Ga0501300_000363_404_1180 249
33 3300049663 Ga0501223_000368 Ga0501223_000368_6505_7281 249
34 3300049668 Ga0501233_004089 Ga0501233_004089_1229_2005 249
35 3300049669 Ga0501235_000385 Ga0501235_000385_779_1555 249
36 3300049686 Ga0501257_007205 Ga0501257_007205_779_1555 249
37 3300049688 Ga0501259_000518 Ga0501259_000518_4826_5602 249
38 3300049690 Ga0501261_000020 Ga0501261_000020_556_1332 249
39 3300049705 Ga0501225_0000786 Ga0501225_0000786_763_1539 249
40 3300049775 Ga0501279_000002 Ga0501279_000002_106938_107714 249
41 3300049776 Ga0501280_000010 Ga0501280_000010_12239_13015 249
42 3300049778 Ga0501282_000295 Ga0501282_000295_1518_2294 249
43 3300049779 Ga0501283_001354 Ga0501283_001354_808_1584 249
44 3300053120 Ga0500597_018671 Ga0500597_018671_24_776 249
45 3300053157 Ga0500624_000044 Ga0500624_000044_8081_8833 249
46 3300053178 Ga0500637_0000008 Ga0500637_0000008_8090_8842 249
47 3300005535 Ga0070684_100042855 Ga0070684_1000428552 250
48 3300013308 Ga0157375_10648450 Ga0157375_106484501 250
49 3300035111 Ga0373923_0046343 Ga0373923_0046343_818_1573 250
50 3300003771 Ga0055526_1000948 Ga0055526_100094814 251
51 3300003771 Ga0055526_1040803 Ga0055526_10408032 251
52 3300005262 Ga0065165_1077603 Ga0065165_10776031 251
53 3300009093 Ga0105240_10000959 Ga0105240_1000095911 251
54 3300009093 Ga0105240_10056021 Ga0105240_100560217 251
55 3300009545 Ga0105237_10001281 Ga0105237_1000128126 251
56 3300009545 Ga0105237_10007067 Ga0105237_1000706713 251
57 3300010375 Ga0105239_10000156 Ga0105239_1000015653 251
58 3300013297 Ga0157378_10376366 Ga0157378_103763662 251
59 3300013306 Ga0163162_10305216 Ga0163162_103052162 251
60 3300015690 Ga0183363_1005 Ga0183363_1005204 251
61 3300021388 Ga0213875_10091761 Ga0213875_100917612 251
62 3300025263 Ga0209565_1000427 Ga0209565_100042725 251
63 3300025292 Ga0209676_1010356 Ga0209676_10103563 251
64 3300025295 Ga0209564_1003622 Ga0209564_10036223 251
65 3300025295 Ga0209564_1005290 Ga0209564_10052905 251
66 3300025297 Ga0209758_1029405 Ga0209758_10294053 251
67 3300025298 Ga0209050_1004951 Ga0209050_10049516 251
68 3300025298 Ga0209050_1014423 Ga0209050_10144233 251
69 3300025302 Ga0207426_1009119 Ga0207426_10091192 251
70 3300025304 Ga0209257_1005036 Ga0209257_10050369 251
71 3300025913 Ga0207695_10000521 Ga0207695_1000052135 251
72 3300025913 Ga0207695_10015077 Ga0207695_100150775 251
73 3300025914 Ga0207671_10000607 Ga0207671_1000060719 251
74 3300025914 Ga0207671_10028062 Ga0207671_100280624 251
75 3300025941 Ga0207711_10029217 Ga0207711_100292173 251
76 3300031911 Ga0307412_10000950 Ga0307412_100009509 251
77 3300037853 Ga0436364_0413697 Ga0436364_0413697_959_1717 251
78 3300046660 Ga0495625_0165586 Ga0495625_0165586_636_1394 251
79 3300047445 Ga0495677_0045964 Ga0495677_0045964_816_1574 251
80 3300047472 Ga0495686_0098955 Ga0495686_0098955_535_1290 251
81 3300048918 Ga0496115_0019493 Ga0496115_0019493_891_1667 251
82 3300048920 Ga0496117_0111413 Ga0496117_0111413_858_1634 251
83 3300048923 Ga0496120_0043762 Ga0496120_0043762_1118_1882 251
84 3300048924 Ga0496121_0010863 Ga0496121_0010863_7601_8371 251
85 3300048924 Ga0496121_0356664 Ga0496121_0356664_92_862 251
86 3300048925 Ga0496122_0046575 Ga0496122_0046575_1540_2304 251
87 3300048926 Ga0496123_0014617 Ga0496123_0014617_4621_5385 251
88 3300048926 Ga0496123_0015139 Ga0496123_0015139_1657_2421 251
89 3300048927 Ga0496124_0000510 Ga0496124_0000510_64340_65104 251
90 3300048927 Ga0496124_0002045 Ga0496124_0002045_21034_21798 251
91 3300048927 Ga0496124_0009343 Ga0496124_0009343_8627_9391 251
92 3300048927 Ga0496124_0154889 Ga0496124_0154889_983_1747 251
93 3300048928 Ga0496125_0128582 Ga0496125_0128582_53_817 251
94 3300048929 Ga0496126_0047987 Ga0496126_0047987_1712_2482 251
95 3300048929 Ga0496126_0317127 Ga0496126_0317127_65_829 251
96 3300053087 Ga0500643_011202 Ga0500643_011202_1791_2549 251
97 3300053140 Ga0500573_0000046 Ga0500573_0000046_70455_71225 251
98 3300005327 Ga0070658_10005034 Ga0070658_1000503414 252
99 3300005339 Ga0070660_100084076 Ga0070660_1000840762 252
100 3300005344 Ga0070661_100036450 Ga0070661_1000364503 252
101 3300005366 Ga0070659_100137208 Ga0070659_1001372083 252
102 3300005530 Ga0070679_100274033 Ga0070679_1002740332 252
103 3300005548 Ga0070665_100000186 Ga0070665_10000018649 252
104 3300005563 Ga0068855_100008444 Ga0068855_10000844410 252
105 3300005564 Ga0070664_100255870 Ga0070664_1002558702 252
106 3300005578 Ga0068854_100019275 Ga0068854_1000192755 252
107 3300005616 Ga0068852_100080343 Ga0068852_1000803433 252
108 3300005616 Ga0068852_100538086 Ga0068852_1005380862 252
109 3300005618 Ga0068864_100537051 Ga0068864_1005370512 252
110 3300005834 Ga0068851_10011304 Ga0068851_100113042 252
111 3300005842 Ga0068858_100003492 Ga0068858_1000034925 252
112 3300006237 Ga0097621_100190058 Ga0097621_1001900582 252
113 3300006358 Ga0068871_100185845 Ga0068871_1001858452 252
114 3300009093 Ga0105240_10004825 Ga0105240_1000482514 252
115 3300009098 Ga0105245_10001709 Ga0105245_100017099 252
116 3300009148 Ga0105243_10129062 Ga0105243_101290623 252
117 3300009174 Ga0105241_10030503 Ga0105241_100305032 252
118 3300009545 Ga0105237_10233537 Ga0105237_102335372 252
119 3300009551 Ga0105238_10092272 Ga0105238_100922723 252
120 3300013100 Ga0157373_10066548 Ga0157373_100665482 252
121 3300013102 Ga0157371_10000030 Ga0157371_1000003014 252
122 3300013104 Ga0157370_10008634 Ga0157370_100086346 252
123 3300013105 Ga0157369_10374014 Ga0157369_103740142 252
124 3300013105 Ga0157369_10536632 Ga0157369_105366322 252
125 3300013296 Ga0157374_10399118 Ga0157374_103991182 252
126 3300021388 Ga0213875_10000229 Ga0213875_1000022931 252
127 3300025230 Ga0209563_100047 Ga0209563_100047226 252
128 3300025321 Ga0207656_10008971 Ga0207656_100089713 252
129 3300025907 Ga0207645_10030776 Ga0207645_100307764 252
130 3300025909 Ga0207705_10000163 Ga0207705_1000016346 252
131 3300025911 Ga0207654_10000852 Ga0207654_1000085215 252
132 3300025912 Ga0207707_10079378 Ga0207707_100793783 252
133 3300025913 Ga0207695_10003499 Ga0207695_100034996 252
134 3300025920 Ga0207649_10000199 Ga0207649_1000019929 252
135 3300025921 Ga0207652_10342710 Ga0207652_103427102 252
136 3300025924 Ga0207694_10004278 Ga0207694_100042783 252
137 3300025924 Ga0207694_10057818 Ga0207694_100578183 252
138 3300025927 Ga0207687_10009517 Ga0207687_100095174 252
139 3300025932 Ga0207690_10003817 Ga0207690_1000381711 252
140 3300025933 Ga0207706_10029979 Ga0207706_100299793 252
141 3300025933 Ga0207706_10055843 Ga0207706_100558434 252
142 3300025935 Ga0207709_10096414 Ga0207709_100964142 252
143 3300025949 Ga0207667_10007430 Ga0207667_100074306 252
144 3300025981 Ga0207640_10109461 Ga0207640_101094613 252
145 3300026035 Ga0207703_10001509 Ga0207703_100015096 252
146 3300026041 Ga0207639_10038650 Ga0207639_100386503 252
147 3300026067 Ga0207678_10003700 Ga0207678_100037002 252
148 3300026078 Ga0207702_10010202 Ga0207702_100102027 252
149 3300026078 Ga0207702_10012601 Ga0207702_100126012 252
150 3300026095 Ga0207676_10653108 Ga0207676_106531082 252
151 3300026116 Ga0207674_10006416 Ga0207674_1000641614 252
152 3300026116 Ga0207674_10732169 Ga0207674_107321692 252
153 3300026142 Ga0207698_10033092 Ga0207698_100330923 252
154 3300026142 Ga0207698_10174385 Ga0207698_101743853 252
155 3300028379 Ga0268266_10000002 Ga0268266_100000021806 252
156 3300028786 Ga0307517_10019763 Ga0307517_100197639 252
157 3300028786 Ga0307517_10082933 Ga0307517_100829333 252
158 3300037853 Ga0436364_0530420 Ga0436364_0530420_88916_89674 252
159 3300039437 Ga0436365_1704067 Ga0436365_1704067_86_844 252
160 3300046452 Ga0495617_035157 Ga0495617_035157_173_931 252
161 3300046471 Ga0495650_0000373 Ga0495650_0000373_24650_25408 252
162 3300046491 Ga0495584_0074512 Ga0495584_0074512_617_1375 252
163 3300046506 Ga0495583_0011527 Ga0495583_0011527_992_1750 252
164 3300046506 Ga0495583_0063366 Ga0495583_0063366_550_1308 252
165 3300046507 Ga0495606_0000591 Ga0495606_0000591_5442_6200 252
166 3300046518 Ga0495631_0026785 Ga0495631_0026785_1268_2026 252
167 3300046520 Ga0495637_0019775 Ga0495637_0019775_351_1109 252
168 3300046524 Ga0495648_0000115 Ga0495648_0000115_10215_10973 252
169 3300046525 Ga0495663_0004526 Ga0495663_0004526_1356_2114 252
170 3300046536 Ga0495587_0195933 Ga0495587_0195933_308_1066 252
171 3300046557 Ga0495622_0006174 Ga0495622_0006174_3246_4004 252
172 3300046558 Ga0495633_0002581 Ga0495633_0002581_608_1366 252
173 3300046648 Ga0495611_0044505 Ga0495611_0044505_165_923 252
174 3300046648 Ga0495611_0111175 Ga0495611_0111175_379_1137 252
175 3300046660 Ga0495625_0000959 Ga0495625_0000959_37262_38020 252
176 3300046660 Ga0495625_0133328 Ga0495625_0133328_373_1131 252
177 3300046665 Ga0495661_0101759 Ga0495661_0101759_625_1383 252
178 3300046684 Ga0495669_0000268 Ga0495669_0000268_9275_10033 252
179 3300046809 Ga0495600_0015371 Ga0495600_0015371_1057_1815 252
180 3300046810 Ga0495660_0071088 Ga0495660_0071088_330_1088 252
181 3300048920 Ga0496117_0084565 Ga0496117_0084565_844_1617 252
182 3300048921 Ga0496118_0067935 Ga0496118_0067935_792_1565 252
183 3300048924 Ga0496121_0000237 Ga0496121_0000237_85392_86150 252
184 3300048924 Ga0496121_0006256 Ga0496121_0006256_3465_4238 252
185 3300048925 Ga0496122_0010014 Ga0496122_0010014_7660_8439 252
186 3300048926 Ga0496123_0004476 Ga0496123_0004476_4512_5291 252
187 3300048927 Ga0496124_0002035 Ga0496124_0002035_20233_21012 252
188 3300053119 Ga0500595_004504 Ga0500595_004504_4669_5427 252
189 3300053122 Ga0500608_026077 Ga0500608_026077_1371_2144 252
190 3300053130 Ga0500642_0000116 Ga0500642_0000116_17874_18632 252
191 3300053153 Ga0500616_0007580 Ga0500616_0007580_1823_2596 252
192 3300053177 Ga0500636_0028474 Ga0500636_0028474_1962_2720 252
193 3300053730 Ga0500645_000009 Ga0500645_000009_9290_10048 252
194 3300053735 Ga0500596_002809 Ga0500596_002809_2061_2819 252
195 3300001989 JGI24739J22299_10003139 JGI24739J22299_100031395 253
196 3300001989 JGI24739J22299_10012763 JGI24739J22299_100127632 253
197 3300002067 JGI24735J21928_10004189 JGI24735J21928_100041893 253
198 3300002067 JGI24735J21928_10007068 JGI24735J21928_100070683 253
199 3300002067 JGI24735J21928_10019301 JGI24735J21928_100193012 253
200 3300003214 JGI25165J46597_1000112 JGI25165J46597_100011246 253
201 3300005327 Ga0070658_10081915 Ga0070658_100819153 253
202 3300005355 Ga0070671_100162503 Ga0070671_1001625031 253
203 3300005356 Ga0070674_100068398 Ga0070674_1000683982 253
204 3300005366 Ga0070659_100056093 Ga0070659_1000560933 253
205 3300005457 Ga0070662_100067495 Ga0070662_1000674953 253
206 3300005563 Ga0068855_100144960 Ga0068855_1001449603 253
207 3300005614 Ga0068856_100011968 Ga0068856_1000119685 253
208 3300005841 Ga0068863_100003767 Ga0068863_10000376713 253
209 3300005843 Ga0068860_100023270 Ga0068860_1000232704 253
210 3300005844 Ga0068862_100000063 Ga0068862_10000006344 253
211 3300006353 Ga0075370_10037579 Ga0075370_100375793 253
212 3300006931 Ga0097620_100011775 Ga0097620_1000117755 253
213 3300009093 Ga0105240_10055391 Ga0105240_100553913 253
214 3300009101 Ga0105247_10063313 Ga0105247_100633132 253
215 3300009148 Ga0105243_10047869 Ga0105243_100478692 253
216 3300013100 Ga0157373_10119605 Ga0157373_101196053 253
217 3300013104 Ga0157370_10000213 Ga0157370_1000021340 253
218 3300013105 Ga0157369_10030780 Ga0157369_100307803 253
219 3300013307 Ga0157372_10005904 Ga0157372_100059042 253
220 3300025254 Ga0209148_1001220 Ga0209148_10012208 253
221 3300025261 Ga0209233_1000078 Ga0209233_100007898 253
222 3300025900 Ga0207710_10033001 Ga0207710_100330013 253
223 3300025904 Ga0207647_10005723 Ga0207647_100057239 253
224 3300025904 Ga0207647_10123078 Ga0207647_101230782 253
225 3300025913 Ga0207695_10029492 Ga0207695_100294923 253
226 3300025919 Ga0207657_10058219 Ga0207657_100582193 253
227 3300025919 Ga0207657_10160254 Ga0207657_101602542 253
228 3300025933 Ga0207706_10036693 Ga0207706_100366932 253
229 3300025933 Ga0207706_10060294 Ga0207706_100602943 253
230 3300025961 Ga0207712_10000069 Ga0207712_10000069132 253
231 3300026078 Ga0207702_10022803 Ga0207702_100228034 253
232 3300026088 Ga0207641_10001660 Ga0207641_100016603 253
233 3300028380 Ga0268265_10000055 Ga0268265_10000055116 253
234 3300028381 Ga0268264_10000381 Ga0268264_1000038167 253
235 3300037312 Ga0395899_0002292 Ga0395899_0002292_11715_12494 253
236 3300037418 Ga0395900_0021625 Ga0395900_0021625_846_1625 253
237 3300037418 Ga0395900_0179985 Ga0395900_0179985_1157_1936 253
238 3300041452 Ga0451793_1365563 Ga0451793_1365563_977_1756 253
239 3300041460 Ga0451802_1527592 Ga0451802_1527592_431_1210 253
240 3300041462 Ga0451806_292367 Ga0451806_292367_199_978 253
241 3300041486 Ga0451807_2051197 Ga0451807_2051197_243_1022 253
242 3300042005 Ga0439448_0022377 Ga0439448_0022377_814_1593 253
243 3300042012 Ga0439455_0000137 Ga0439455_0000137_6227_7006 253
244 3300042157 Ga0439458_0000756 Ga0439458_0000756_1118_1897 253
245 3300042157 Ga0439458_0012507 Ga0439458_0012507_249_1028 253
246 3300042157 Ga0439458_0037728 Ga0439458_0037728_98_877 253
247 3300044842 Ga0466957_0086515 Ga0466957_0086515_77_856 253
248 3300046507 Ga0495606_0149671 Ga0495606_0149671_266_1045 253
249 3300047323 Ga0495683_0131357 Ga0495683_0131357_64_843 253
250 3300047472 Ga0495686_0008181 Ga0495686_0008181_5227_6021 253
251 3300047472 Ga0495686_0009317 Ga0495686_0009317_5106_5900 253
252 3300048905 Ga0496102_0000049 Ga0496102_0000049_143231_144001 253
253 3300048906 Ga0496103_0000037 Ga0496103_0000037_35474_36244 253
254 3300048919 Ga0496116_0000664 Ga0496116_0000664_35175_35945 253
255 3300048920 Ga0496117_0000115 Ga0496117_0000115_143231_144001 253
256 3300048920 Ga0496117_0048676 Ga0496117_0048676_1932_2711 253
257 3300048921 Ga0496118_0000086 Ga0496118_0000086_35488_36258 253
258 3300048921 Ga0496118_0024617 Ga0496118_0024617_1721_2500 253
259 3300048921 Ga0496118_0117603 Ga0496118_0117603_702_1481 253
260 3300048922 Ga0496119_0026037 Ga0496119_0026037_3275_4045 253
261 3300048923 Ga0496120_0056749 Ga0496120_0056749_1225_1995 253
262 3300048924 Ga0496121_0021861 Ga0496121_0021861_669_1448 253
263 3300048925 Ga0496122_0009733 Ga0496122_0009733_6761_7540 253
264 3300048926 Ga0496123_0010752 Ga0496123_0010752_7101_7880 253
265 3300048927 Ga0496124_0000102 Ga0496124_0000102_35488_36258 253
266 3300048927 Ga0496124_0090087 Ga0496124_0090087_677_1456 253
267 3300049513 Ga0501290_005576 Ga0501290_005576_308_1069 253
268 3300049686 Ga0501257_001545 Ga0501257_001545_3141_3902 253
269 3300049776 Ga0501280_004171 Ga0501280_004171_209_970 253
270 3300050496 nmdc:mga07m45_138208_c1 nmdc:mga07m45_138208_c1_457_1236 253
271 3300053140 Ga0500573_0245911 Ga0500573_0245911_136_906 253
272 iso_pu_bacteria 2848297114 2848299367 253
273 3300001979 JGI24740J21852_10012988 JGI24740J21852_100129883 254
274 3300001989 JGI24739J22299_10001067 JGI24739J22299_100010678 254
275 3300001990 JGI24737J22298_10004452 JGI24737J22298_100044523 254
276 3300001990 JGI24737J22298_10005014 JGI24737J22298_100050142 254
277 3300002075 JGI24738J21930_10000464 JGI24738J21930_1000046411 254
278 3300002075 JGI24738J21930_10002688 JGI24738J21930_100026885 254
279 3300003316 rootH1_10111877 rootH1_101118772 254
280 3300003322 rootL2_10227911 rootL2_102279111 254
281 3300003762 Ga0055542_1004132 Ga0055542_10041322 254
282 3300005327 Ga0070658_10000896 Ga0070658_1000089615 254
283 3300005327 Ga0070658_10006492 Ga0070658_100064924 254
284 3300005328 Ga0070676_10000257 Ga0070676_100002574 254
285 3300005334 Ga0068869_100004094 Ga0068869_10000409410 254
286 3300005338 Ga0068868_100000023 Ga0068868_10000002326 254
287 3300005339 Ga0070660_100000395 Ga0070660_10000039519 254
288 3300005339 Ga0070660_100049125 Ga0070660_1000491252 254
289 3300005355 Ga0070671_100043899 Ga0070671_1000438995 254
290 3300005364 Ga0070673_100000001 Ga0070673_100000001106 254
291 3300005364 Ga0070673_100335412 Ga0070673_1003354122 254
292 3300005455 Ga0070663_100012272 Ga0070663_1000122726 254
293 3300005457 Ga0070662_100039173 Ga0070662_1000391733 254
294 3300005457 Ga0070662_100206618 Ga0070662_1002066182 254
295 3300005459 Ga0068867_100000387 Ga0068867_10000038716 254
296 3300005539 Ga0068853_100013579 Ga0068853_1000135793 254
297 3300005539 Ga0068853_100209603 Ga0068853_1002096032 254
298 3300005543 Ga0070672_100093513 Ga0070672_1000935133 254
299 3300005563 Ga0068855_100000092 Ga0068855_10000009267 254
300 3300005578 Ga0068854_100001764 Ga0068854_1000017647 254
301 3300005614 Ga0068856_100322377 Ga0068856_1003223772 254
302 3300005616 Ga0068852_100001030 Ga0068852_1000010306 254
303 3300005616 Ga0068852_100722711 Ga0068852_1007227111 254
304 3300005718 Ga0068866_10042187 Ga0068866_100421873 254
305 3300006237 Ga0097621_100031374 Ga0097621_1000313743 254
306 3300006881 Ga0068865_100000072 Ga0068865_10000007236 254
307 3300006881 Ga0068865_100279800 Ga0068865_1002798002 254
308 3300009098 Ga0105245_10000991 Ga0105245_1000099110 254
309 3300009148 Ga0105243_10000737 Ga0105243_1000073714 254
310 3300009174 Ga0105241_10446330 Ga0105241_104463302 254
311 3300009176 Ga0105242_10000178 Ga0105242_1000017814 254
312 3300009545 Ga0105237_10104848 Ga0105237_101048483 254
313 3300009551 Ga0105238_10017266 Ga0105238_100172663 254
314 3300010375 Ga0105239_10027427 Ga0105239_100274278 254
315 3300011119 Ga0105246_10003219 Ga0105246_100032195 254
316 3300013296 Ga0157374_10005847 Ga0157374_100058477 254
317 3300013296 Ga0157374_10026073 Ga0157374_100260733 254
318 3300013297 Ga0157378_10017190 Ga0157378_100171903 254
319 3300013307 Ga0157372_10064731 Ga0157372_100647313 254
320 3300013307 Ga0157372_10148749 Ga0157372_101487493 254
321 3300013308 Ga0157375_10009597 Ga0157375_100095977 254
322 3300014745 Ga0157377_10008193 Ga0157377_100081934 254
323 3300014969 Ga0157376_10000287 Ga0157376_1000028717 254
324 3300025254 Ga0209148_1000133 Ga0209148_100013385 254
325 3300025272 Ga0209455_1014725 Ga0209455_10147251 254
326 3300025899 Ga0207642_10032946 Ga0207642_100329463 254
327 3300025901 Ga0207688_10132857 Ga0207688_101328572 254
328 3300025904 Ga0207647_10001366 Ga0207647_1000136611 254
329 3300025907 Ga0207645_10000520 Ga0207645_1000052026 254
330 3300025909 Ga0207705_10000018 Ga0207705_10000018206 254
331 3300025909 Ga0207705_10001877 Ga0207705_100018773 254
332 3300025914 Ga0207671_10023761 Ga0207671_100237612 254
333 3300025919 Ga0207657_10012810 Ga0207657_100128106 254
334 3300025919 Ga0207657_10016065 Ga0207657_100160652 254
335 3300025919 Ga0207657_10489385 Ga0207657_104893851 254
336 3300025926 Ga0207659_10297651 Ga0207659_102976512 254
337 3300025927 Ga0207687_10002396 Ga0207687_100023965 254
338 3300025931 Ga0207644_10031668 Ga0207644_100316685 254
339 3300025933 Ga0207706_10005782 Ga0207706_1000578210 254
340 3300025934 Ga0207686_10001920 Ga0207686_100019207 254
341 3300025935 Ga0207709_10000432 Ga0207709_1000043212 254
342 3300025938 Ga0207704_10000032 Ga0207704_1000003274 254
343 3300025938 Ga0207704_10179440 Ga0207704_101794403 254
344 3300025940 Ga0207691_10073708 Ga0207691_100737082 254
345 3300025942 Ga0207689_10008114 Ga0207689_1000811410 254
346 3300025949 Ga0207667_10000013 Ga0207667_1000001339 254
347 3300025960 Ga0207651_10000001 Ga0207651_10000001363 254
348 3300025981 Ga0207640_10000050 Ga0207640_1000005070 254
349 3300025981 Ga0207640_10084174 Ga0207640_100841742 254
350 3300026023 Ga0207677_10001163 Ga0207677_100011632 254
351 3300026041 Ga0207639_10003659 Ga0207639_100036598 254
352 3300026041 Ga0207639_10205081 Ga0207639_102050812 254
353 3300026067 Ga0207678_10021977 Ga0207678_100219775 254
354 3300026078 Ga0207702_10114116 Ga0207702_101141164 254
355 3300026089 Ga0207648_10001195 Ga0207648_1000119513 254
356 3300026121 Ga0207683_10004967 Ga0207683_100049677 254
357 3300026142 Ga0207698_10000551 Ga0207698_1000055120 254
358 3300037471 Ga0395905_0016001 Ga0395905_0016001_1914_2678 254
359 3300037471 Ga0395905_0030594 Ga0395905_0030594_4262_5026 254
360 3300037471 Ga0395905_0584614 Ga0395905_0584614_244_1008 254
361 3300044658 Ga0466972_0010998 Ga0466972_0010998_3325_4089 254
362 3300044658 Ga0466972_0019619 Ga0466972_0019619_1664_2428 254
363 3300044683 Ga0466965_0069761 Ga0466965_0069761_881_1645 254
364 3300044693 Ga0466961_0002427 Ga0466961_0002427_8441_9205 254
365 3300044693 Ga0466961_0151817 Ga0466961_0151817_346_1110 254
366 3300044765 Ga0466970_0010891 Ga0466970_0010891_2100_2864 254
367 3300044842 Ga0466957_0131832 Ga0466957_0131832_159_923 254
368 3300044901 Ga0466960_0002678 Ga0466960_0002678_2304_3068 254
369 3300045049 Ga0466959_0000595 Ga0466959_0000595_6179_6943 254
370 3300045836 Ga0466958_0090108 Ga0466958_0090108_547_1311 254
371 3300045836 Ga0466958_0095266 Ga0466958_0095266_641_1405 254
372 3300046506 Ga0495583_0002224 Ga0495583_0002224_3433_4200 254
373 3300046507 Ga0495606_0008930 Ga0495606_0008930_1018_1782 254
374 3300047472 Ga0495686_0000149 Ga0495686_0000149_94038_94802 254
375 3300047472 Ga0495686_0246744 Ga0495686_0246744_47_811 254
376 3300048920 Ga0496117_0066120 Ga0496117_0066120_524_1288 254
377 3300048921 Ga0496118_0038779 Ga0496118_0038779_2251_3015 254
378 3300049460 Ga0495682_0052089 Ga0495682_0052089_97_864 254
379 3300053103 Ga0500555_000444 Ga0500555_000444_12913_13680 254
380 3300061719 Ga0466962_0008633 Ga0466962_0008633_2777_3541 254
381 3300061719 Ga0466962_0158351 Ga0466962_0158351_221_985 254
382 3300061719 Ga0466962_0182140 Ga0466962_0182140_59_823 254
383 iso_pu_bacteria 2643221588 2643950309 254
384 3300031995 Ga0307409_100135470 Ga0307409_1001354702 255
385 iso_pu_bacteria 2896253425 2896254590 255
386 3300036712 Ga0316584_0116543 Ga0316584_0116543_203_979 256
387 3300003911 JGI25405J52794_10003443 JGI25405J52794_100034433 257
388 3300005344 Ga0070661_100123609 Ga0070661_1001236092 257
389 3300005366 Ga0070659_100017522 Ga0070659_1000175224 257
390 3300005366 Ga0070659_100021216 Ga0070659_1000212164 257
391 3300005435 Ga0070714_100262029 Ga0070714_1002620292 257
392 3300005457 Ga0070662_100002436 Ga0070662_1000024363 257
393 3300005457 Ga0070662_100009003 Ga0070662_1000090036 257
394 3300005530 Ga0070679_100008282 Ga0070679_10000828212 257
395 3300005539 Ga0068853_100018932 Ga0068853_1000189326 257
396 3300005563 Ga0068855_100014816 Ga0068855_1000148168 257
397 3300005563 Ga0068855_100034440 Ga0068855_1000344407 257
398 3300005564 Ga0070664_100011340 Ga0070664_1000113402 257
399 3300005564 Ga0070664_100013946 Ga0070664_1000139468 257
400 3300005577 Ga0068857_100051510 Ga0068857_1000515103 257
401 3300005577 Ga0068857_100502939 Ga0068857_1005029391 257
402 3300005578 Ga0068854_100013863 Ga0068854_1000138633 257
403 3300005614 Ga0068856_100033420 Ga0068856_1000334203 257
404 3300005937 Ga0081455_10002546 Ga0081455_1000254615 257
405 3300011119 Ga0105246_10000632 Ga0105246_1000063214 257
406 3300013100 Ga0157373_10003358 Ga0157373_1000335811 257
407 3300013102 Ga0157371_10003665 Ga0157371_1000366515 257
408 3300013102 Ga0157371_10148248 Ga0157371_101482482 257
409 3300013104 Ga0157370_10027202 Ga0157370_100272026 257
410 3300013105 Ga0157369_10049579 Ga0157369_100495793 257
411 3300013307 Ga0157372_10215277 Ga0157372_102152772 257
412 3300013307 Ga0157372_10321430 Ga0157372_103214302 257
413 3300025909 Ga0207705_10009458 Ga0207705_100094582 257
414 3300025912 Ga0207707_10026421 Ga0207707_100264216 257
415 3300025917 Ga0207660_10089146 Ga0207660_100891463 257
416 3300025919 Ga0207657_10000408 Ga0207657_1000040842 257
417 3300025920 Ga0207649_10005456 Ga0207649_100054562 257
418 3300025921 Ga0207652_10251142 Ga0207652_102511422 257
419 3300025921 Ga0207652_10328239 Ga0207652_103282392 257
420 3300025929 Ga0207664_10284302 Ga0207664_102843022 257
421 3300025932 Ga0207690_10013220 Ga0207690_100132203 257
422 3300025932 Ga0207690_10049134 Ga0207690_100491343 257
423 3300025933 Ga0207706_10004237 Ga0207706_100042372 257
424 3300025933 Ga0207706_10017165 Ga0207706_100171657 257
425 3300025944 Ga0207661_10120942 Ga0207661_101209423 257
426 3300025949 Ga0207667_10047477 Ga0207667_100474775 257
427 3300025949 Ga0207667_10088539 Ga0207667_100885392 257
428 3300026041 Ga0207639_10005117 Ga0207639_100051178 257
429 3300026116 Ga0207674_10003143 Ga0207674_100031433 257
430 3300026116 Ga0207674_10063616 Ga0207674_100636163 257
431 3300026121 Ga0207683_10268557 Ga0207683_102685572 257
432 3300031548 Ga0307408_100024384 Ga0307408_1000243844 257
433 3300031824 Ga0307413_10033283 Ga0307413_100332834 257
434 3300031901 Ga0307406_10101318 Ga0307406_101013183 257
435 3300032002 Ga0307416_100018666 Ga0307416_1000186664 257
436 3300032004 Ga0307414_10320199 Ga0307414_103201991 257
437 3300032005 Ga0307411_10067422 Ga0307411_100674223 257
438 3300049572 Ga0501036_0612885 Ga0501036_0612885_53_844 257
439 iso_pu_bacteria 2808606401 2809062205 257
440 iso_pu_bacteria 2808606404 2809078455 257
441 iso_pu_bacteria 2808606405 2809082594 257
442 iso_pu_bacteria 2880518877 2880518988 257
443 iso_pu_bacteria 2919709256 2919711732 257
444 3300005347 Ga0070668_100000739 Ga0070668_10000073920 258
445 3300005367 Ga0070667_100000162 Ga0070667_10000016268 258
446 3300005841 Ga0068863_100000047 Ga0068863_1000000475 258
447 3300005843 Ga0068860_100008267 Ga0068860_1000082675 258
448 3300005844 Ga0068862_100924121 Ga0068862_1009241211 258
449 3300028380 Ga0268265_10892249 Ga0268265_108922491 258
450 3300031852 Ga0307410_10093588 Ga0307410_100935882 258
451 3300031995 Ga0307409_100412705 Ga0307409_1004127052 258
452 3300046460 Ga0495638_0000011 Ga0495638_0000011_366088_366864 258
453 3300046471 Ga0495650_0006527 Ga0495650_0006527_520_1299 258
454 3300046471 Ga0495650_0049726 Ga0495650_0049726_797_1573 258
455 3300046506 Ga0495583_0000305 Ga0495583_0000305_17990_18766 258
456 3300046513 Ga0495616_0000018 Ga0495616_0000018_156419_157195 258
457 3300046519 Ga0495632_0000538 Ga0495632_0000538_31599_32375 258
458 3300046524 Ga0495648_0000023 Ga0495648_0000023_163808_164584 258
459 3300046558 Ga0495633_0038543 Ga0495633_0038543_1165_1941 258
460 3300046616 Ga0495668_0014245 Ga0495668_0014245_2201_2977 258
461 3300046692 Ga0495671_0000012 Ga0495671_0000012_68773_69549 258
462 3300047469 Ga0495673_0000029 Ga0495673_0000029_289084_289860 258
463 3300053087 Ga0500643_000081 Ga0500643_000081_84816_85595 258
464 3300053136 Ga0500559_0068599 Ga0500559_0068599_72_848 258
465 3300053158 Ga0500627_0002055 Ga0500627_0002055_4257_5033 258
466 3300055283 Ga0500661_000082 Ga0500661_000082_12640_13419 258
467 iso_pu_bacteria 2896184354 2896186827 258
468 3300001976 JGI24752J21851_1001572 JGI24752J21851_10015724 259
469 3300002070 JGI24750J21931_1010742 JGI24750J21931_10107422 259
470 3300002459 JGI24751J29686_10007032 JGI24751J29686_100070322 259
471 3300005331 Ga0070670_100042123 Ga0070670_1000421233 259
472 3300005335 Ga0070666_10000063 Ga0070666_1000006343 259
473 3300005347 Ga0070668_100013413 Ga0070668_1000134132 259
474 3300005353 Ga0070669_100000042 Ga0070669_100000042104 259
475 3300005355 Ga0070671_100000002 Ga0070671_10000000237 259
476 3300005367 Ga0070667_100035266 Ga0070667_1000352665 259
477 3300005544 Ga0070686_100160416 Ga0070686_1001604162 259
478 3300005577 Ga0068857_100056170 Ga0068857_1000561703 259
479 3300005617 Ga0068859_100002597 Ga0068859_1000025975 259
480 3300005618 Ga0068864_100000731 Ga0068864_10000073123 259
481 3300005719 Ga0068861_100000148 Ga0068861_10000014812 259
482 3300005841 Ga0068863_100014281 Ga0068863_1000142816 259
483 3300005842 Ga0068858_100000588 Ga0068858_10000058815 259
484 3300005843 Ga0068860_100036289 Ga0068860_1000362893 259
485 3300005844 Ga0068862_100007384 Ga0068862_1000073848 259
486 3300006931 Ga0097620_100002597 Ga0097620_1000025975 259
487 3300009101 Ga0105247_10001115 Ga0105247_1000111512 259
488 3300009177 Ga0105248_10019155 Ga0105248_100191553 259
489 3300009553 Ga0105249_10129922 Ga0105249_101299223 259
490 3300013306 Ga0163162_10025996 Ga0163162_100259967 259
491 3300025315 Ga0207697_10000130 Ga0207697_1000013030 259
492 3300025900 Ga0207710_10008193 Ga0207710_100081932 259
493 3300025903 Ga0207680_10000033 Ga0207680_100000339 259
494 3300025923 Ga0207681_10000002 Ga0207681_10000002423 259
495 3300025925 Ga0207650_10097313 Ga0207650_100973133 259
496 3300025931 Ga0207644_10000002 Ga0207644_10000002428 259
497 3300025961 Ga0207712_10001860 Ga0207712_100018606 259
498 3300025986 Ga0207658_10017969 Ga0207658_100179696 259
499 3300026088 Ga0207641_10019831 Ga0207641_100198313 259
500 3300026095 Ga0207676_10000705 Ga0207676_100007056 259
501 3300026116 Ga0207674_10059376 Ga0207674_100593763 259
502 3300026116 Ga0207674_10088996 Ga0207674_100889963 259
503 3300026118 Ga0207675_100000355 Ga0207675_10000035530 259
504 3300028380 Ga0268265_10000361 Ga0268265_1000036112 259
505 3300028381 Ga0268264_10000116 Ga0268264_1000011639 259
506 3300031911 Ga0307412_10086127 Ga0307412_100861273 259
507 3300032004 Ga0307414_10001891 Ga0307414_100018918 259
508 3300046616 Ga0495668_0173497 Ga0495668_0173497_174_953 259
509 3300046660 Ga0495625_0003788 Ga0495625_0003788_8840_9619 259
510 3300046692 Ga0495671_0007760 Ga0495671_0007760_4651_5442 259
511 3300048905 Ga0496102_0123199 Ga0496102_0123199_574_1353 259
512 3300048925 Ga0496122_0000970 Ga0496122_0000970_15375_16154 259
513 3300048926 Ga0496123_0000286 Ga0496123_0000286_35395_36174 259
514 3300053087 Ga0500643_000306 Ga0500643_000306_22408_23187 259
515 3300053087 Ga0500643_024242 Ga0500643_024242_179_958 259
516 3300053104 Ga0500556_0000074 Ga0500556_0000074_51529_52308 259
517 3300053118 Ga0500594_0024835 Ga0500594_0024835_90_881 259
518 3300053122 Ga0500608_007974 Ga0500608_007974_1113_1892 259
519 3300053130 Ga0500642_0000002 Ga0500642_0000002_543786_544565 259
520 3300053730 Ga0500645_000439 Ga0500645_000439_4299_5078 259
521 iso_pu_bacteria 2775507255 2778123872 259
522 3300014326 Ga0157380_10259177 Ga0157380_102591772 260
523 3300006042 Ga0075368_10000252 Ga0075368_100002527 261
524 3300006048 Ga0075363_100052875 Ga0075363_1000528752 261
525 3300006178 Ga0075367_10000054 Ga0075367_1000005422 261
526 3300006353 Ga0075370_10006098 Ga0075370_100060984 261
527 3300025229 Ga0209147_100491 Ga0209147_10049110 261
528 3300027866 Ga0209813_10000063 Ga0209813_1000006339 261
529 3300046453 Ga0495627_000478 Ga0495627_000478_21473_22258 261
530 3300046524 Ga0495648_0009282 Ga0495648_0009282_4991_5776 261
531 3300046558 Ga0495633_0011568 Ga0495633_0011568_795_1580 261
532 3300046558 Ga0495633_0044808 Ga0495633_0044808_624_1409 261
533 3300048927 Ga0496124_0070937 Ga0496124_0070937_1944_2729 261
534 3300050490 nmdc:mga03n38_46054_c1 nmdc:mga03n38_46054_c1_534_1319 261
535 3300050494 nmdc:mga06z11_27_c1 nmdc:mga06z11_27_c1_39819_40604 261
536 3300050495 nmdc:mga04h51_147_c1 nmdc:mga04h51_147_c1_8002_8787 261
537 3300050496 nmdc:mga07m45_18564_c1 nmdc:mga07m45_18564_c1_2326_3111 261
538 3300053108 Ga0500562_024231 Ga0500562_024231_584_1369 261
539 3300053157 Ga0500624_000053 Ga0500624_000053_12623_13408 261
540 iso_pu_bacteria 2512564014 2512644701 261
541 3300025981 Ga0207640_10278503 Ga0207640_102785032 262
542 2162886007 SwRhRL2b_contig_2794509 SwRhRL2b_0850.00004100 263
543 3300001915 JGI24741J21665_1005221 JGI24741J21665_10052213 263
544 3300001979 JGI24740J21852_10001016 JGI24740J21852_100010163 263
545 3300001989 JGI24739J22299_10038747 JGI24739J22299_100387472 263
546 3300001990 JGI24737J22298_10050336 JGI24737J22298_100503361 263
547 3300002067 JGI24735J21928_10004916 JGI24735J21928_100049165 263
548 3300005289 Ga0065704_10072077 Ga0065704_100720775 263
549 3300005339 Ga0070660_100217734 Ga0070660_1002177341 263
550 3300005344 Ga0070661_100042406 Ga0070661_1000424063 263
551 3300005347 Ga0070668_100088273 Ga0070668_1000882733 263
552 3300005355 Ga0070671_100182742 Ga0070671_1001827421 263
553 3300005455 Ga0070663_100013894 Ga0070663_1000138945 263
554 3300005539 Ga0068853_100364157 Ga0068853_1003641572 263
555 3300005548 Ga0070665_100105320 Ga0070665_1001053203 263
556 3300005563 Ga0068855_100299424 Ga0068855_1002994242 263
557 3300005564 Ga0070664_100025320 Ga0070664_1000253202 263
558 3300005577 Ga0068857_100283789 Ga0068857_1002837891 263
559 3300005578 Ga0068854_100114825 Ga0068854_1001148251 263
560 3300005834 Ga0068851_10012072 Ga0068851_100120725 263
561 3300009011 Ga0105251_10015352 Ga0105251_100153522 263
562 3300009093 Ga0105240_10043982 Ga0105240_100439823 263
563 3300009174 Ga0105241_10002409 Ga0105241_100024096 263
564 3300009545 Ga0105237_10016910 Ga0105237_100169107 263
565 3300009551 Ga0105238_10210877 Ga0105238_102108772 263
566 3300009553 Ga0105249_10321312 Ga0105249_103213122 263
567 3300013100 Ga0157373_10024990 Ga0157373_100249902 263
568 3300013104 Ga0157370_10031556 Ga0157370_100315565 263
569 3300013307 Ga0157372_10597749 Ga0157372_105977492 263
570 3300017792 Ga0163161_10033177 Ga0163161_100331772 263
571 3300020070 Ga0206356_10706515 Ga0206356_107065152 263
572 3300025904 Ga0207647_10008063 Ga0207647_100080635 263
573 3300025913 Ga0207695_10136608 Ga0207695_101366082 263
574 3300025919 Ga0207657_10138453 Ga0207657_101384531 263
575 3300025920 Ga0207649_10112409 Ga0207649_101124093 263
576 3300025924 Ga0207694_10153631 Ga0207694_101536313 263
577 3300025933 Ga0207706_10016251 Ga0207706_100162519 263
578 3300025949 Ga0207667_10266992 Ga0207667_102669923 263
579 3300025981 Ga0207640_10192816 Ga0207640_101928163 263
580 3300026041 Ga0207639_10000138 Ga0207639_1000013825 263
581 3300026067 Ga0207678_10002459 Ga0207678_100024599 263
582 3300026078 Ga0207702_10010000 Ga0207702_100100003 263
583 3300026116 Ga0207674_10018492 Ga0207674_1001849210 263
584 3300026142 Ga0207698_10179648 Ga0207698_101796483 263
585 3300031852 Ga0307410_10125478 Ga0307410_101254783 263
586 3300031901 Ga0307406_10179361 Ga0307406_101793611 263
587 3300031911 Ga0307412_10023565 Ga0307412_100235653 263
588 3300031911 Ga0307412_10186843 Ga0307412_101868432 263
589 3300031995 Ga0307409_100736415 Ga0307409_1007364151 263
590 3300032004 Ga0307414_10112675 Ga0307414_101126751 263
591 3300032005 Ga0307411_10551386 Ga0307411_105513862 263
592 3300046453 Ga0495627_000193 Ga0495627_000193_53459_54250 263
593 3300046512 Ga0495610_0001092 Ga0495610_0001092_2823_3614 263
594 3300046519 Ga0495632_0000042 Ga0495632_0000042_52796_53587 263
595 3300046520 Ga0495637_0000626 Ga0495637_0000626_14349_15140 263
596 3300046520 Ga0495637_0020613 Ga0495637_0020613_527_1318 263
597 3300046522 Ga0495643_0000005 Ga0495643_0000005_389533_390324 263
598 3300046525 Ga0495663_0000015 Ga0495663_0000015_91599_92390 263
599 3300046558 Ga0495633_0000197 Ga0495633_0000197_18979_19770 263
600 3300046558 Ga0495633_0000262 Ga0495633_0000262_52796_53587 263
601 3300046692 Ga0495671_0000007 Ga0495671_0000007_389467_390258 263
602 3300047320 Ga0495672_0227828 Ga0495672_0227828_60_851 263
603 3300047470 Ga0495681_0000032 Ga0495681_0000032_51454_52245 263
604 3300047472 Ga0495686_0008478 Ga0495686_0008478_1069_1860 263
605 3300047472 Ga0495686_0022254 Ga0495686_0022254_2903_3694 263
606 3300048911 Ga0496108_0018131 Ga0496108_0018131_878_1669 263
607 3300048913 Ga0496110_0069636 Ga0496110_0069636_592_1383 263
608 3300048919 Ga0496116_0059042 Ga0496116_0059042_117_908 263
609 3300048924 Ga0496121_0000208 Ga0496121_0000208_44991_45782 263
610 3300048925 Ga0496122_0049081 Ga0496122_0049081_1925_2716 263
611 3300048927 Ga0496124_0027789 Ga0496124_0027789_1562_2353 263
612 3300048927 Ga0496124_0054093 Ga0496124_0054093_777_1568 263
613 3300048928 Ga0496125_0022011 Ga0496125_0022011_4259_5050 263
614 3300049459 Ga0495678_029037 Ga0495678_029037_552_1343 263
615 3300049551 Ga0501335_000124 Ga0501335_000124_1461_2252 263
616 3300049669 Ga0501235_001136 Ga0501235_001136_944_1735 263
617 3300049670 Ga0501236_021268 Ga0501236_021268_157_948 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

97

266

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.8819 19 220
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.8752 19 218
2goy-assembly2.cif.gz_E crystal structure of assimilatory adenosine 5'-phosphosulfate reductase with bound aps 0.8737 17 230
7lhu-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.8723 19 220
1sur-assembly1.cif.gz_A-2 phospho-adenylyl-sulfate reductase 0.8667 17 212
ID Description Score Start End Superfamily
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8737 17 230 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8684 17 212 3.40.50.620
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8526 19 243 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8407 17 230 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.818 17 239 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A5R2N3D8-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9533 62 224 GO:0004604
GO:0005737
GO:0019379
AF-A0A436FC25-F1-model_v4 deleted 0.9442 19 220
AF-A0A5R2N3D8-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9365 62 224 GO:0004604
GO:0005737
GO:0019379
AF-A0A3D2F615-F1-model_v4 Phosphoadenylyl-sulfate reductase 0.9314 19 225 GO:0004604
GO:0005737
GO:0019379
AF-A0A2A4LKB0-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9309 18 240 GO:0004604
GO:0005737
GO:0019379
GO:0043866
GO:0046872
GO:0051539
GO:0070814

Feature Viewer

pLDDT pTM Quality
80.56 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map