F469594

General Info

Members Datasets Scaffolds Average Seq Length
616 321 581 229

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606372|2808900363
Length 256
Sequence GVPPIAHGGGPASRGRPEFEPPVRAQAATAADRPGILRPMPATSPAIEDYLKTVYAHTEWQPDAITPKVLADRLGVAPSSVTEMVKKMAAAGLVSHVPYGAVRLTADGTAEALAVVRRHRLIETWLVQEMGYGWDEVHDEAEILEHAISDRLLEAIDARLGRPVRDPHGDPIPRSDGTLERRPTLLLAEASPGHSGAVVRISDRDPGVLRALDEAGIGLDAELTVTDVAAASVDVTIGSRAHTLPRAAAEVIWVTA

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221597 Microbacterium sp. Root180 Isolate Unclassified
5 2643221619 Agromyces sp. Root81 Isolate Unclassified
6 2643221630 Microbacterium sp. Root322 Isolate Unclassified
7 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
8 2643221649 Leifsonia sp. Root4 Isolate Unclassified
9 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
10 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
11 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
12 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
13 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
14 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
15 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
16 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
17 2808606372 Agromyces sp. 23-23 Isolate Unclassified
18 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
19 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
20 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
21 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
22 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
23 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
24 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
25 2919395869 Microbacterium resistens 2980 Isolate Unclassified
26 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
27 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
28 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
29 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
30 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
31 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
32 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
33 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
34 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
37 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
38 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
39 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
213 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
214 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
215 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
216 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
217 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
218 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
219 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
302 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
310 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
313 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
314 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
315 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
321 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 0
Isolates 5.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 8.28
Nodule 0.16
Rhizoplane 12.66
Rhizosphere 65.91
Stem 0
Stem Tuber 0
Unclassified 12.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1007734 3300001977 Bacteria 1636
2 JGI24739J22299_10085623 3300001989 Bacteria 963
3 JGI24750J21931_1001193 3300002070 Bacteria 3313
4 JGI24744J21845_10002079 3300002077 Bacteria 4059
5 JGI24744J21845_10007863 3300002077 Bacteria 2202
6 JGI24034J26672_10013415 3300002239 Bacteria 1243
7 JGI24742J22300_10000911 3300002244 Bacteria 4514
8 JGI24742J22300_10032469 3300002244 Bacteria 915
9 Ga0055540_1000029 3300003792 Bacteria 179894
10 Ga0055540_1002534 3300003792 Bacteria 9539
11 Ga0055540_1003364 3300003792 Bacteria 7756
12 Ga0055540_1015764 3300003792 Bacteria 2181
13 Ga0070676_10061696 3300005328 Bacteria 2228
14 Ga0070683_100146586 3300005329 Bacteria 2237
15 Ga0068869_100205057 3300005334 Bacteria 1556
16 Ga0070666_10052854 3300005335 Bacteria 2739
17 Ga0070666_10202667 3300005335 Bacteria 1396
18 Ga0070666_10225083 3300005335 Bacteria 1324
19 Ga0070682_100015442 3300005337 Bacteria 4425
20 Ga0070682_100029056 3300005337 Bacteria 3328
21 Ga0068868_100001612 3300005338 Bacteria 15394
22 Ga0070689_100030572 3300005340 Bacteria 4089
23 Ga0070691_10014157 3300005341 Bacteria 3658
24 Ga0070668_100011834 3300005347 Bacteria 6500
25 Ga0070668_100022683 3300005347 Bacteria 4746
26 Ga0070668_100135030 3300005347 Bacteria 1983
27 Ga0070668_100208673 3300005347 Bacteria 1606
28 Ga0070668_100534600 3300005347 Bacteria 1018
29 Ga0070675_100128870 3300005354 Bacteria 2154
30 Ga0070674_100002940 3300005356 Bacteria 9445
31 Ga0070674_100065393 3300005356 Bacteria 2552
32 Ga0070673_100091600 3300005364 Bacteria 2485
33 Ga0070688_100032775 3300005365 Bacteria 3136
34 Ga0070659_100086836 3300005366 Bacteria 2504
35 Ga0070667_100000630 3300005367 Bacteria 34283
36 Ga0070667_100000831 3300005367 Bacteria 28698
37 Ga0070667_100046633 3300005367 Bacteria 3646
38 Ga0070667_100268632 3300005367 Bacteria 1529
39 Ga0070709_10011706 3300005434 Bacteria 4898
40 Ga0070709_10086658 3300005434 Bacteria 2056
41 Ga0070714_100213327 3300005435 Bacteria 1770
42 Ga0070714_100663178 3300005435 Bacteria 1005
43 Ga0070710_10001814 3300005437 Bacteria 10084
44 Ga0070710_10030703 3300005437 Bacteria 2893
45 Ga0070711_100004140 3300005439 Bacteria 8526
46 Ga0070711_100021930 3300005439 Bacteria 4133
47 Ga0070705_100033952 3300005440 Bacteria 2848
48 Ga0070700_100010917 3300005441 Bacteria 5023
49 Ga0070694_100287910 3300005444 Bacteria 1255
50 Ga0070663_100063385 3300005455 Bacteria 2669
51 Ga0070663_100416063 3300005455 Bacteria 1102
52 Ga0070678_100028925 3300005456 Bacteria 3787
53 Ga0070678_100095400 3300005456 Bacteria 2292
54 Ga0070678_100296246 3300005456 Bacteria 1373
55 Ga0070662_100043124 3300005457 Bacteria 3226
56 Ga0070681_10725468 3300005458 Bacteria 910
57 Ga0068867_100133741 3300005459 Bacteria 1930
58 Ga0070685_10046240 3300005466 Bacteria 2498
59 Ga0068853_100024683 3300005539 Bacteria 5042
60 Ga0068853_100050178 3300005539 Bacteria 3589
61 Ga0070695_100055867 3300005545 Bacteria 2546
62 Ga0070695_100405504 3300005545 Bacteria 1034
63 Ga0070696_100024989 3300005546 Bacteria 4060
64 Ga0070693_100067435 3300005547 Bacteria 2097
65 Ga0070665_100003013 3300005548 Bacteria 18167
66 Ga0070665_100008244 3300005548 Bacteria 10544
67 Ga0070665_100027844 3300005548 Bacteria 5691
68 Ga0070665_100075491 3300005548 Bacteria 3378
69 Ga0070704_100002135 3300005549 Bacteria 11006
70 Ga0070704_100033410 3300005549 Bacteria 3477
71 Ga0070704_100181471 3300005549 Bacteria 1684
72 Ga0070664_100125355 3300005564 Bacteria 2252
73 Ga0068854_100000630 3300005578 Bacteria 20862
74 Ga0068854_100090814 3300005578 Bacteria 2272
75 Ga0068854_100134966 3300005578 Bacteria 1888
76 Ga0068856_100160713 3300005614 Bacteria 2257
77 Ga0070702_100000790 3300005615 Bacteria 12044
78 Ga0070702_100206733 3300005615 Bacteria 1303
79 Ga0068852_100061558 3300005616 Bacteria 3262
80 Ga0068852_100168042 3300005616 Bacteria 2054
81 Ga0068859_100005238 3300005617 Bacteria 13175
82 Ga0068859_100011242 3300005617 Bacteria 9005
83 Ga0068859_100072360 3300005617 Bacteria 3484
84 Ga0068859_100891845 3300005617 Bacteria 974
85 Ga0068864_100368031 3300005618 Bacteria 1360
86 Ga0068866_10007220 3300005718 Bacteria 4648
87 Ga0068861_100002991 3300005719 Bacteria 11156
88 Ga0068861_100757340 3300005719 Bacteria 908
89 Ga0068863_100001801 3300005841 Bacteria 21265
90 Ga0068863_100035405 3300005841 Bacteria 4755
91 Ga0068863_100416546 3300005841 Bacteria 1316
92 Ga0068858_100037254 3300005842 Bacteria 4509
93 Ga0068858_100200083 3300005842 Bacteria 1889
94 Ga0068858_100220055 3300005842 Bacteria 1798
95 Ga0068860_100000231 3300005843 Bacteria 86110
96 Ga0068860_100002676 3300005843 Bacteria 18553
97 Ga0068860_100052794 3300005843 Bacteria 3865
98 Ga0068862_100000060 3300005844 Bacteria 133781
99 Ga0068862_100005303 3300005844 Bacteria 10802
100 Ga0075365_10002478 3300006038 Bacteria 9075
101 Ga0075365_10008621 3300006038 Bacteria 5806
102 Ga0075365_10031963 3300006038 Bacteria 3380
103 Ga0075365_10086747 3300006038 Bacteria 2127
104 Ga0075363_100002167 3300006048 Bacteria 7901
105 Ga0075363_100031886 3300006048 Bacteria 2734
106 Ga0075363_100047914 3300006048 Bacteria 2271
107 Ga0075364_10001593 3300006051 Bacteria 12402
108 Ga0075364_10028730 3300006051 Bacteria 3561
109 Ga0075364_10117578 3300006051 Bacteria 1778
110 Ga0070715_10001473 3300006163 Bacteria 6844
111 Ga0070716_100003182 3300006173 Bacteria 7691
112 Ga0070716_100013912 3300006173 Bacteria 4112
113 Ga0070712_100042742 3300006175 Bacteria 3117
114 Ga0075362_10003816 3300006177 Bacteria 5342
115 Ga0075367_10007733 3300006178 Bacteria 5526
116 Ga0075369_10000862 3300006186 Bacteria 10038
117 Ga0075369_10002150 3300006186 Bacteria 6959
118 Ga0075369_10038054 3300006186 Bacteria 2051
119 Ga0097621_100433321 3300006237 Bacteria 1182
120 Ga0075370_10006244 3300006353 Bacteria 5979
121 Ga0075370_10007350 3300006353 Bacteria 5606
122 Ga0068871_100149084 3300006358 Bacteria 1994
123 Ga0075428_100014477 3300006844 Bacteria 8760
124 Ga0075430_100234431 3300006846 Bacteria 1521
125 Ga0075431_100054720 3300006847 Bacteria 4115
126 Ga0097620_100005238 3300006931 Bacteria 13175
127 Ga0097620_100011242 3300006931 Bacteria 9005
128 Ga0097620_100072357 3300006931 Bacteria 3484
129 Ga0097620_100891894 3300006931 Bacteria 974
130 Ga0099795_10042009 3300007788 Bacteria 1630
131 Ga0105244_10069180 3300009036 Bacteria 1763
132 Ga0105250_10033787 3300009092 Bacteria 2053
133 Ga0105250_10126648 3300009092 Bacteria 1052
134 Ga0105250_10207429 3300009092 Bacteria 828
135 Ga0111539_10466556 3300009094 Bacteria 1470
136 Ga0105245_10304822 3300009098 Bacteria 1564
137 Ga0105245_10419384 3300009098 Bacteria 1341
138 Ga0105247_10000058 3300009101 Bacteria 131442
139 Ga0105247_10000570 3300009101 Bacteria 30023
140 Ga0105247_10030307 3300009101 Bacteria 3278
141 Ga0105247_10128028 3300009101 Bacteria 1652
142 Ga0114129_10041263 3300009147 Bacteria 6503
143 Ga0114129_10366563 3300009147 Bacteria 1905
144 Ga0105243_10001753 3300009148 Bacteria 18673
145 Ga0105241_10463878 3300009174 Bacteria 1123
146 Ga0105242_10000909 3300009176 Bacteria 23018
147 Ga0105242_10314795 3300009176 Bacteria 1434
148 Ga0105242_10582979 3300009176 Bacteria 1077
149 Ga0105248_10000325 3300009177 Bacteria 56490
150 Ga0105248_10010646 3300009177 Bacteria 10143
151 Ga0105248_10155227 3300009177 Bacteria 2583
152 Ga0105248_10459240 3300009177 Bacteria 1436
153 Ga0105248_10514539 3300009177 Bacteria 1350
154 Ga0105237_10008410 3300009545 Bacteria 11180
155 Ga0105237_10033885 3300009545 Bacteria 5174
156 Ga0105237_10270874 3300009545 Bacteria 1701
157 Ga0105238_10109994 3300009551 Bacteria 2737
158 Ga0105249_10000087 3300009553 Bacteria 131590
159 Ga0105249_10001452 3300009553 Bacteria 20756
160 Ga0105249_10179896 3300009553 Bacteria 2057
161 Ga0099796_10048894 3300010159 Bacteria 1460
162 Ga0105239_10004193 3300010375 Bacteria 17314
163 Ga0105239_10006534 3300010375 Bacteria 13508
164 Ga0105239_10051721 3300010375 Bacteria 4503
165 Ga0105246_10070110 3300011119 Bacteria 2464
166 Ga0157371_10194850 3300013102 Bacteria 1451
167 Ga0157369_10935180 3300013105 Bacteria 888
168 Ga0171462_1002 3300013250 Bacteria 1052134
169 Ga0157374_10078134 3300013296 Bacteria 3134
170 Ga0157378_10000869 3300013297 Bacteria 27899
171 Ga0157378_10143708 3300013297 Bacteria 2218
172 Ga0163162_10025393 3300013306 Bacteria 5853
173 Ga0163162_10058625 3300013306 Bacteria 3880
174 Ga0163162_10412549 3300013306 Bacteria 1483
175 Ga0157372_10021535 3300013307 Bacteria 6966
176 Ga0157372_10260324 3300013307 Bacteria 2014
177 Ga0157375_10079810 3300013308 Bacteria 3309
178 Ga0163163_10002753 3300014325 Bacteria 14829
179 Ga0157380_10272803 3300014326 Bacteria 1543
180 Ga0157377_10050566 3300014745 Bacteria 2341
181 Ga0157379_10008443 3300014968 Bacteria 8955
182 Ga0157379_10253320 3300014968 Bacteria 1598
183 Ga0157376_10374191 3300014969 Bacteria 1370
184 Ga0163161_10005171 3300017792 Bacteria 9075
185 Ga0213876_10009186 3300021384 Bacteria 5323
186 Ga0209646_1000014 3300025246 Bacteria 550484
187 Ga0209051_1000042 3300025303 Bacteria 308486
188 Ga0209051_1000581 3300025303 Bacteria 43508
189 Ga0209051_1010244 3300025303 Bacteria 4757
190 Ga0209051_1025671 3300025303 Bacteria 2391
191 Ga0209051_1045594 3300025303 Bacteria 1516
192 Ga0207696_1032663 3300025711 Bacteria 1565
193 Ga0207692_10000814 3300025898 Bacteria 11143
194 Ga0207692_10070552 3300025898 Bacteria 1839
195 Ga0207642_10000644 3300025899 Bacteria 10712
196 Ga0207710_10000085 3300025900 Bacteria 131447
197 Ga0207688_10001946 3300025901 Bacteria 11061
198 Ga0207688_10006102 3300025901 Bacteria 6554
199 Ga0207680_10098755 3300025903 Bacteria 1872
200 Ga0207647_10086182 3300025904 Bacteria 1877
201 Ga0207685_10001708 3300025905 Bacteria 4751
202 Ga0207699_10085912 3300025906 Bacteria 1963
203 Ga0207645_10053987 3300025907 Bacteria 2567
204 Ga0207645_10060293 3300025907 Bacteria 2422
205 Ga0207705_10504232 3300025909 Bacteria 940
206 Ga0207671_10008558 3300025914 Bacteria 8657
207 Ga0207693_10001502 3300025915 Bacteria 20587
208 Ga0207663_10001892 3300025916 Bacteria 9898
209 Ga0207662_10088083 3300025918 Bacteria 1906
210 Ga0207657_10195782 3300025919 Bacteria 1628
211 Ga0207652_10660812 3300025921 Bacteria 934
212 Ga0207681_10004313 3300025923 Bacteria 8781
213 Ga0207694_10098702 3300025924 Bacteria 2313
214 Ga0207650_10307173 3300025925 Bacteria 1297
215 Ga0207659_10135336 3300025926 Bacteria 1907
216 Ga0207687_10001805 3300025927 Bacteria 14728
217 Ga0207687_10097814 3300025927 Bacteria 2154
218 Ga0207687_10348566 3300025927 Bacteria 1206
219 Ga0207664_10182481 3300025929 Bacteria 1802
220 Ga0207644_10067164 3300025931 Bacteria 2613
221 Ga0207690_10081976 3300025932 Bacteria 2255
222 Ga0207690_10433789 3300025932 Bacteria 1053
223 Ga0207686_10313465 3300025934 Bacteria 1169
224 Ga0207709_10003346 3300025935 Bacteria 9595
225 Ga0207709_10032619 3300025935 Bacteria 3051
226 Ga0207709_10095923 3300025935 Bacteria 1950
227 Ga0207670_10035996 3300025936 Bacteria 3216
228 Ga0207670_10206431 3300025936 Bacteria 1495
229 Ga0207669_10000374 3300025937 Bacteria 20104
230 Ga0207704_10001199 3300025938 Bacteria 11545
231 Ga0207704_10263603 3300025938 Bacteria 1300
232 Ga0207665_10000595 3300025939 Bacteria 24296
233 Ga0207665_10002059 3300025939 Bacteria 13550
234 Ga0207665_10285344 3300025939 Bacteria 1230
235 Ga0207711_10000893 3300025941 Bacteria 28700
236 Ga0207711_10015782 3300025941 Bacteria 6266
237 Ga0207689_10046755 3300025942 Bacteria 3576
238 Ga0207679_10205496 3300025945 Bacteria 1648
239 Ga0207667_10203163 3300025949 Bacteria 2032
240 Ga0207651_10029288 3300025960 Bacteria 3487
241 Ga0207651_10365420 3300025960 Bacteria 1219
242 Ga0207712_10000040 3300025961 Bacteria 180255
243 Ga0207712_10002257 3300025961 Bacteria 12516
244 Ga0207712_10195933 3300025961 Bacteria 1598
245 Ga0207668_10025467 3300025972 Bacteria 3829
246 Ga0207668_10110376 3300025972 Bacteria 2062
247 Ga0207668_10400468 3300025972 Bacteria 1160
248 Ga0207668_10667009 3300025972 Bacteria 911
249 Ga0207640_10002335 3300025981 Bacteria 10195
250 Ga0207640_10097099 3300025981 Bacteria 2056
251 Ga0207640_10281144 3300025981 Bacteria 1307
252 Ga0207658_10000740 3300025986 Bacteria 28154
253 Ga0207658_10004291 3300025986 Bacteria 9930
254 Ga0207658_10014508 3300025986 Bacteria 5395
255 Ga0207658_10044474 3300025986 Bacteria 3233
256 Ga0207677_10145948 3300026023 Bacteria 1818
257 Ga0207703_10026853 3300026035 Bacteria 4534
258 Ga0207703_10360041 3300026035 Bacteria 1341
259 Ga0207703_10474036 3300026035 Bacteria 1172
260 Ga0207639_10011231 3300026041 Bacteria 6212
261 Ga0207678_10036482 3300026067 Bacteria 4279
262 Ga0207678_10581084 3300026067 Bacteria 981
263 Ga0207708_10000982 3300026075 Bacteria 21374
264 Ga0207708_10004706 3300026075 Bacteria 10034
265 Ga0207641_10001736 3300026088 Bacteria 21039
266 Ga0207641_10016504 3300026088 Bacteria 6047
267 Ga0207641_10221864 3300026088 Bacteria 1753
268 Ga0207648_10000599 3300026089 Bacteria 40518
269 Ga0207648_10006604 3300026089 Bacteria 11518
270 Ga0207674_10103385 3300026116 Bacteria 2828
271 Ga0207675_100080332 3300026118 Bacteria 3057
272 Ga0207675_100123489 3300026118 Bacteria 2451
273 Ga0207675_100176934 3300026118 Bacteria 2042
274 Ga0207683_10007631 3300026121 Bacteria 9265
275 Ga0207683_10111488 3300026121 Bacteria 2450
276 Ga0207698_10022934 3300026142 Bacteria 4352
277 Ga0207698_10155817 3300026142 Bacteria 1990
278 Ga0207428_10330208 3300027907 Bacteria 1125
279 Ga0268266_10011626 3300028379 Bacteria 7642
280 Ga0268266_10256744 3300028379 Bacteria 1618
281 Ga0268265_10000004 3300028380 Bacteria 648376
282 Ga0268265_10032003 3300028380 Bacteria 3804
283 Ga0268265_10487995 3300028380 Bacteria 1158
284 Ga0268264_10000133 3300028381 Bacteria 179929
285 Ga0268264_10004587 3300028381 Bacteria 11745
286 Ga0268264_10616825 3300028381 Bacteria 1070
287 Ga0265327_10001843 3300031251 Bacteria 24600
288 Ga0307413_10615925 3300031824 Bacteria 891
289 Ga0307410_10003289 3300031852 Bacteria 8072
290 Ga0307407_10018506 3300031903 Bacteria 3525
291 Ga0307407_10363796 3300031903 Bacteria 1028
292 Ga0307409_100043962 3300031995 Bacteria 3360
293 Ga0307409_100251989 3300031995 Bacteria 1615
294 Ga0307416_100008398 3300032002 Bacteria 6661
295 Ga0307416_100827475 3300032002 Bacteria 1023
296 Ga0307414_10159723 3300032004 Bacteria 1789
297 Ga0307414_10324032 3300032004 Bacteria 1313
298 Ga0307414_10631887 3300032004 Bacteria 963
299 Ga0307411_10054018 3300032005 Bacteria 2635
300 Ga0307415_100818546 3300032126 Bacteria 852
301 Ga0373941_0033606 3300035115 Bacteria 1543
302 Ga0373931_0089890 3300035691 Bacteria 1709
303 Ga0316584_0040693 3300036712 Bacteria 3463
304 Ga0395905_0244100 3300037471 Bacteria 1678
305 Ga0436364_0385449 3300037853 Bacteria 4473
306 Ga0436364_0572184 3300037853 Bacteria 5912
307 Ga0436365_0259894 3300039437 Bacteria 19688
308 Ga0436365_1378611 3300039437 Bacteria 178407
309 Ga0436365_1469068 3300039437 Bacteria 36678
310 Ga0436363_0540344 3300039450 Bacteria 860
311 Ga0436363_1310990 3300039450 Bacteria 1508
312 Ga0439461_0008188 3300041410 Bacteria 1868
313 Ga0439466_0002959 3300041411 Bacteria 6635
314 Ga0439466_0005537 3300041411 Bacteria 4818
315 Ga0439465_0000470 3300041413 Bacteria 11931
316 Ga0439465_0008519 3300041413 Bacteria 3235
317 Ga0439465_0017299 3300041413 Bacteria 2250
318 Ga0451789_0443718 3300041443 Bacteria 1510
319 Ga0451793_0020002 3300041452 Bacteria 1891
320 Ga0451793_0087177 3300041452 Bacteria 631
321 Ga0451793_1356714 3300041452 Bacteria 2315
322 Ga0451795_0359733 3300041456 Bacteria 2083
323 Ga0451806_135764 3300041462 Bacteria 1284
324 Ga0439431_0002820 3300041997 Bacteria 3822
325 Ga0439431_0034457 3300041997 Bacteria 1269
326 Ga0439442_004448 3300042002 Bacteria 2783
327 Ga0439445_0001825 3300042004 Bacteria 4695
328 Ga0439445_0002825 3300042004 Bacteria 3880
329 Ga0439434_0014646 3300042435 Bacteria 2334
330 Ga0439460_0107543 3300042461 Bacteria 902
331 Ga0466969_0034754 3300044656 Bacteria 2553
332 Ga0466972_0001669 3300044658 Bacteria 10860
333 Ga0466972_0009736 3300044658 Bacteria 4824
334 Ga0466972_0017973 3300044658 Bacteria 3536
335 Ga0466972_0131399 3300044658 Bacteria 1179
336 Ga0466965_0002816 3300044683 Bacteria 7494
337 Ga0466965_0004402 3300044683 Bacteria 6262
338 Ga0466965_0016628 3300044683 Bacteria 3504
339 Ga0466965_0071608 3300044683 Bacteria 1744
340 Ga0466965_0125477 3300044683 Bacteria 1328
341 Ga0466966_0001426 3300044684 Bacteria 15385
342 Ga0466966_0039215 3300044684 Bacteria 3051
343 Ga0466961_0001731 3300044693 Bacteria 13574
344 Ga0466961_0027878 3300044693 Bacteria 3631
345 Ga0466963_0092507 3300044694 Bacteria 2060
346 Ga0466963_0235968 3300044694 Bacteria 1282
347 Ga0466963_0559997 3300044694 Bacteria 807
348 Ga0466964_0022135 3300044706 Bacteria 2463
349 Ga0466964_0028839 3300044706 Bacteria 2189
350 Ga0466964_0090979 3300044706 Bacteria 1328
351 Ga0466971_0023472 3300044719 Bacteria 2750
352 Ga0466968_0035826 3300044735 Bacteria 2077
353 Ga0466970_0002428 3300044765 Bacteria 9004
354 Ga0466970_0013109 3300044765 Bacteria 4248
355 Ga0466957_0002495 3300044842 Bacteria 9888
356 Ga0466957_0018332 3300044842 Bacteria 4110
357 Ga0466957_0066819 3300044842 Bacteria 2217
358 Ga0466957_0091268 3300044842 Bacteria 1909
359 Ga0466957_0130355 3300044842 Bacteria 1610
360 Ga0466960_0000201 3300044901 Bacteria 20658
361 Ga0466960_0001933 3300044901 Bacteria 7659
362 Ga0466960_0048242 3300044901 Bacteria 2046
363 Ga0466960_0210670 3300044901 Bacteria 1065
364 Ga0466960_0361481 3300044901 Bacteria 830
365 Ga0466959_0027800 3300045049 Bacteria 4195
366 Ga0466959_0028309 3300045049 Bacteria 4155
367 Ga0466958_0000266 3300045836 Bacteria 20187
368 Ga0466958_0039965 3300045836 Bacteria 2819
369 Ga0466958_0251852 3300045836 Bacteria 1130
370 Ga0466967_0003022 3300045976 Bacteria 10790
371 Ga0466967_0086733 3300045976 Bacteria 2836
372 Ga0466967_0097927 3300045976 Bacteria 2677
373 Ga0466967_0164938 3300045976 Bacteria 2081
374 Ga0466967_0169338 3300045976 Bacteria 2054
375 Ga0466967_0204257 3300045976 Bacteria 1872
376 Ga0495627_000312 3300046453 Bacteria 47799
377 Ga0495629_0045413 3300046459 Bacteria 3082
378 Ga0495638_0000244 3300046460 Bacteria 74504
379 Ga0495638_0119569 3300046460 Bacteria 1558
380 Ga0495641_0032411 3300046461 Bacteria 2487
381 Ga0495582_0146481 3300046473 Bacteria 1340
382 Ga0495606_0011728 3300046507 Bacteria 7112
383 Ga0495620_0189370 3300046515 Bacteria 794
384 Ga0495648_0017697 3300046524 Bacteria 5083
385 Ga0495665_0007328 3300046531 Bacteria 5961
386 Ga0495668_0163045 3300046616 Bacteria 1221
387 Ga0495624_0152755 3300046690 Bacteria 1412
388 Ga0495670_0172741 3300046691 Bacteria 1139
389 Ga0495581_0034656 3300047315 Bacteria 2920
390 Ga0495674_0043857 3300047319 Bacteria 3978
391 Ga0495672_0002688 3300047320 Bacteria 16001
392 Ga0495672_0092493 3300047320 Bacteria 1658
393 Ga0495672_0120274 3300047320 Bacteria 1397
394 Ga0495673_0000723 3300047469 Bacteria 31706
395 Ga0495686_0003616 3300047472 Bacteria 13260
396 Ga0495593_0012633 3300047673 Bacteria 4824
397 Ga0495614_0120564 3300048089 Bacteria 1156
398 Ga0496100_0000127 3300048903 Bacteria 42888
399 Ga0496100_0000505 3300048903 Bacteria 18747
400 Ga0496100_0017532 3300048903 Bacteria 4229
401 Ga0496100_0080538 3300048903 Bacteria 2198
402 Ga0496100_0240241 3300048903 Bacteria 1336
403 Ga0496101_0000068 3300048904 Bacteria 120985
404 Ga0496101_0000077 3300048904 Bacteria 109236
405 Ga0496101_0050228 3300048904 Bacteria 3001
406 Ga0496101_0233862 3300048904 Bacteria 1429
407 Ga0496101_0284767 3300048904 Bacteria 1292
408 Ga0496102_0000037 3300048905 Bacteria 199368
409 Ga0496102_0000594 3300048905 Bacteria 38107
410 Ga0496102_0007572 3300048905 Bacteria 9276
411 Ga0496102_0024070 3300048905 Bacteria 5412
412 Ga0496102_0033049 3300048905 Bacteria 4647
413 Ga0496102_0128960 3300048905 Bacteria 2366
414 Ga0496102_0206832 3300048905 Bacteria 1850
415 Ga0496102_0694181 3300048905 Bacteria 941
416 Ga0496103_0000004 3300048906 Bacteria 510080
417 Ga0496103_0000450 3300048906 Bacteria 35078
418 Ga0496103_0000790 3300048906 Bacteria 23307
419 Ga0496103_0005646 3300048906 Bacteria 7479
420 Ga0496103_0035441 3300048906 Bacteria 3055
421 Ga0496104_0000418 3300048907 Bacteria 37221
422 Ga0496104_0050862 3300048907 Bacteria 3909
423 Ga0496105_0029102 3300048908 Bacteria 4521
424 Ga0496105_0029487 3300048908 Bacteria 4491
425 Ga0496106_0001341 3300048909 Bacteria 18465
426 Ga0496106_0014139 3300048909 Bacteria 5896
427 Ga0496106_0014226 3300048909 Bacteria 5876
428 Ga0496106_0042481 3300048909 Bacteria 3410
429 Ga0496106_0108513 3300048909 Bacteria 2159
430 Ga0496107_0000392 3300048910 Bacteria 23713
431 Ga0496107_0001228 3300048910 Bacteria 15646
432 Ga0496107_0016429 3300048910 Bacteria 5198
433 Ga0496107_0022615 3300048910 Bacteria 4443
434 Ga0496107_0024454 3300048910 Bacteria 4273
435 Ga0496107_0108430 3300048910 Bacteria 2039
436 Ga0496107_0617670 3300048910 Bacteria 800
437 Ga0496108_0004384 3300048911 Bacteria 11359
438 Ga0496108_0015138 3300048911 Bacteria 6293
439 Ga0496108_0029070 3300048911 Bacteria 4575
440 Ga0496108_0134855 3300048911 Bacteria 2123
441 Ga0496109_0001366 3300048912 Bacteria 20228
442 Ga0496109_0006296 3300048912 Bacteria 9991
443 Ga0496109_0031691 3300048912 Bacteria 4747
444 Ga0496109_0035094 3300048912 Bacteria 4522
445 Ga0496109_0081120 3300048912 Bacteria 2989
446 Ga0496109_0917108 3300048912 Bacteria 814
447 Ga0496110_0001103 3300048913 Bacteria 19045
448 Ga0496110_0044601 3300048913 Bacteria 3872
449 Ga0496110_0080650 3300048913 Bacteria 2900
450 Ga0496110_0238058 3300048913 Bacteria 1656
451 Ga0496111_0005185 3300048914 Bacteria 8307
452 Ga0496111_0174712 3300048914 Bacteria 1596
453 Ga0496112_0006704 3300048915 Bacteria 10142
454 Ga0496112_0034049 3300048915 Bacteria 4956
455 Ga0496112_0056529 3300048915 Bacteria 3862
456 Ga0496112_0088656 3300048915 Bacteria 3062
457 Ga0496112_0102352 3300048915 Bacteria 2834
458 Ga0496113_0008358 3300048916 Bacteria 6741
459 Ga0496113_0107241 3300048916 Bacteria 2170
460 Ga0496113_0233233 3300048916 Bacteria 1468
461 Ga0496113_0313402 3300048916 Bacteria 1257
462 Ga0496114_0000110 3300048917 Bacteria 59135
463 Ga0496114_0002485 3300048917 Bacteria 14085
464 Ga0496114_0017992 3300048917 Bacteria 5709
465 Ga0496114_0047285 3300048917 Bacteria 3579
466 Ga0496114_0470395 3300048917 Bacteria 1112
467 Ga0496115_0030537 3300048918 Bacteria 4240
468 Ga0496115_0103122 3300048918 Bacteria 2340
469 Ga0496115_0332187 3300048918 Bacteria 1242
470 Ga0496116_0000056 3300048919 Bacteria 282554
471 Ga0496116_0007028 3300048919 Bacteria 10075
472 Ga0496116_0017744 3300048919 Bacteria 5513
473 Ga0496117_0000003 3300048920 Bacteria 1881097
474 Ga0496117_0000206 3300048920 Bacteria 114638
475 Ga0496117_0000808 3300048920 Bacteria 48592
476 Ga0496117_0061728 3300048920 Bacteria 2574
477 Ga0496118_0000001 3300048921 Bacteria 1881100
478 Ga0496118_0000364 3300048921 Bacteria 76481
479 Ga0496118_0000905 3300048921 Bacteria 46324
480 Ga0496118_0004720 3300048921 Bacteria 15955
481 Ga0496118_0016303 3300048921 Bacteria 6822
482 Ga0496118_0022022 3300048921 Bacteria 5588
483 Ga0496119_0001959 3300048922 Bacteria 23406
484 Ga0496119_0002043 3300048922 Bacteria 22843
485 Ga0496119_0005342 3300048922 Bacteria 12357
486 Ga0496119_0006924 3300048922 Bacteria 10340
487 Ga0496119_0014032 3300048922 Bacteria 6309
488 Ga0496119_0077648 3300048922 Bacteria 1923
489 Ga0496120_0006295 3300048923 Bacteria 9152
490 Ga0496120_0017809 3300048923 Bacteria 4592
491 Ga0496120_0028222 3300048923 Bacteria 3440
492 Ga0496121_0000023 3300048924 Bacteria 463448
493 Ga0496121_0000790 3300048924 Bacteria 57884
494 Ga0496121_0014805 3300048924 Bacteria 8235
495 Ga0496122_0000038 3300048925 Bacteria 295624
496 Ga0496122_0000235 3300048925 Bacteria 124769
497 Ga0496122_0003643 3300048925 Bacteria 20024
498 Ga0496122_0073782 3300048925 Bacteria 2417
499 Ga0496122_0276856 3300048925 Bacteria 920
500 Ga0496123_0000036 3300048926 Bacteria 265722
501 Ga0496123_0011888 3300048926 Bacteria 7482
502 Ga0496123_0035768 3300048926 Bacteria 3533
503 Ga0496124_0000014 3300048927 Bacteria 463448
504 Ga0496124_0002889 3300048927 Bacteria 21677
505 Ga0496124_0050478 3300048927 Bacteria 3544
506 Ga0496124_0094456 3300048927 Bacteria 2432
507 Ga0496125_0000020 3300048928 Bacteria 463448
508 Ga0496125_0012064 3300048928 Bacteria 8598
509 Ga0496125_0048094 3300048928 Bacteria 3560
510 Ga0496125_0081135 3300048928 Bacteria 2479
511 Ga0496125_0081787 3300048928 Bacteria 2466
512 Ga0496126_0000023 3300048929 Bacteria 463448
513 Ga0496126_0000912 3300048929 Bacteria 51111
514 Ga0496126_0004156 3300048929 Bacteria 17477
515 Ga0496126_0025068 3300048929 Bacteria 5747
516 Ga0496126_0035324 3300048929 Bacteria 4687
517 Ga0496126_0070492 3300048929 Bacteria 3114
518 Ga0501032_0002220 3300049569 Bacteria 15287
519 Ga0501032_0013764 3300049569 Bacteria 5740
520 Ga0501033_0002350 3300049570 Bacteria 16130
521 Ga0501034_0001656 3300049571 Bacteria 28757
522 Ga0501034_0016305 3300049571 Bacteria 7628
523 Ga0501034_0033635 3300049571 Bacteria 5199
524 Ga0501034_0055735 3300049571 Bacteria 3977
525 Ga0501034_0268114 3300049571 Bacteria 1649
526 Ga0501036_0022652 3300049572 Bacteria 5286
527 Ga0501037_0001024 3300049573 Bacteria 20661
528 Ga0501038_0008021 3300049574 Bacteria 9726
529 Ga0501039_0001582 3300049575 Bacteria 16761
530 Ga0501039_0034454 3300049575 Bacteria 3907
531 Ga0501043_0002179 3300049579 Bacteria 16718
532 Ga0501043_0034760 3300049579 Bacteria 3964
533 Ga0501043_0132255 3300049579 Bacteria 1955
534 Ga0501046_0039066 3300049580 Bacteria 3803
535 Ga0501047_0028440 3300049581 Bacteria 5389
536 Ga0501047_0492231 3300049581 Bacteria 1053
537 Ga0501048_0018424 3300049582 Bacteria 5135
538 Ga0501069_0118772 3300049585 Bacteria 1509
539 Ga0501069_0204860 3300049585 Bacteria 1144
540 Ga0501070_0002338 3300049586 Bacteria 16653
541 Ga0501070_0002467 3300049586 Bacteria 16202
542 Ga0501070_0008341 3300049586 Bacteria 8755
543 Ga0501071_0002594 3300049587 Bacteria 11042
544 Ga0501073_0045427 3300049589 Bacteria 3093
545 Ga0501073_0117204 3300049589 Bacteria 1845
546 Ga0501077_0224723 3300049593 Bacteria 1193
547 Ga0501080_0130851 3300049742 Bacteria 2323
548 Ga0501035_0008115 3300049822 Bacteria 9784
549 Ga0501044_0002686 3300049823 Bacteria 20228
550 nmdc:mga03683_3424_c1 3300050489 Bacteria 5115
551 nmdc:mga03n38_12438_c1 3300050490 Bacteria 3203
552 nmdc:mga03n38_16039_c1 3300050490 Bacteria 2907
553 nmdc:mga03n38_24671_c1 3300050490 Bacteria 2460
554 nmdc:mga03n38_93749_c1 3300050490 Bacteria 1435
555 nmdc:mga00v17_11417_c1 3300050491 Bacteria 4882
556 nmdc:mga00v17_143562_c1 3300050491 Bacteria 1532
557 nmdc:mga00v17_147033_c1 3300050491 Bacteria 1513
558 nmdc:mga00v17_202750_c1 3300050491 Bacteria 1282
559 nmdc:mga00v17_23631_c1 3300050491 Bacteria 3557
560 nmdc:mga00v17_346539_c1 3300050491 Bacteria 966
561 nmdc:mga00v17_410943_c1 3300050491 Bacteria 879
562 nmdc:mga00v17_6778_c1 3300050491 Bacteria 6087
563 nmdc:mga07m45_101660_c1 3300050496 Bacteria 1651
564 nmdc:mga07m45_106057_c1 3300050496 Bacteria 1616
565 nmdc:mga07m45_2024_c1 3300050496 Bacteria 9406
566 nmdc:mga05p37_26068_c1 3300050507 Bacteria 7108
567 nmdc:mga0qj67_104168_c2 3300050509 Bacteria 1949
568 nmdc:mga06r32_137043_c1 3300050510 Bacteria 2422
569 nmdc:mga08y16_590475_c1 3300050511 Bacteria 1120
570 nmdc:mga0sz30_53687_c1 3300050516 Bacteria 1713
571 Ga0500610_0005649 3300053079 Bacteria 5157
572 Ga0495619_0134277 3300053085 Bacteria 1702
573 Ga0500556_0002637 3300053104 Bacteria 5607
574 Ga0500562_006222 3300053108 Bacteria 3012
575 Ga0500569_073019 3300053109 Bacteria 1083
576 Ga0500642_0008941 3300053130 Bacteria 3453
577 Ga0500568_0039594 3300053139 Bacteria 1902
578 Ga0500573_0137653 3300053140 Bacteria 1347
579 Ga0500616_0010055 3300053153 Bacteria 5685
580 Ga0466962_0009981 3300061719 Bacteria 4555
581 Ga0466962_0021451 3300061719 Bacteria 3101

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100663178 Ga0070714_1006631781 194
2 3300049571 Ga0501034_0033635 Ga0501034_0033635_2755_3438 194
3 3300049587 Ga0501071_0002594 Ga0501071_0002594_4560_5243 194
4 3300003792 Ga0055540_1000029 Ga0055540_100002983 197
5 3300005335 Ga0070666_10202667 Ga0070666_102026672 197
6 3300005367 Ga0070667_100000831 Ga0070667_10000083122 197
7 3300025986 Ga0207658_10000740 Ga0207658_1000074024 197
8 3300031251 Ga0265327_10001843 Ga0265327_1000184323 197
9 3300041452 Ga0451793_0087177 Ga0451793_0087177_13_612 198
10 3300048905 Ga0496102_0694181 Ga0496102_0694181_45_644 198
11 3300048910 Ga0496107_0024454 Ga0496107_0024454_3636_4235 198
12 3300048916 Ga0496113_0107241 Ga0496113_0107241_56_655 198
13 3300049586 Ga0501070_0008341 Ga0501070_0008341_346_1047 198
14 3300050491 nmdc:mga00v17_346539_c1 nmdc:mga00v17_346539_c1_23_622 198
15 3300045976 Ga0466967_0164938 Ga0466967_0164938_22_630 202
16 3300053153 Ga0500616_0010055 Ga0500616_0010055_2575_3279 202
17 3300049585 Ga0501069_0204860 Ga0501069_0204860_116_811 204
18 iso_pu_bacteria 2946041624 2946041680 204
19 iso_pu_bacteria 2643221630 2644171742 205
20 iso_pu_bacteria 2643221724 2644681504 205
21 iso_pu_bacteria 2728369380 2730231092 205
22 iso_pu_bacteria 2747842429 2747954946 205
23 iso_pu_bacteria 2857723135 2857726431 205
24 iso_pu_bacteria 2919395869 2919397546 205
25 iso_pu_bacteria 2945968032 2945969228 205
26 iso_pu_bacteria 2946033335 2946035911 205
27 iso_pu_bacteria 8004182704 8004184061 205
28 3300044901 Ga0466960_0361481 Ga0466960_0361481_144_791 206
29 iso_pu_bacteria 2643221597 2643997116 206
30 iso_pu_bacteria 2808606306 2808629249 206
31 iso_pu_bacteria 2939660829 2939661590 206
32 3300046453 Ga0495627_000312 Ga0495627_000312_21031_21660 207
33 3300048920 Ga0496117_0000808 Ga0496117_0000808_26974_27603 207
34 3300048921 Ga0496118_0022022 Ga0496118_0022022_2568_3197 207
35 3300048922 Ga0496119_0077648 Ga0496119_0077648_1173_1802 207
36 3300048925 Ga0496122_0073782 Ga0496122_0073782_446_1075 207
37 3300048929 Ga0496126_0000912 Ga0496126_0000912_29528_30157 207
38 3300048929 Ga0496126_0070492 Ga0496126_0070492_877_1506 207
39 3300049571 Ga0501034_0001656 Ga0501034_0001656_18771_19400 207
40 iso_pu_bacteria 2643221572 2643876931 207
41 iso_pu_bacteria 2643221649 2644278234 207
42 iso_pu_bacteria 2643221669 2644383986 207
43 iso_pu_bacteria 2895660088 2895662289 207
44 iso_pu_bacteria 2984580707 2984583330 207
45 3300006051 Ga0075364_10117578 Ga0075364_101175783 208
46 3300025246 Ga0209646_1000014 Ga0209646_1000014496 208
47 3300031903 Ga0307407_10363796 Ga0307407_103637962 208
48 3300032004 Ga0307414_10631887 Ga0307414_106318872 208
49 3300044842 Ga0466957_0091268 Ga0466957_0091268_1264_1896 208
50 3300048925 Ga0496122_0003643 Ga0496122_0003643_14942_15574 208
51 3300048925 Ga0496122_0276856 Ga0496122_0276856_162_794 208
52 3300048927 Ga0496124_0094456 Ga0496124_0094456_1610_2242 208
53 3300048928 Ga0496125_0012064 Ga0496125_0012064_2073_2705 208
54 3300050491 nmdc:mga00v17_147033_c1 nmdc:mga00v17_147033_c1_208_840 208
55 3300050491 nmdc:mga00v17_410943_c1 nmdc:mga00v17_410943_c1_85_717 208
56 3300013250 Ga0171462_1002 Ga0171462_1002332 209
57 3300032002 Ga0307416_100827475 Ga0307416_1008274751 209
58 3300041452 Ga0451793_1356714 Ga0451793_1356714_603_1325 209
59 3300046515 Ga0495620_0189370 Ga0495620_0189370_134_775 209
60 3300048921 Ga0496118_0004720 Ga0496118_0004720_2218_2862 209
61 3300048922 Ga0496119_0001959 Ga0496119_0001959_5066_5710 209
62 3300048922 Ga0496119_0002043 Ga0496119_0002043_14991_15632 209
63 3300048923 Ga0496120_0028222 Ga0496120_0028222_1492_2136 209
64 3300048925 Ga0496122_0000235 Ga0496122_0000235_98143_98787 209
65 3300048926 Ga0496123_0000036 Ga0496123_0000036_25987_26631 209
66 3300048927 Ga0496124_0002889 Ga0496124_0002889_16266_16910 209
67 3300048928 Ga0496125_0048094 Ga0496125_0048094_1464_2108 209
68 3300049575 Ga0501039_0034454 Ga0501039_0034454_1377_2012 209
69 3300049579 Ga0501043_0132255 Ga0501043_0132255_1186_1821 209
70 iso_pu_bacteria 2773857763 2774397689 209
71 3300025909 Ga0207705_10504232 Ga0207705_105042321 210
72 3300025921 Ga0207652_10660812 Ga0207652_106608122 210
73 3300025932 Ga0207690_10433789 Ga0207690_104337892 210
74 iso_pu_bacteria 2852643534 2852644957 211
75 3300005347 Ga0070668_100208673 Ga0070668_1002086732 213
76 3300005617 Ga0068859_100891845 Ga0068859_1008918451 213
77 3300006931 Ga0097620_100891894 Ga0097620_1008918941 213
78 3300009036 Ga0105244_10069180 Ga0105244_100691802 213
79 3300009094 Ga0111539_10466556 Ga0111539_104665562 213
80 3300011119 Ga0105246_10070110 Ga0105246_100701101 213
81 3300025935 Ga0207709_10032619 Ga0207709_100326192 213
82 3300026116 Ga0207674_10103385 Ga0207674_101033852 213
83 3300027907 Ga0207428_10330208 Ga0207428_103302082 213
84 3300031995 Ga0307409_100251989 Ga0307409_1002519892 213
85 3300032004 Ga0307414_10159723 Ga0307414_101597232 213
86 3300032004 Ga0307414_10324032 Ga0307414_103240321 213
87 3300042461 Ga0439460_0107543 Ga0439460_0107543_231_884 213
88 3300046460 Ga0495638_0119569 Ga0495638_0119569_166_819 213
89 3300048916 Ga0496113_0233233 Ga0496113_0233233_202_855 213
90 3300048928 Ga0496125_0081787 Ga0496125_0081787_1227_1880 213
91 3300050511 nmdc:mga08y16_590475_c1 nmdc:mga08y16_590475_c1_176_829 213
92 iso_pu_bacteria 2585428094 2587861644 213
93 iso_pu_bacteria 2643221549 2643769150 213
94 iso_pu_bacteria 2643221619 2644112612 213
95 iso_pu_bacteria 2808606372 2808900363 213
96 3300005549 Ga0070704_100181471 Ga0070704_1001814712 214
97 3300044683 Ga0466965_0125477 Ga0466965_0125477_625_1278 214
98 3300053140 Ga0500573_0137653 Ga0500573_0137653_266_931 216
99 3300009177 Ga0105248_10514539 Ga0105248_105145392 217
100 3300025303 Ga0209051_1045594 Ga0209051_10455942 217
101 3300046691 Ga0495670_0172741 Ga0495670_0172741_124_783 217
102 iso_pu_bacteria 2919443155 2919444983 217
103 3300041462 Ga0451806_135764 Ga0451806_135764_361_1032 219
104 3300005456 Ga0070678_100095400 Ga0070678_1000954003 220
105 3300005347 Ga0070668_100011834 Ga0070668_1000118348 221
106 3300005548 Ga0070665_100008244 Ga0070665_1000082445 221
107 3300005617 Ga0068859_100011242 Ga0068859_1000112426 221
108 3300005841 Ga0068863_100001801 Ga0068863_10000180119 221
109 3300005842 Ga0068858_100037254 Ga0068858_1000372544 221
110 3300005843 Ga0068860_100000231 Ga0068860_10000023133 221
111 3300005844 Ga0068862_100000060 Ga0068862_10000006053 221
112 3300006931 Ga0097620_100011242 Ga0097620_1000112426 221
113 3300025900 Ga0207710_10000085 Ga0207710_10000085105 221
114 3300025923 Ga0207681_10004313 Ga0207681_100043138 221
115 3300025941 Ga0207711_10000893 Ga0207711_100008933 221
116 3300025961 Ga0207712_10000040 Ga0207712_1000004083 221
117 3300025986 Ga0207658_10004291 Ga0207658_100042913 221
118 3300026088 Ga0207641_10001736 Ga0207641_1000173610 221
119 3300028380 Ga0268265_10000004 Ga0268265_10000004555 221
120 3300028381 Ga0268264_10000133 Ga0268264_1000013382 221
121 3300037471 Ga0395905_0244100 Ga0395905_0244100_243_968 221
122 3300047320 Ga0495672_0120274 Ga0495672_0120274_237_902 221
123 3300048918 Ga0496115_0332187 Ga0496115_0332187_313_981 221
124 3300048927 Ga0496124_0050478 Ga0496124_0050478_2248_2916 221
125 3300005347 Ga0070668_100534600 Ga0070668_1005346001 222
126 3300006038 Ga0075365_10008621 Ga0075365_100086215 222
127 3300006038 Ga0075365_10086747 Ga0075365_100867471 222
128 3300006048 Ga0075363_100031886 Ga0075363_1000318862 222
129 3300006353 Ga0075370_10006244 Ga0075370_100062442 222
130 3300006353 Ga0075370_10007350 Ga0075370_100073502 222
131 3300009176 Ga0105242_10582979 Ga0105242_105829792 222
132 3300031852 Ga0307410_10003289 Ga0307410_100032895 222
133 3300031903 Ga0307407_10018506 Ga0307407_100185063 222
134 3300031995 Ga0307409_100043962 Ga0307409_1000439624 222
135 3300032002 Ga0307416_100008398 Ga0307416_1000083982 222
136 3300032005 Ga0307411_10054018 Ga0307411_100540182 222
137 3300050490 nmdc:mga03n38_12438_c1 nmdc:mga03n38_12438_c1_332_1003 222
138 3300050490 nmdc:mga03n38_24671_c1 nmdc:mga03n38_24671_c1_1678_2349 222
139 3300050496 nmdc:mga07m45_101660_c1 nmdc:mga07m45_101660_c1_45_716 222
140 3300050496 nmdc:mga07m45_2024_c1 nmdc:mga07m45_2024_c1_3343_4014 222
141 3300053109 Ga0500569_073019 Ga0500569_073019_291_962 222
142 iso_pu_bacteria 2643221635 2644198379 222
143 iso_pu_bacteria 8046352972 8046354302 222
144 3300036712 Ga0316584_0040693 Ga0316584_0040693_244_921 223
145 3300009092 Ga0105250_10033787 Ga0105250_100337873 224
146 3300013306 Ga0163162_10058625 Ga0163162_100586252 224
147 3300041413 Ga0439465_0008519 Ga0439465_0008519_2532_3209 224
148 3300050490 nmdc:mga03n38_16039_c1 nmdc:mga03n38_16039_c1_957_1634 224
149 3300050491 nmdc:mga00v17_6778_c1 nmdc:mga00v17_6778_c1_2121_2798 224
150 iso_pu_bacteria 2939582691 2939587421 224
151 3300005842 Ga0068858_100200083 Ga0068858_1002000832 225
152 3300009101 Ga0105247_10128028 Ga0105247_101280281 225
153 3300048909 Ga0496106_0108513 Ga0496106_0108513_1357_2073 225
154 3300048910 Ga0496107_0617670 Ga0496107_0617670_45_773 225
155 3300048917 Ga0496114_0470395 Ga0496114_0470395_187_915 225
156 iso_pu_bacteria 2643221687 2644486346 226
157 iso_pu_bacteria 2643221715 2644637386 226
158 iso_pu_bacteria 2902810491 2902815422 226
159 iso_pu_bacteria 2902837492 2902840234 226
160 3300026118 Ga0207675_100176934 Ga0207675_1001769342 227
161 iso_pu_bacteria 2929212328 2929215066 227
162 3300003792 Ga0055540_1003364 Ga0055540_10033644 228
163 3300025303 Ga0209051_1000581 Ga0209051_100058134 228
164 3300049571 Ga0501034_0268114 Ga0501034_0268114_341_1030 228
165 3300005435 Ga0070714_100213327 Ga0070714_1002133272 229
166 3300006038 Ga0075365_10031963 Ga0075365_100319632 229
167 3300006048 Ga0075363_100002167 Ga0075363_1000021673 229
168 3300021384 Ga0213876_10009186 Ga0213876_100091864 229
169 3300025929 Ga0207664_10182481 Ga0207664_101824812 229
170 3300037853 Ga0436364_0385449 Ga0436364_0385449_3432_4124 229
171 3300037853 Ga0436364_0572184 Ga0436364_0572184_1250_1954 229
172 3300039437 Ga0436365_0259894 Ga0436365_0259894_11970_12674 229
173 3300039437 Ga0436365_1378611 Ga0436365_1378611_119692_120384 229
174 3300039437 Ga0436365_1469068 Ga0436365_1469068_28823_29527 229
175 3300039450 Ga0436363_0540344 Ga0436363_0540344_64_765 229
176 3300041413 Ga0439465_0000470 Ga0439465_0000470_593_1288 229
177 3300044694 Ga0466963_0092507 Ga0466963_0092507_1318_2022 229
178 3300044694 Ga0466963_0559997 Ga0466963_0559997_58_750 229
179 3300044719 Ga0466971_0023472 Ga0466971_0023472_1665_2369 229
180 3300044842 Ga0466957_0130355 Ga0466957_0130355_729_1433 229
181 3300045976 Ga0466967_0003022 Ga0466967_0003022_2597_3289 229
182 3300045976 Ga0466967_0169338 Ga0466967_0169338_1279_1983 229
183 3300048920 Ga0496117_0061728 Ga0496117_0061728_391_1134 229
184 3300048921 Ga0496118_0000364 Ga0496118_0000364_8473_9216 229
185 3300049569 Ga0501032_0013764 Ga0501032_0013764_2953_3657 229
186 3300049570 Ga0501033_0002350 Ga0501033_0002350_12750_13454 229
187 3300049571 Ga0501034_0055735 Ga0501034_0055735_44_748 229
188 3300049579 Ga0501043_0034760 Ga0501043_0034760_2875_3579 229
189 3300049580 Ga0501046_0039066 Ga0501046_0039066_32_736 229
190 3300049581 Ga0501047_0028440 Ga0501047_0028440_4261_4965 229
191 3300049581 Ga0501047_0492231 Ga0501047_0492231_336_1040 229
192 3300049582 Ga0501048_0018424 Ga0501048_0018424_3664_4368 229
193 3300049585 Ga0501069_0118772 Ga0501069_0118772_297_1001 229
194 3300049586 Ga0501070_0002338 Ga0501070_0002338_4073_4777 229
195 3300049589 Ga0501073_0117204 Ga0501073_0117204_820_1524 229
196 3300049742 Ga0501080_0130851 Ga0501080_0130851_953_1657 229
197 3300049822 Ga0501035_0008115 Ga0501035_0008115_5254_5958 229
198 3300049823 Ga0501044_0002686 Ga0501044_0002686_12785_13489 229
199 3300053130 Ga0500642_0008941 Ga0500642_0008941_2516_3208 229
200 3300061719 Ga0466962_0021451 Ga0466962_0021451_381_1085 229
201 iso_pu_bacteria 2842134933 2842138341 229
202 iso_pu_bacteria 2902792274 2902798546 229
203 3300003792 Ga0055540_1002534 Ga0055540_10025347 230
204 3300003792 Ga0055540_1015764 Ga0055540_10157642 230
205 3300005458 Ga0070681_10725468 Ga0070681_107254681 230
206 3300005539 Ga0068853_100050178 Ga0068853_1000501782 230
207 3300006051 Ga0075364_10028730 Ga0075364_100287305 230
208 3300006186 Ga0075369_10038054 Ga0075369_100380542 230
209 3300025303 Ga0209051_1010244 Ga0209051_10102445 230
210 3300025303 Ga0209051_1025671 Ga0209051_10256712 230
211 3300025939 Ga0207665_10285344 Ga0207665_102853442 230
212 3300026041 Ga0207639_10011231 Ga0207639_100112317 230
213 3300026067 Ga0207678_10581084 Ga0207678_105810841 230
214 3300032126 Ga0307415_100818546 Ga0307415_1008185461 230
215 3300041410 Ga0439461_0008188 Ga0439461_0008188_312_1010 230
216 3300041411 Ga0439466_0002959 Ga0439466_0002959_5444_6142 230
217 3300041452 Ga0451793_0020002 Ga0451793_0020002_344_1042 230
218 3300041456 Ga0451795_0359733 Ga0451795_0359733_429_1127 230
219 3300041997 Ga0439431_0002820 Ga0439431_0002820_3070_3768 230
220 3300042004 Ga0439445_0001825 Ga0439445_0001825_2899_3597 230
221 3300044658 Ga0466972_0017973 Ga0466972_0017973_1177_1869 230
222 3300044658 Ga0466972_0131399 Ga0466972_0131399_347_1039 230
223 3300044684 Ga0466966_0039215 Ga0466966_0039215_179_871 230
224 3300044693 Ga0466961_0027878 Ga0466961_0027878_2571_3263 230
225 3300044706 Ga0466964_0022135 Ga0466964_0022135_1684_2376 230
226 3300044706 Ga0466964_0090979 Ga0466964_0090979_386_1078 230
227 3300044765 Ga0466970_0013109 Ga0466970_0013109_2033_2725 230
228 3300044842 Ga0466957_0066819 Ga0466957_0066819_1440_2132 230
229 3300045049 Ga0466959_0027800 Ga0466959_0027800_2570_3262 230
230 3300045836 Ga0466958_0039965 Ga0466958_0039965_1540_2232 230
231 3300045836 Ga0466958_0251852 Ga0466958_0251852_244_936 230
232 3300046459 Ga0495629_0045413 Ga0495629_0045413_1944_2636 230
233 3300046461 Ga0495641_0032411 Ga0495641_0032411_450_1142 230
234 3300046473 Ga0495582_0146481 Ga0495582_0146481_375_1067 230
235 3300046507 Ga0495606_0011728 Ga0495606_0011728_2725_3417 230
236 3300046531 Ga0495665_0007328 Ga0495665_0007328_3130_3822 230
237 3300046690 Ga0495624_0152755 Ga0495624_0152755_222_914 230
238 3300047315 Ga0495581_0034656 Ga0495581_0034656_1629_2321 230
239 3300047319 Ga0495674_0043857 Ga0495674_0043857_2395_3087 230
240 3300047472 Ga0495686_0003616 Ga0495686_0003616_6638_7336 230
241 3300047673 Ga0495593_0012633 Ga0495593_0012633_1726_2418 230
242 3300048089 Ga0495614_0120564 Ga0495614_0120564_439_1131 230
243 3300050491 nmdc:mga00v17_11417_c1 nmdc:mga00v17_11417_c1_1186_1884 230
244 3300050491 nmdc:mga00v17_23631_c1 nmdc:mga00v17_23631_c1_872_1570 230
245 3300053085 Ga0495619_0134277 Ga0495619_0134277_112_804 230
246 3300061719 Ga0466962_0009981 Ga0466962_0009981_3605_4297 230
247 3300006844 Ga0075428_100014477 Ga0075428_1000144774 231
248 3300006846 Ga0075430_100234431 Ga0075430_1002344312 231
249 3300006847 Ga0075431_100054720 Ga0075431_1000547204 231
250 3300009147 Ga0114129_10041263 Ga0114129_100412634 231
251 3300009545 Ga0105237_10008410 Ga0105237_100084103 231
252 3300010375 Ga0105239_10006534 Ga0105239_100065348 231
253 3300025914 Ga0207671_10008558 Ga0207671_100085583 231
254 3300046524 Ga0495648_0017697 Ga0495648_0017697_1687_2391 231
255 3300047320 Ga0495672_0002688 Ga0495672_0002688_13368_14072 231
256 3300047469 Ga0495673_0000723 Ga0495673_0000723_22057_22761 231
257 3300048903 Ga0496100_0000505 Ga0496100_0000505_16436_17176 231
258 3300048904 Ga0496101_0000077 Ga0496101_0000077_13010_13750 231
259 3300048905 Ga0496102_0000037 Ga0496102_0000037_185400_186140 231
260 3300048906 Ga0496103_0000004 Ga0496103_0000004_496112_496852 231
261 3300048909 Ga0496106_0042481 Ga0496106_0042481_356_1096 231
262 3300048910 Ga0496107_0016429 Ga0496107_0016429_1683_2423 231
263 3300048919 Ga0496116_0000056 Ga0496116_0000056_185843_186583 231
264 3300048920 Ga0496117_0000003 Ga0496117_0000003_1694515_1695255 231
265 3300048921 Ga0496118_0000001 Ga0496118_0000001_1694518_1695258 231
266 3300048922 Ga0496119_0014032 Ga0496119_0014032_180_920 231
267 3300048923 Ga0496120_0006295 Ga0496120_0006295_97_837 231
268 3300048924 Ga0496121_0000790 Ga0496121_0000790_6247_6987 231
269 3300048929 Ga0496126_0004156 Ga0496126_0004156_13757_14497 231
270 3300050507 nmdc:mga05p37_26068_c1 nmdc:mga05p37_26068_c1_534_1229 231
271 3300050509 nmdc:mga0qj67_104168_c2 nmdc:mga0qj67_104168_c2_654_1349 231
272 3300050510 nmdc:mga06r32_137043_c1 nmdc:mga06r32_137043_c1_1588_2283 231
273 3300009098 Ga0105245_10419384 Ga0105245_104193841 232
274 3300010375 Ga0105239_10051721 Ga0105239_100517212 232
275 3300025303 Ga0209051_1000042 Ga0209051_1000042229 232
276 3300025903 Ga0207680_10098755 Ga0207680_100987552 232
277 3300025927 Ga0207687_10348566 Ga0207687_103485661 232
278 3300044656 Ga0466969_0034754 Ga0466969_0034754_113_853 232
279 3300044683 Ga0466965_0002816 Ga0466965_0002816_3753_4463 232
280 3300044684 Ga0466966_0001426 Ga0466966_0001426_4078_4818 232
281 3300044693 Ga0466961_0001731 Ga0466961_0001731_4852_5592 232
282 3300044694 Ga0466963_0235968 Ga0466963_0235968_479_1219 232
283 3300044842 Ga0466957_0002495 Ga0466957_0002495_4563_5303 232
284 3300045836 Ga0466958_0000266 Ga0466958_0000266_7131_7871 232
285 3300045976 Ga0466967_0097927 Ga0466967_0097927_1140_1850 232
286 3300048903 Ga0496100_0000127 Ga0496100_0000127_32306_33016 232
287 3300048904 Ga0496101_0000068 Ga0496101_0000068_106404_107114 232
288 3300048904 Ga0496101_0284767 Ga0496101_0284767_565_1266 232
289 3300048905 Ga0496102_0007572 Ga0496102_0007572_7805_8515 232
290 3300048906 Ga0496103_0000790 Ga0496103_0000790_7546_8256 232
291 3300048910 Ga0496107_0001228 Ga0496107_0001228_12738_13448 232
292 3300048911 Ga0496108_0015138 Ga0496108_0015138_3601_4311 232
293 3300048911 Ga0496108_0029070 Ga0496108_0029070_274_984 232
294 3300048912 Ga0496109_0001366 Ga0496109_0001366_7357_8067 232
295 3300048912 Ga0496109_0035094 Ga0496109_0035094_1871_2581 232
296 3300048913 Ga0496110_0001103 Ga0496110_0001103_8153_8863 232
297 3300048914 Ga0496111_0005185 Ga0496111_0005185_6761_7471 232
298 3300048916 Ga0496113_0008358 Ga0496113_0008358_5832_6533 232
299 3300048917 Ga0496114_0000110 Ga0496114_0000110_21937_22647 232
300 3300048918 Ga0496115_0030537 Ga0496115_0030537_1306_2016 232
301 3300048919 Ga0496116_0017744 Ga0496116_0017744_470_1180 232
302 3300048921 Ga0496118_0016303 Ga0496118_0016303_2490_3200 232
303 3300048922 Ga0496119_0006924 Ga0496119_0006924_1305_2015 232
304 3300048924 Ga0496121_0000023 Ga0496121_0000023_149017_149727 232
305 3300048925 Ga0496122_0000038 Ga0496122_0000038_149017_149727 232
306 3300048926 Ga0496123_0011888 Ga0496123_0011888_5301_6011 232
307 3300048926 Ga0496123_0035768 Ga0496123_0035768_955_1656 232
308 3300048927 Ga0496124_0000014 Ga0496124_0000014_149017_149727 232
309 3300048928 Ga0496125_0000020 Ga0496125_0000020_313722_314432 232
310 3300048929 Ga0496126_0000023 Ga0496126_0000023_149017_149727 232
311 3300048929 Ga0496126_0035324 Ga0496126_0035324_1412_2113 232
312 3300050496 nmdc:mga07m45_106057_c1 nmdc:mga07m45_106057_c1_419_1117 232
313 3300001977 JGI24746J21847_1007734 JGI24746J21847_10077342 233
314 3300001989 JGI24739J22299_10085623 JGI24739J22299_100856232 233
315 3300002070 JGI24750J21931_1001193 JGI24750J21931_10011932 233
316 3300002077 JGI24744J21845_10002079 JGI24744J21845_100020792 233
317 3300002077 JGI24744J21845_10007863 JGI24744J21845_100078632 233
318 3300002239 JGI24034J26672_10013415 JGI24034J26672_100134152 233
319 3300002244 JGI24742J22300_10000911 JGI24742J22300_100009112 233
320 3300002244 JGI24742J22300_10032469 JGI24742J22300_100324691 233
321 3300005328 Ga0070676_10061696 Ga0070676_100616961 233
322 3300005329 Ga0070683_100146586 Ga0070683_1001465862 233
323 3300005334 Ga0068869_100205057 Ga0068869_1002050572 233
324 3300005335 Ga0070666_10052854 Ga0070666_100528543 233
325 3300005335 Ga0070666_10225083 Ga0070666_102250831 233
326 3300005337 Ga0070682_100015442 Ga0070682_1000154424 233
327 3300005337 Ga0070682_100029056 Ga0070682_1000290565 233
328 3300005338 Ga0068868_100001612 Ga0068868_1000016129 233
329 3300005340 Ga0070689_100030572 Ga0070689_1000305722 233
330 3300005341 Ga0070691_10014157 Ga0070691_100141572 233
331 3300005347 Ga0070668_100022683 Ga0070668_1000226833 233
332 3300005347 Ga0070668_100135030 Ga0070668_1001350302 233
333 3300005354 Ga0070675_100128870 Ga0070675_1001288702 233
334 3300005356 Ga0070674_100002940 Ga0070674_1000029402 233
335 3300005356 Ga0070674_100065393 Ga0070674_1000653933 233
336 3300005364 Ga0070673_100091600 Ga0070673_1000916003 233
337 3300005365 Ga0070688_100032775 Ga0070688_1000327752 233
338 3300005366 Ga0070659_100086836 Ga0070659_1000868362 233
339 3300005367 Ga0070667_100000630 Ga0070667_10000063032 233
340 3300005367 Ga0070667_100046633 Ga0070667_1000466332 233
341 3300005367 Ga0070667_100268632 Ga0070667_1002686322 233
342 3300005434 Ga0070709_10011706 Ga0070709_100117064 233
343 3300005434 Ga0070709_10086658 Ga0070709_100866582 233
344 3300005437 Ga0070710_10001814 Ga0070710_1000181410 233
345 3300005437 Ga0070710_10030703 Ga0070710_100307034 233
346 3300005439 Ga0070711_100004140 Ga0070711_1000041407 233
347 3300005439 Ga0070711_100021930 Ga0070711_1000219302 233
348 3300005440 Ga0070705_100033952 Ga0070705_1000339523 233
349 3300005441 Ga0070700_100010917 Ga0070700_1000109174 233
350 3300005444 Ga0070694_100287910 Ga0070694_1002879101 233
351 3300005455 Ga0070663_100063385 Ga0070663_1000633853 233
352 3300005455 Ga0070663_100416063 Ga0070663_1004160631 233
353 3300005456 Ga0070678_100028925 Ga0070678_1000289253 233
354 3300005456 Ga0070678_100296246 Ga0070678_1002962461 233
355 3300005457 Ga0070662_100043124 Ga0070662_1000431242 233
356 3300005459 Ga0068867_100133741 Ga0068867_1001337412 233
357 3300005466 Ga0070685_10046240 Ga0070685_100462403 233
358 3300005539 Ga0068853_100024683 Ga0068853_1000246834 233
359 3300005545 Ga0070695_100055867 Ga0070695_1000558672 233
360 3300005545 Ga0070695_100405504 Ga0070695_1004055042 233
361 3300005546 Ga0070696_100024989 Ga0070696_1000249894 233
362 3300005547 Ga0070693_100067435 Ga0070693_1000674353 233
363 3300005548 Ga0070665_100003013 Ga0070665_1000030134 233
364 3300005548 Ga0070665_100027844 Ga0070665_1000278444 233
365 3300005548 Ga0070665_100075491 Ga0070665_1000754912 233
366 3300005549 Ga0070704_100002135 Ga0070704_10000213510 233
367 3300005549 Ga0070704_100033410 Ga0070704_1000334104 233
368 3300005564 Ga0070664_100125355 Ga0070664_1001253552 233
369 3300005578 Ga0068854_100000630 Ga0068854_10000063015 233
370 3300005578 Ga0068854_100090814 Ga0068854_1000908142 233
371 3300005578 Ga0068854_100134966 Ga0068854_1001349662 233
372 3300005614 Ga0068856_100160713 Ga0068856_1001607132 233
373 3300005615 Ga0070702_100000790 Ga0070702_1000007908 233
374 3300005615 Ga0070702_100206733 Ga0070702_1002067332 233
375 3300005616 Ga0068852_100061558 Ga0068852_1000615583 233
376 3300005616 Ga0068852_100168042 Ga0068852_1001680422 233
377 3300005617 Ga0068859_100005238 Ga0068859_1000052384 233
378 3300005617 Ga0068859_100072360 Ga0068859_1000723602 233
379 3300005618 Ga0068864_100368031 Ga0068864_1003680312 233
380 3300005718 Ga0068866_10007220 Ga0068866_100072203 233
381 3300005719 Ga0068861_100002991 Ga0068861_10000299111 233
382 3300005719 Ga0068861_100757340 Ga0068861_1007573401 233
383 3300005841 Ga0068863_100035405 Ga0068863_1000354054 233
384 3300005841 Ga0068863_100416546 Ga0068863_1004165462 233
385 3300005842 Ga0068858_100220055 Ga0068858_1002200552 233
386 3300005843 Ga0068860_100002676 Ga0068860_10000267612 233
387 3300005843 Ga0068860_100052794 Ga0068860_1000527942 233
388 3300005844 Ga0068862_100005303 Ga0068862_1000053034 233
389 3300006038 Ga0075365_10002478 Ga0075365_100024783 233
390 3300006048 Ga0075363_100047914 Ga0075363_1000479142 233
391 3300006051 Ga0075364_10001593 Ga0075364_100015937 233
392 3300006163 Ga0070715_10001473 Ga0070715_100014735 233
393 3300006173 Ga0070716_100003182 Ga0070716_1000031823 233
394 3300006173 Ga0070716_100013912 Ga0070716_1000139122 233
395 3300006175 Ga0070712_100042742 Ga0070712_1000427423 233
396 3300006177 Ga0075362_10003816 Ga0075362_100038162 233
397 3300006178 Ga0075367_10007733 Ga0075367_100077333 233
398 3300006186 Ga0075369_10000862 Ga0075369_1000086210 233
399 3300006186 Ga0075369_10002150 Ga0075369_100021504 233
400 3300006237 Ga0097621_100433321 Ga0097621_1004333211 233
401 3300006358 Ga0068871_100149084 Ga0068871_1001490842 233
402 3300006931 Ga0097620_100005238 Ga0097620_1000052384 233
403 3300006931 Ga0097620_100072357 Ga0097620_1000723572 233
404 3300007788 Ga0099795_10042009 Ga0099795_100420091 233
405 3300009092 Ga0105250_10126648 Ga0105250_101266482 233
406 3300009092 Ga0105250_10207429 Ga0105250_102074291 233
407 3300009098 Ga0105245_10304822 Ga0105245_103048222 233
408 3300009101 Ga0105247_10000058 Ga0105247_10000058107 233
409 3300009101 Ga0105247_10000570 Ga0105247_100005702 233
410 3300009101 Ga0105247_10030307 Ga0105247_100303073 233
411 3300009147 Ga0114129_10366563 Ga0114129_103665632 233
412 3300009148 Ga0105243_10001753 Ga0105243_1000175313 233
413 3300009174 Ga0105241_10463878 Ga0105241_104638782 233
414 3300009176 Ga0105242_10000909 Ga0105242_100009094 233
415 3300009176 Ga0105242_10314795 Ga0105242_103147952 233
416 3300009177 Ga0105248_10000325 Ga0105248_100003254 233
417 3300009177 Ga0105248_10010646 Ga0105248_100106468 233
418 3300009177 Ga0105248_10155227 Ga0105248_101552272 233
419 3300009177 Ga0105248_10459240 Ga0105248_104592402 233
420 3300009545 Ga0105237_10033885 Ga0105237_100338851 233
421 3300009545 Ga0105237_10270874 Ga0105237_102708742 233
422 3300009551 Ga0105238_10109994 Ga0105238_101099942 233
423 3300009553 Ga0105249_10000087 Ga0105249_1000008732 233
424 3300009553 Ga0105249_10001452 Ga0105249_100014528 233
425 3300009553 Ga0105249_10179896 Ga0105249_101798962 233
426 3300010159 Ga0099796_10048894 Ga0099796_100488942 233
427 3300010375 Ga0105239_10004193 Ga0105239_100041937 233
428 3300013102 Ga0157371_10194850 Ga0157371_101948502 233
429 3300013105 Ga0157369_10935180 Ga0157369_109351801 233
430 3300013296 Ga0157374_10078134 Ga0157374_100781343 233
431 3300013297 Ga0157378_10000869 Ga0157378_100008698 233
432 3300013297 Ga0157378_10143708 Ga0157378_101437082 233
433 3300013306 Ga0163162_10025393 Ga0163162_100253934 233
434 3300013306 Ga0163162_10412549 Ga0163162_104125492 233
435 3300013307 Ga0157372_10021535 Ga0157372_100215354 233
436 3300013307 Ga0157372_10260324 Ga0157372_102603242 233
437 3300013308 Ga0157375_10079810 Ga0157375_100798103 233
438 3300014325 Ga0163163_10002753 Ga0163163_1000275313 233
439 3300014326 Ga0157380_10272803 Ga0157380_102728032 233
440 3300014745 Ga0157377_10050566 Ga0157377_100505663 233
441 3300014968 Ga0157379_10008443 Ga0157379_100084434 233
442 3300014968 Ga0157379_10253320 Ga0157379_102533202 233
443 3300014969 Ga0157376_10374191 Ga0157376_103741911 233
444 3300017792 Ga0163161_10005171 Ga0163161_100051718 233
445 3300025711 Ga0207696_1032663 Ga0207696_10326632 233
446 3300025898 Ga0207692_10000814 Ga0207692_100008144 233
447 3300025898 Ga0207692_10070552 Ga0207692_100705522 233
448 3300025899 Ga0207642_10000644 Ga0207642_1000064410 233
449 3300025901 Ga0207688_10001946 Ga0207688_100019466 233
450 3300025901 Ga0207688_10006102 Ga0207688_100061026 233
451 3300025904 Ga0207647_10086182 Ga0207647_100861823 233
452 3300025905 Ga0207685_10001708 Ga0207685_100017083 233
453 3300025906 Ga0207699_10085912 Ga0207699_100859122 233
454 3300025907 Ga0207645_10053987 Ga0207645_100539871 233
455 3300025907 Ga0207645_10060293 Ga0207645_100602933 233
456 3300025915 Ga0207693_10001502 Ga0207693_100015024 233
457 3300025916 Ga0207663_10001892 Ga0207663_100018929 233
458 3300025918 Ga0207662_10088083 Ga0207662_100880832 233
459 3300025919 Ga0207657_10195782 Ga0207657_101957822 233
460 3300025924 Ga0207694_10098702 Ga0207694_100987022 233
461 3300025925 Ga0207650_10307173 Ga0207650_103071732 233
462 3300025926 Ga0207659_10135336 Ga0207659_101353362 233
463 3300025927 Ga0207687_10001805 Ga0207687_100018059 233
464 3300025927 Ga0207687_10097814 Ga0207687_100978142 233
465 3300025931 Ga0207644_10067164 Ga0207644_100671642 233
466 3300025932 Ga0207690_10081976 Ga0207690_100819762 233
467 3300025934 Ga0207686_10313465 Ga0207686_103134652 233
468 3300025935 Ga0207709_10003346 Ga0207709_100033467 233
469 3300025935 Ga0207709_10095923 Ga0207709_100959232 233
470 3300025936 Ga0207670_10035996 Ga0207670_100359963 233
471 3300025936 Ga0207670_10206431 Ga0207670_102064312 233
472 3300025937 Ga0207669_10000374 Ga0207669_1000037413 233
473 3300025938 Ga0207704_10001199 Ga0207704_1000119910 233
474 3300025938 Ga0207704_10263603 Ga0207704_102636032 233
475 3300025939 Ga0207665_10000595 Ga0207665_1000059518 233
476 3300025939 Ga0207665_10002059 Ga0207665_100020594 233
477 3300025941 Ga0207711_10015782 Ga0207711_100157826 233
478 3300025942 Ga0207689_10046755 Ga0207689_100467553 233
479 3300025945 Ga0207679_10205496 Ga0207679_102054962 233
480 3300025949 Ga0207667_10203163 Ga0207667_102031632 233
481 3300025960 Ga0207651_10029288 Ga0207651_100292884 233
482 3300025960 Ga0207651_10365420 Ga0207651_103654201 233
483 3300025961 Ga0207712_10002257 Ga0207712_100022577 233
484 3300025961 Ga0207712_10195933 Ga0207712_101959331 233
485 3300025972 Ga0207668_10025467 Ga0207668_100254674 233
486 3300025972 Ga0207668_10110376 Ga0207668_101103762 233
487 3300025972 Ga0207668_10400468 Ga0207668_104004682 233
488 3300025972 Ga0207668_10667009 Ga0207668_106670091 233
489 3300025981 Ga0207640_10002335 Ga0207640_1000233510 233
490 3300025981 Ga0207640_10097099 Ga0207640_100970992 233
491 3300025981 Ga0207640_10281144 Ga0207640_102811441 233
492 3300025986 Ga0207658_10014508 Ga0207658_100145083 233
493 3300025986 Ga0207658_10044474 Ga0207658_100444742 233
494 3300026023 Ga0207677_10145948 Ga0207677_101459482 233
495 3300026035 Ga0207703_10026853 Ga0207703_100268534 233
496 3300026035 Ga0207703_10360041 Ga0207703_103600412 233
497 3300026035 Ga0207703_10474036 Ga0207703_104740361 233
498 3300026067 Ga0207678_10036482 Ga0207678_100364822 233
499 3300026075 Ga0207708_10000982 Ga0207708_1000098220 233
500 3300026075 Ga0207708_10004706 Ga0207708_100047069 233
501 3300026088 Ga0207641_10016504 Ga0207641_100165044 233
502 3300026088 Ga0207641_10221864 Ga0207641_102218642 233
503 3300026089 Ga0207648_10000599 Ga0207648_1000059926 233
504 3300026089 Ga0207648_10006604 Ga0207648_1000660415 233
505 3300026118 Ga0207675_100080332 Ga0207675_1000803324 233
506 3300026118 Ga0207675_100123489 Ga0207675_1001234891 233
507 3300026121 Ga0207683_10007631 Ga0207683_100076312 233
508 3300026121 Ga0207683_10111488 Ga0207683_101114882 233
509 3300026142 Ga0207698_10022934 Ga0207698_100229342 233
510 3300026142 Ga0207698_10155817 Ga0207698_101558173 233
511 3300028379 Ga0268266_10011626 Ga0268266_1001162610 233
512 3300028379 Ga0268266_10256744 Ga0268266_102567442 233
513 3300028380 Ga0268265_10032003 Ga0268265_100320033 233
514 3300028380 Ga0268265_10487995 Ga0268265_104879951 233
515 3300028381 Ga0268264_10004587 Ga0268264_1000458710 233
516 3300028381 Ga0268264_10616825 Ga0268264_106168252 233
517 3300031824 Ga0307413_10615925 Ga0307413_106159251 233
518 3300035115 Ga0373941_0033606 Ga0373941_0033606_629_1330 233
519 3300035691 Ga0373931_0089890 Ga0373931_0089890_560_1261 233
520 3300039450 Ga0436363_1310990 Ga0436363_1310990_601_1305 233
521 3300041411 Ga0439466_0005537 Ga0439466_0005537_3934_4638 233
522 3300041413 Ga0439465_0017299 Ga0439465_0017299_184_888 233
523 3300041443 Ga0451789_0443718 Ga0451789_0443718_727_1431 233
524 3300041997 Ga0439431_0034457 Ga0439431_0034457_428_1132 233
525 3300042002 Ga0439442_004448 Ga0439442_004448_101_805 233
526 3300042004 Ga0439445_0002825 Ga0439445_0002825_1283_1987 233
527 3300042435 Ga0439434_0014646 Ga0439434_0014646_1021_1725 233
528 3300044658 Ga0466972_0001669 Ga0466972_0001669_4749_5450 233
529 3300044658 Ga0466972_0009736 Ga0466972_0009736_2737_3441 233
530 3300044683 Ga0466965_0004402 Ga0466965_0004402_3717_4433 233
531 3300044683 Ga0466965_0016628 Ga0466965_0016628_2019_2720 233
532 3300044683 Ga0466965_0071608 Ga0466965_0071608_650_1354 233
533 3300044706 Ga0466964_0028839 Ga0466964_0028839_822_1523 233
534 3300044735 Ga0466968_0035826 Ga0466968_0035826_463_1164 233
535 3300044765 Ga0466970_0002428 Ga0466970_0002428_5460_6161 233
536 3300044842 Ga0466957_0018332 Ga0466957_0018332_1739_2440 233
537 3300044901 Ga0466960_0000201 Ga0466960_0000201_12096_12812 233
538 3300044901 Ga0466960_0001933 Ga0466960_0001933_1495_2196 233
539 3300044901 Ga0466960_0048242 Ga0466960_0048242_1126_1830 233
540 3300044901 Ga0466960_0210670 Ga0466960_0210670_203_907 233
541 3300045049 Ga0466959_0028309 Ga0466959_0028309_1346_2047 233
542 3300045976 Ga0466967_0086733 Ga0466967_0086733_1188_1895 233
543 3300045976 Ga0466967_0204257 Ga0466967_0204257_289_993 233
544 3300046460 Ga0495638_0000244 Ga0495638_0000244_47934_48647 233
545 3300046616 Ga0495668_0163045 Ga0495668_0163045_225_938 233
546 3300047320 Ga0495672_0092493 Ga0495672_0092493_535_1239 233
547 3300048903 Ga0496100_0017532 Ga0496100_0017532_1242_1943 233
548 3300048903 Ga0496100_0080538 Ga0496100_0080538_1042_1746 233
549 3300048903 Ga0496100_0240241 Ga0496100_0240241_37_741 233
550 3300048904 Ga0496101_0050228 Ga0496101_0050228_2010_2711 233
551 3300048904 Ga0496101_0233862 Ga0496101_0233862_200_904 233
552 3300048905 Ga0496102_0000594 Ga0496102_0000594_32586_33290 233
553 3300048905 Ga0496102_0024070 Ga0496102_0024070_2000_2701 233
554 3300048905 Ga0496102_0033049 Ga0496102_0033049_1573_2274 233
555 3300048905 Ga0496102_0128960 Ga0496102_0128960_994_1695 233
556 3300048905 Ga0496102_0206832 Ga0496102_0206832_1086_1787 233
557 3300048906 Ga0496103_0000450 Ga0496103_0000450_1427_2131 233
558 3300048906 Ga0496103_0005646 Ga0496103_0005646_462_1163 233
559 3300048906 Ga0496103_0035441 Ga0496103_0035441_2004_2708 233
560 3300048907 Ga0496104_0000418 Ga0496104_0000418_4860_5567 233
561 3300048907 Ga0496104_0050862 Ga0496104_0050862_2985_3689 233
562 3300048908 Ga0496105_0029102 Ga0496105_0029102_914_1618 233
563 3300048908 Ga0496105_0029487 Ga0496105_0029487_1567_2274 233
564 3300048909 Ga0496106_0001341 Ga0496106_0001341_12998_13699 233
565 3300048909 Ga0496106_0014139 Ga0496106_0014139_3161_3868 233
566 3300048909 Ga0496106_0014226 Ga0496106_0014226_2436_3137 233
567 3300048910 Ga0496107_0000392 Ga0496107_0000392_13431_14132 233
568 3300048910 Ga0496107_0022615 Ga0496107_0022615_1187_1894 233
569 3300048910 Ga0496107_0108430 Ga0496107_0108430_1168_1869 233
570 3300048911 Ga0496108_0004384 Ga0496108_0004384_8854_9555 233
571 3300048911 Ga0496108_0134855 Ga0496108_0134855_207_911 233
572 3300048912 Ga0496109_0006296 Ga0496109_0006296_4901_5602 233
573 3300048912 Ga0496109_0031691 Ga0496109_0031691_3437_4141 233
574 3300048912 Ga0496109_0081120 Ga0496109_0081120_1276_1980 233
575 3300048912 Ga0496109_0917108 Ga0496109_0917108_43_747 233
576 3300048913 Ga0496110_0044601 Ga0496110_0044601_36_740 233
577 3300048913 Ga0496110_0080650 Ga0496110_0080650_1697_2401 233
578 3300048913 Ga0496110_0238058 Ga0496110_0238058_815_1516 233
579 3300048914 Ga0496111_0174712 Ga0496111_0174712_743_1444 233
580 3300048915 Ga0496112_0006704 Ga0496112_0006704_4169_4873 233
581 3300048915 Ga0496112_0034049 Ga0496112_0034049_2267_2971 233
582 3300048915 Ga0496112_0056529 Ga0496112_0056529_2074_2775 233
583 3300048915 Ga0496112_0088656 Ga0496112_0088656_801_1505 233
584 3300048915 Ga0496112_0102352 Ga0496112_0102352_1481_2185 233
585 3300048916 Ga0496113_0313402 Ga0496113_0313402_76_777 233
586 3300048917 Ga0496114_0002485 Ga0496114_0002485_10438_11145 233
587 3300048917 Ga0496114_0017992 Ga0496114_0017992_4812_5513 233
588 3300048917 Ga0496114_0047285 Ga0496114_0047285_2489_3190 233
589 3300048918 Ga0496115_0103122 Ga0496115_0103122_34_735 233
590 3300048919 Ga0496116_0007028 Ga0496116_0007028_3965_4669 233
591 3300048920 Ga0496117_0000206 Ga0496117_0000206_80395_81099 233
592 3300048921 Ga0496118_0000905 Ga0496118_0000905_11663_12367 233
593 3300048922 Ga0496119_0005342 Ga0496119_0005342_964_1668 233
594 3300048923 Ga0496120_0017809 Ga0496120_0017809_2137_2841 233
595 3300048924 Ga0496121_0014805 Ga0496121_0014805_3318_4022 233
596 3300048928 Ga0496125_0081135 Ga0496125_0081135_414_1118 233
597 3300048929 Ga0496126_0025068 Ga0496126_0025068_1582_2286 233
598 3300049569 Ga0501032_0002220 Ga0501032_0002220_9638_10345 233
599 3300049571 Ga0501034_0016305 Ga0501034_0016305_3603_4310 233
600 3300049572 Ga0501036_0022652 Ga0501036_0022652_4540_5247 233
601 3300049573 Ga0501037_0001024 Ga0501037_0001024_8187_8894 233
602 3300049574 Ga0501038_0008021 Ga0501038_0008021_4562_5269 233
603 3300049575 Ga0501039_0001582 Ga0501039_0001582_6705_7412 233
604 3300049579 Ga0501043_0002179 Ga0501043_0002179_5355_6062 233
605 3300049586 Ga0501070_0002467 Ga0501070_0002467_4837_5544 233
606 3300049589 Ga0501073_0045427 Ga0501073_0045427_1529_2236 233
607 3300049593 Ga0501077_0224723 Ga0501077_0224723_35_742 233
608 3300050489 nmdc:mga03683_3424_c1 nmdc:mga03683_3424_c1_227_931 233
609 3300050490 nmdc:mga03n38_93749_c1 nmdc:mga03n38_93749_c1_66_770 233
610 3300050491 nmdc:mga00v17_143562_c1 nmdc:mga00v17_143562_c1_34_738 233
611 3300050491 nmdc:mga00v17_202750_c1 nmdc:mga00v17_202750_c1_394_1119 233
612 3300050516 nmdc:mga0sz30_53687_c1 nmdc:mga0sz30_53687_c1_301_1005 233
613 3300053079 Ga0500610_0005649 Ga0500610_0005649_97_810 233
614 3300053104 Ga0500556_0002637 Ga0500556_0002637_2522_3235 233
615 3300053108 Ga0500562_006222 Ga0500562_006222_221_928 233
616 3300053139 Ga0500568_0039594 Ga0500568_0039594_876_1589 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02742

Fe_dep_repr_C

Iron dependent repressor, metal binding and dimerisation domain

105

174

0.99

PF01325

Fe_dep_repress

Iron dependent repressor, N-terminal DNA binding domain

42

102

0.96

PF04023

FeoA

FeoA domain

185

256

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zr6-assembly1.cif.gz_B manganese-dependent transcriptional repressor complex with manganese 0.9847 14 232
5zr6-assembly1.cif.gz_A manganese-dependent transcriptional repressor complex with manganese 0.9813 14 233
5zr4-assembly1.cif.gz_A manganese-dependent transcriptional repressor 0.9747 15 232
5zr6-assembly1.cif.gz_A manganese-dependent transcriptional repressor complex with manganese 0.9678 14 233
5zr6-assembly1.cif.gz_B manganese-dependent transcriptional repressor complex with manganese 0.9662 14 232
ID Description Score Start End Superfamily
af_I6Y1Q2_8_79_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1.008 9 79 1.10.10.10
af_I6Y1Q2_8_79_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9803 9 79 1.10.10.10
af_I6Y1Q2_151_228_2.30.30.90 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.9687 151 233 2.30.30.90
af_Q57988_1_71_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9571 10 79 1.10.10.10
af_I6Y1Q2_151_228_2.30.30.90 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.9564 151 233 2.30.30.90
ID Description Score Start End GO Terms
AF-A0A231HFR8-F1-model_v4 Manganese transport regulator 0.9904 21 233 GO:0003700
GO:0005737
GO:0043565
GO:0045892
GO:0046914
GO:0046983
AF-A0A399PJQ1-F1-model_v4 Manganese transport regulator 0.983 5 187 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A1H1LF58-F1-model_v4 Manganese transport regulator 0.9819 10 233 GO:0003677
GO:0003700
GO:0005737
GO:0045892
GO:0046914
GO:0046983
AF-A0A231HFR8-F1-model_v4 Manganese transport regulator 0.9809 21 233 GO:0003700
GO:0005737
GO:0043565
GO:0045892
GO:0046914
GO:0046983
AF-A0A1A3SL69-F1-model_v4 Manganese transport regulator 0.9802 1 233 GO:0003700
GO:0005737
GO:0043565
GO:0045892
GO:0046914
GO:0046983

Feature Viewer

pLDDT pTM Quality
90.35 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map