F469594
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 616 | 321 | 581 | 229 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2808606372|2808900363 |
| Length | 256 |
| Sequence | GVPPIAHGGGPASRGRPEFEPPVRAQAATAADRPGILRPMPATSPAIEDYLKTVYAHTEWQPDAITPKVLADRLGVAPSSVTEMVKKMAAAGLVSHVPYGAVRLTADGTAEALAVVRRHRLIETWLVQEMGYGWDEVHDEAEILEHAISDRLLEAIDARLGRPVRDPHGDPIPRSDGTLERRPTLLLAEASPGHSGAVVRISDRDPGVLRALDEAGIGLDAELTVTDVAAASVDVTIGSRAHTLPRAAAEVIWVTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 2 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 3 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 4 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 5 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 6 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 7 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 8 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 9 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 10 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 11 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 12 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 13 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 14 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 15 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 16 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 17 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 18 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 19 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 20 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 21 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 22 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 23 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 24 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 25 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 26 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 27 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 28 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 29 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 30 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 31 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 32 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 33 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 34 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 35 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 36 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 37 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 38 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 39 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 40 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 210 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 211 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 212 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 217 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 218 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 219 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 220 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 221 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 222 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 223 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 279 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 280 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 281 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 313 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 314 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 315 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 316 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 318 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 319 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 320 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 321 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.32 |
| Metatranscriptomes | 0 |
| Isolates | 5.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0 |
| Endosphere | 8.28 |
| Nodule | 0.16 |
| Rhizoplane | 12.66 |
| Rhizosphere | 65.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1007734 | 3300001977 | Bacteria | 1636 |
| 2 | JGI24739J22299_10085623 | 3300001989 | Bacteria | 963 |
| 3 | JGI24750J21931_1001193 | 3300002070 | Bacteria | 3313 |
| 4 | JGI24744J21845_10002079 | 3300002077 | Bacteria | 4059 |
| 5 | JGI24744J21845_10007863 | 3300002077 | Bacteria | 2202 |
| 6 | JGI24034J26672_10013415 | 3300002239 | Bacteria | 1243 |
| 7 | JGI24742J22300_10000911 | 3300002244 | Bacteria | 4514 |
| 8 | JGI24742J22300_10032469 | 3300002244 | Bacteria | 915 |
| 9 | Ga0055540_1000029 | 3300003792 | Bacteria | 179894 |
| 10 | Ga0055540_1002534 | 3300003792 | Bacteria | 9539 |
| 11 | Ga0055540_1003364 | 3300003792 | Bacteria | 7756 |
| 12 | Ga0055540_1015764 | 3300003792 | Bacteria | 2181 |
| 13 | Ga0070676_10061696 | 3300005328 | Bacteria | 2228 |
| 14 | Ga0070683_100146586 | 3300005329 | Bacteria | 2237 |
| 15 | Ga0068869_100205057 | 3300005334 | Bacteria | 1556 |
| 16 | Ga0070666_10052854 | 3300005335 | Bacteria | 2739 |
| 17 | Ga0070666_10202667 | 3300005335 | Bacteria | 1396 |
| 18 | Ga0070666_10225083 | 3300005335 | Bacteria | 1324 |
| 19 | Ga0070682_100015442 | 3300005337 | Bacteria | 4425 |
| 20 | Ga0070682_100029056 | 3300005337 | Bacteria | 3328 |
| 21 | Ga0068868_100001612 | 3300005338 | Bacteria | 15394 |
| 22 | Ga0070689_100030572 | 3300005340 | Bacteria | 4089 |
| 23 | Ga0070691_10014157 | 3300005341 | Bacteria | 3658 |
| 24 | Ga0070668_100011834 | 3300005347 | Bacteria | 6500 |
| 25 | Ga0070668_100022683 | 3300005347 | Bacteria | 4746 |
| 26 | Ga0070668_100135030 | 3300005347 | Bacteria | 1983 |
| 27 | Ga0070668_100208673 | 3300005347 | Bacteria | 1606 |
| 28 | Ga0070668_100534600 | 3300005347 | Bacteria | 1018 |
| 29 | Ga0070675_100128870 | 3300005354 | Bacteria | 2154 |
| 30 | Ga0070674_100002940 | 3300005356 | Bacteria | 9445 |
| 31 | Ga0070674_100065393 | 3300005356 | Bacteria | 2552 |
| 32 | Ga0070673_100091600 | 3300005364 | Bacteria | 2485 |
| 33 | Ga0070688_100032775 | 3300005365 | Bacteria | 3136 |
| 34 | Ga0070659_100086836 | 3300005366 | Bacteria | 2504 |
| 35 | Ga0070667_100000630 | 3300005367 | Bacteria | 34283 |
| 36 | Ga0070667_100000831 | 3300005367 | Bacteria | 28698 |
| 37 | Ga0070667_100046633 | 3300005367 | Bacteria | 3646 |
| 38 | Ga0070667_100268632 | 3300005367 | Bacteria | 1529 |
| 39 | Ga0070709_10011706 | 3300005434 | Bacteria | 4898 |
| 40 | Ga0070709_10086658 | 3300005434 | Bacteria | 2056 |
| 41 | Ga0070714_100213327 | 3300005435 | Bacteria | 1770 |
| 42 | Ga0070714_100663178 | 3300005435 | Bacteria | 1005 |
| 43 | Ga0070710_10001814 | 3300005437 | Bacteria | 10084 |
| 44 | Ga0070710_10030703 | 3300005437 | Bacteria | 2893 |
| 45 | Ga0070711_100004140 | 3300005439 | Bacteria | 8526 |
| 46 | Ga0070711_100021930 | 3300005439 | Bacteria | 4133 |
| 47 | Ga0070705_100033952 | 3300005440 | Bacteria | 2848 |
| 48 | Ga0070700_100010917 | 3300005441 | Bacteria | 5023 |
| 49 | Ga0070694_100287910 | 3300005444 | Bacteria | 1255 |
| 50 | Ga0070663_100063385 | 3300005455 | Bacteria | 2669 |
| 51 | Ga0070663_100416063 | 3300005455 | Bacteria | 1102 |
| 52 | Ga0070678_100028925 | 3300005456 | Bacteria | 3787 |
| 53 | Ga0070678_100095400 | 3300005456 | Bacteria | 2292 |
| 54 | Ga0070678_100296246 | 3300005456 | Bacteria | 1373 |
| 55 | Ga0070662_100043124 | 3300005457 | Bacteria | 3226 |
| 56 | Ga0070681_10725468 | 3300005458 | Bacteria | 910 |
| 57 | Ga0068867_100133741 | 3300005459 | Bacteria | 1930 |
| 58 | Ga0070685_10046240 | 3300005466 | Bacteria | 2498 |
| 59 | Ga0068853_100024683 | 3300005539 | Bacteria | 5042 |
| 60 | Ga0068853_100050178 | 3300005539 | Bacteria | 3589 |
| 61 | Ga0070695_100055867 | 3300005545 | Bacteria | 2546 |
| 62 | Ga0070695_100405504 | 3300005545 | Bacteria | 1034 |
| 63 | Ga0070696_100024989 | 3300005546 | Bacteria | 4060 |
| 64 | Ga0070693_100067435 | 3300005547 | Bacteria | 2097 |
| 65 | Ga0070665_100003013 | 3300005548 | Bacteria | 18167 |
| 66 | Ga0070665_100008244 | 3300005548 | Bacteria | 10544 |
| 67 | Ga0070665_100027844 | 3300005548 | Bacteria | 5691 |
| 68 | Ga0070665_100075491 | 3300005548 | Bacteria | 3378 |
| 69 | Ga0070704_100002135 | 3300005549 | Bacteria | 11006 |
| 70 | Ga0070704_100033410 | 3300005549 | Bacteria | 3477 |
| 71 | Ga0070704_100181471 | 3300005549 | Bacteria | 1684 |
| 72 | Ga0070664_100125355 | 3300005564 | Bacteria | 2252 |
| 73 | Ga0068854_100000630 | 3300005578 | Bacteria | 20862 |
| 74 | Ga0068854_100090814 | 3300005578 | Bacteria | 2272 |
| 75 | Ga0068854_100134966 | 3300005578 | Bacteria | 1888 |
| 76 | Ga0068856_100160713 | 3300005614 | Bacteria | 2257 |
| 77 | Ga0070702_100000790 | 3300005615 | Bacteria | 12044 |
| 78 | Ga0070702_100206733 | 3300005615 | Bacteria | 1303 |
| 79 | Ga0068852_100061558 | 3300005616 | Bacteria | 3262 |
| 80 | Ga0068852_100168042 | 3300005616 | Bacteria | 2054 |
| 81 | Ga0068859_100005238 | 3300005617 | Bacteria | 13175 |
| 82 | Ga0068859_100011242 | 3300005617 | Bacteria | 9005 |
| 83 | Ga0068859_100072360 | 3300005617 | Bacteria | 3484 |
| 84 | Ga0068859_100891845 | 3300005617 | Bacteria | 974 |
| 85 | Ga0068864_100368031 | 3300005618 | Bacteria | 1360 |
| 86 | Ga0068866_10007220 | 3300005718 | Bacteria | 4648 |
| 87 | Ga0068861_100002991 | 3300005719 | Bacteria | 11156 |
| 88 | Ga0068861_100757340 | 3300005719 | Bacteria | 908 |
| 89 | Ga0068863_100001801 | 3300005841 | Bacteria | 21265 |
| 90 | Ga0068863_100035405 | 3300005841 | Bacteria | 4755 |
| 91 | Ga0068863_100416546 | 3300005841 | Bacteria | 1316 |
| 92 | Ga0068858_100037254 | 3300005842 | Bacteria | 4509 |
| 93 | Ga0068858_100200083 | 3300005842 | Bacteria | 1889 |
| 94 | Ga0068858_100220055 | 3300005842 | Bacteria | 1798 |
| 95 | Ga0068860_100000231 | 3300005843 | Bacteria | 86110 |
| 96 | Ga0068860_100002676 | 3300005843 | Bacteria | 18553 |
| 97 | Ga0068860_100052794 | 3300005843 | Bacteria | 3865 |
| 98 | Ga0068862_100000060 | 3300005844 | Bacteria | 133781 |
| 99 | Ga0068862_100005303 | 3300005844 | Bacteria | 10802 |
| 100 | Ga0075365_10002478 | 3300006038 | Bacteria | 9075 |
| 101 | Ga0075365_10008621 | 3300006038 | Bacteria | 5806 |
| 102 | Ga0075365_10031963 | 3300006038 | Bacteria | 3380 |
| 103 | Ga0075365_10086747 | 3300006038 | Bacteria | 2127 |
| 104 | Ga0075363_100002167 | 3300006048 | Bacteria | 7901 |
| 105 | Ga0075363_100031886 | 3300006048 | Bacteria | 2734 |
| 106 | Ga0075363_100047914 | 3300006048 | Bacteria | 2271 |
| 107 | Ga0075364_10001593 | 3300006051 | Bacteria | 12402 |
| 108 | Ga0075364_10028730 | 3300006051 | Bacteria | 3561 |
| 109 | Ga0075364_10117578 | 3300006051 | Bacteria | 1778 |
| 110 | Ga0070715_10001473 | 3300006163 | Bacteria | 6844 |
| 111 | Ga0070716_100003182 | 3300006173 | Bacteria | 7691 |
| 112 | Ga0070716_100013912 | 3300006173 | Bacteria | 4112 |
| 113 | Ga0070712_100042742 | 3300006175 | Bacteria | 3117 |
| 114 | Ga0075362_10003816 | 3300006177 | Bacteria | 5342 |
| 115 | Ga0075367_10007733 | 3300006178 | Bacteria | 5526 |
| 116 | Ga0075369_10000862 | 3300006186 | Bacteria | 10038 |
| 117 | Ga0075369_10002150 | 3300006186 | Bacteria | 6959 |
| 118 | Ga0075369_10038054 | 3300006186 | Bacteria | 2051 |
| 119 | Ga0097621_100433321 | 3300006237 | Bacteria | 1182 |
| 120 | Ga0075370_10006244 | 3300006353 | Bacteria | 5979 |
| 121 | Ga0075370_10007350 | 3300006353 | Bacteria | 5606 |
| 122 | Ga0068871_100149084 | 3300006358 | Bacteria | 1994 |
| 123 | Ga0075428_100014477 | 3300006844 | Bacteria | 8760 |
| 124 | Ga0075430_100234431 | 3300006846 | Bacteria | 1521 |
| 125 | Ga0075431_100054720 | 3300006847 | Bacteria | 4115 |
| 126 | Ga0097620_100005238 | 3300006931 | Bacteria | 13175 |
| 127 | Ga0097620_100011242 | 3300006931 | Bacteria | 9005 |
| 128 | Ga0097620_100072357 | 3300006931 | Bacteria | 3484 |
| 129 | Ga0097620_100891894 | 3300006931 | Bacteria | 974 |
| 130 | Ga0099795_10042009 | 3300007788 | Bacteria | 1630 |
| 131 | Ga0105244_10069180 | 3300009036 | Bacteria | 1763 |
| 132 | Ga0105250_10033787 | 3300009092 | Bacteria | 2053 |
| 133 | Ga0105250_10126648 | 3300009092 | Bacteria | 1052 |
| 134 | Ga0105250_10207429 | 3300009092 | Bacteria | 828 |
| 135 | Ga0111539_10466556 | 3300009094 | Bacteria | 1470 |
| 136 | Ga0105245_10304822 | 3300009098 | Bacteria | 1564 |
| 137 | Ga0105245_10419384 | 3300009098 | Bacteria | 1341 |
| 138 | Ga0105247_10000058 | 3300009101 | Bacteria | 131442 |
| 139 | Ga0105247_10000570 | 3300009101 | Bacteria | 30023 |
| 140 | Ga0105247_10030307 | 3300009101 | Bacteria | 3278 |
| 141 | Ga0105247_10128028 | 3300009101 | Bacteria | 1652 |
| 142 | Ga0114129_10041263 | 3300009147 | Bacteria | 6503 |
| 143 | Ga0114129_10366563 | 3300009147 | Bacteria | 1905 |
| 144 | Ga0105243_10001753 | 3300009148 | Bacteria | 18673 |
| 145 | Ga0105241_10463878 | 3300009174 | Bacteria | 1123 |
| 146 | Ga0105242_10000909 | 3300009176 | Bacteria | 23018 |
| 147 | Ga0105242_10314795 | 3300009176 | Bacteria | 1434 |
| 148 | Ga0105242_10582979 | 3300009176 | Bacteria | 1077 |
| 149 | Ga0105248_10000325 | 3300009177 | Bacteria | 56490 |
| 150 | Ga0105248_10010646 | 3300009177 | Bacteria | 10143 |
| 151 | Ga0105248_10155227 | 3300009177 | Bacteria | 2583 |
| 152 | Ga0105248_10459240 | 3300009177 | Bacteria | 1436 |
| 153 | Ga0105248_10514539 | 3300009177 | Bacteria | 1350 |
| 154 | Ga0105237_10008410 | 3300009545 | Bacteria | 11180 |
| 155 | Ga0105237_10033885 | 3300009545 | Bacteria | 5174 |
| 156 | Ga0105237_10270874 | 3300009545 | Bacteria | 1701 |
| 157 | Ga0105238_10109994 | 3300009551 | Bacteria | 2737 |
| 158 | Ga0105249_10000087 | 3300009553 | Bacteria | 131590 |
| 159 | Ga0105249_10001452 | 3300009553 | Bacteria | 20756 |
| 160 | Ga0105249_10179896 | 3300009553 | Bacteria | 2057 |
| 161 | Ga0099796_10048894 | 3300010159 | Bacteria | 1460 |
| 162 | Ga0105239_10004193 | 3300010375 | Bacteria | 17314 |
| 163 | Ga0105239_10006534 | 3300010375 | Bacteria | 13508 |
| 164 | Ga0105239_10051721 | 3300010375 | Bacteria | 4503 |
| 165 | Ga0105246_10070110 | 3300011119 | Bacteria | 2464 |
| 166 | Ga0157371_10194850 | 3300013102 | Bacteria | 1451 |
| 167 | Ga0157369_10935180 | 3300013105 | Bacteria | 888 |
| 168 | Ga0171462_1002 | 3300013250 | Bacteria | 1052134 |
| 169 | Ga0157374_10078134 | 3300013296 | Bacteria | 3134 |
| 170 | Ga0157378_10000869 | 3300013297 | Bacteria | 27899 |
| 171 | Ga0157378_10143708 | 3300013297 | Bacteria | 2218 |
| 172 | Ga0163162_10025393 | 3300013306 | Bacteria | 5853 |
| 173 | Ga0163162_10058625 | 3300013306 | Bacteria | 3880 |
| 174 | Ga0163162_10412549 | 3300013306 | Bacteria | 1483 |
| 175 | Ga0157372_10021535 | 3300013307 | Bacteria | 6966 |
| 176 | Ga0157372_10260324 | 3300013307 | Bacteria | 2014 |
| 177 | Ga0157375_10079810 | 3300013308 | Bacteria | 3309 |
| 178 | Ga0163163_10002753 | 3300014325 | Bacteria | 14829 |
| 179 | Ga0157380_10272803 | 3300014326 | Bacteria | 1543 |
| 180 | Ga0157377_10050566 | 3300014745 | Bacteria | 2341 |
| 181 | Ga0157379_10008443 | 3300014968 | Bacteria | 8955 |
| 182 | Ga0157379_10253320 | 3300014968 | Bacteria | 1598 |
| 183 | Ga0157376_10374191 | 3300014969 | Bacteria | 1370 |
| 184 | Ga0163161_10005171 | 3300017792 | Bacteria | 9075 |
| 185 | Ga0213876_10009186 | 3300021384 | Bacteria | 5323 |
| 186 | Ga0209646_1000014 | 3300025246 | Bacteria | 550484 |
| 187 | Ga0209051_1000042 | 3300025303 | Bacteria | 308486 |
| 188 | Ga0209051_1000581 | 3300025303 | Bacteria | 43508 |
| 189 | Ga0209051_1010244 | 3300025303 | Bacteria | 4757 |
| 190 | Ga0209051_1025671 | 3300025303 | Bacteria | 2391 |
| 191 | Ga0209051_1045594 | 3300025303 | Bacteria | 1516 |
| 192 | Ga0207696_1032663 | 3300025711 | Bacteria | 1565 |
| 193 | Ga0207692_10000814 | 3300025898 | Bacteria | 11143 |
| 194 | Ga0207692_10070552 | 3300025898 | Bacteria | 1839 |
| 195 | Ga0207642_10000644 | 3300025899 | Bacteria | 10712 |
| 196 | Ga0207710_10000085 | 3300025900 | Bacteria | 131447 |
| 197 | Ga0207688_10001946 | 3300025901 | Bacteria | 11061 |
| 198 | Ga0207688_10006102 | 3300025901 | Bacteria | 6554 |
| 199 | Ga0207680_10098755 | 3300025903 | Bacteria | 1872 |
| 200 | Ga0207647_10086182 | 3300025904 | Bacteria | 1877 |
| 201 | Ga0207685_10001708 | 3300025905 | Bacteria | 4751 |
| 202 | Ga0207699_10085912 | 3300025906 | Bacteria | 1963 |
| 203 | Ga0207645_10053987 | 3300025907 | Bacteria | 2567 |
| 204 | Ga0207645_10060293 | 3300025907 | Bacteria | 2422 |
| 205 | Ga0207705_10504232 | 3300025909 | Bacteria | 940 |
| 206 | Ga0207671_10008558 | 3300025914 | Bacteria | 8657 |
| 207 | Ga0207693_10001502 | 3300025915 | Bacteria | 20587 |
| 208 | Ga0207663_10001892 | 3300025916 | Bacteria | 9898 |
| 209 | Ga0207662_10088083 | 3300025918 | Bacteria | 1906 |
| 210 | Ga0207657_10195782 | 3300025919 | Bacteria | 1628 |
| 211 | Ga0207652_10660812 | 3300025921 | Bacteria | 934 |
| 212 | Ga0207681_10004313 | 3300025923 | Bacteria | 8781 |
| 213 | Ga0207694_10098702 | 3300025924 | Bacteria | 2313 |
| 214 | Ga0207650_10307173 | 3300025925 | Bacteria | 1297 |
| 215 | Ga0207659_10135336 | 3300025926 | Bacteria | 1907 |
| 216 | Ga0207687_10001805 | 3300025927 | Bacteria | 14728 |
| 217 | Ga0207687_10097814 | 3300025927 | Bacteria | 2154 |
| 218 | Ga0207687_10348566 | 3300025927 | Bacteria | 1206 |
| 219 | Ga0207664_10182481 | 3300025929 | Bacteria | 1802 |
| 220 | Ga0207644_10067164 | 3300025931 | Bacteria | 2613 |
| 221 | Ga0207690_10081976 | 3300025932 | Bacteria | 2255 |
| 222 | Ga0207690_10433789 | 3300025932 | Bacteria | 1053 |
| 223 | Ga0207686_10313465 | 3300025934 | Bacteria | 1169 |
| 224 | Ga0207709_10003346 | 3300025935 | Bacteria | 9595 |
| 225 | Ga0207709_10032619 | 3300025935 | Bacteria | 3051 |
| 226 | Ga0207709_10095923 | 3300025935 | Bacteria | 1950 |
| 227 | Ga0207670_10035996 | 3300025936 | Bacteria | 3216 |
| 228 | Ga0207670_10206431 | 3300025936 | Bacteria | 1495 |
| 229 | Ga0207669_10000374 | 3300025937 | Bacteria | 20104 |
| 230 | Ga0207704_10001199 | 3300025938 | Bacteria | 11545 |
| 231 | Ga0207704_10263603 | 3300025938 | Bacteria | 1300 |
| 232 | Ga0207665_10000595 | 3300025939 | Bacteria | 24296 |
| 233 | Ga0207665_10002059 | 3300025939 | Bacteria | 13550 |
| 234 | Ga0207665_10285344 | 3300025939 | Bacteria | 1230 |
| 235 | Ga0207711_10000893 | 3300025941 | Bacteria | 28700 |
| 236 | Ga0207711_10015782 | 3300025941 | Bacteria | 6266 |
| 237 | Ga0207689_10046755 | 3300025942 | Bacteria | 3576 |
| 238 | Ga0207679_10205496 | 3300025945 | Bacteria | 1648 |
| 239 | Ga0207667_10203163 | 3300025949 | Bacteria | 2032 |
| 240 | Ga0207651_10029288 | 3300025960 | Bacteria | 3487 |
| 241 | Ga0207651_10365420 | 3300025960 | Bacteria | 1219 |
| 242 | Ga0207712_10000040 | 3300025961 | Bacteria | 180255 |
| 243 | Ga0207712_10002257 | 3300025961 | Bacteria | 12516 |
| 244 | Ga0207712_10195933 | 3300025961 | Bacteria | 1598 |
| 245 | Ga0207668_10025467 | 3300025972 | Bacteria | 3829 |
| 246 | Ga0207668_10110376 | 3300025972 | Bacteria | 2062 |
| 247 | Ga0207668_10400468 | 3300025972 | Bacteria | 1160 |
| 248 | Ga0207668_10667009 | 3300025972 | Bacteria | 911 |
| 249 | Ga0207640_10002335 | 3300025981 | Bacteria | 10195 |
| 250 | Ga0207640_10097099 | 3300025981 | Bacteria | 2056 |
| 251 | Ga0207640_10281144 | 3300025981 | Bacteria | 1307 |
| 252 | Ga0207658_10000740 | 3300025986 | Bacteria | 28154 |
| 253 | Ga0207658_10004291 | 3300025986 | Bacteria | 9930 |
| 254 | Ga0207658_10014508 | 3300025986 | Bacteria | 5395 |
| 255 | Ga0207658_10044474 | 3300025986 | Bacteria | 3233 |
| 256 | Ga0207677_10145948 | 3300026023 | Bacteria | 1818 |
| 257 | Ga0207703_10026853 | 3300026035 | Bacteria | 4534 |
| 258 | Ga0207703_10360041 | 3300026035 | Bacteria | 1341 |
| 259 | Ga0207703_10474036 | 3300026035 | Bacteria | 1172 |
| 260 | Ga0207639_10011231 | 3300026041 | Bacteria | 6212 |
| 261 | Ga0207678_10036482 | 3300026067 | Bacteria | 4279 |
| 262 | Ga0207678_10581084 | 3300026067 | Bacteria | 981 |
| 263 | Ga0207708_10000982 | 3300026075 | Bacteria | 21374 |
| 264 | Ga0207708_10004706 | 3300026075 | Bacteria | 10034 |
| 265 | Ga0207641_10001736 | 3300026088 | Bacteria | 21039 |
| 266 | Ga0207641_10016504 | 3300026088 | Bacteria | 6047 |
| 267 | Ga0207641_10221864 | 3300026088 | Bacteria | 1753 |
| 268 | Ga0207648_10000599 | 3300026089 | Bacteria | 40518 |
| 269 | Ga0207648_10006604 | 3300026089 | Bacteria | 11518 |
| 270 | Ga0207674_10103385 | 3300026116 | Bacteria | 2828 |
| 271 | Ga0207675_100080332 | 3300026118 | Bacteria | 3057 |
| 272 | Ga0207675_100123489 | 3300026118 | Bacteria | 2451 |
| 273 | Ga0207675_100176934 | 3300026118 | Bacteria | 2042 |
| 274 | Ga0207683_10007631 | 3300026121 | Bacteria | 9265 |
| 275 | Ga0207683_10111488 | 3300026121 | Bacteria | 2450 |
| 276 | Ga0207698_10022934 | 3300026142 | Bacteria | 4352 |
| 277 | Ga0207698_10155817 | 3300026142 | Bacteria | 1990 |
| 278 | Ga0207428_10330208 | 3300027907 | Bacteria | 1125 |
| 279 | Ga0268266_10011626 | 3300028379 | Bacteria | 7642 |
| 280 | Ga0268266_10256744 | 3300028379 | Bacteria | 1618 |
| 281 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 282 | Ga0268265_10032003 | 3300028380 | Bacteria | 3804 |
| 283 | Ga0268265_10487995 | 3300028380 | Bacteria | 1158 |
| 284 | Ga0268264_10000133 | 3300028381 | Bacteria | 179929 |
| 285 | Ga0268264_10004587 | 3300028381 | Bacteria | 11745 |
| 286 | Ga0268264_10616825 | 3300028381 | Bacteria | 1070 |
| 287 | Ga0265327_10001843 | 3300031251 | Bacteria | 24600 |
| 288 | Ga0307413_10615925 | 3300031824 | Bacteria | 891 |
| 289 | Ga0307410_10003289 | 3300031852 | Bacteria | 8072 |
| 290 | Ga0307407_10018506 | 3300031903 | Bacteria | 3525 |
| 291 | Ga0307407_10363796 | 3300031903 | Bacteria | 1028 |
| 292 | Ga0307409_100043962 | 3300031995 | Bacteria | 3360 |
| 293 | Ga0307409_100251989 | 3300031995 | Bacteria | 1615 |
| 294 | Ga0307416_100008398 | 3300032002 | Bacteria | 6661 |
| 295 | Ga0307416_100827475 | 3300032002 | Bacteria | 1023 |
| 296 | Ga0307414_10159723 | 3300032004 | Bacteria | 1789 |
| 297 | Ga0307414_10324032 | 3300032004 | Bacteria | 1313 |
| 298 | Ga0307414_10631887 | 3300032004 | Bacteria | 963 |
| 299 | Ga0307411_10054018 | 3300032005 | Bacteria | 2635 |
| 300 | Ga0307415_100818546 | 3300032126 | Bacteria | 852 |
| 301 | Ga0373941_0033606 | 3300035115 | Bacteria | 1543 |
| 302 | Ga0373931_0089890 | 3300035691 | Bacteria | 1709 |
| 303 | Ga0316584_0040693 | 3300036712 | Bacteria | 3463 |
| 304 | Ga0395905_0244100 | 3300037471 | Bacteria | 1678 |
| 305 | Ga0436364_0385449 | 3300037853 | Bacteria | 4473 |
| 306 | Ga0436364_0572184 | 3300037853 | Bacteria | 5912 |
| 307 | Ga0436365_0259894 | 3300039437 | Bacteria | 19688 |
| 308 | Ga0436365_1378611 | 3300039437 | Bacteria | 178407 |
| 309 | Ga0436365_1469068 | 3300039437 | Bacteria | 36678 |
| 310 | Ga0436363_0540344 | 3300039450 | Bacteria | 860 |
| 311 | Ga0436363_1310990 | 3300039450 | Bacteria | 1508 |
| 312 | Ga0439461_0008188 | 3300041410 | Bacteria | 1868 |
| 313 | Ga0439466_0002959 | 3300041411 | Bacteria | 6635 |
| 314 | Ga0439466_0005537 | 3300041411 | Bacteria | 4818 |
| 315 | Ga0439465_0000470 | 3300041413 | Bacteria | 11931 |
| 316 | Ga0439465_0008519 | 3300041413 | Bacteria | 3235 |
| 317 | Ga0439465_0017299 | 3300041413 | Bacteria | 2250 |
| 318 | Ga0451789_0443718 | 3300041443 | Bacteria | 1510 |
| 319 | Ga0451793_0020002 | 3300041452 | Bacteria | 1891 |
| 320 | Ga0451793_0087177 | 3300041452 | Bacteria | 631 |
| 321 | Ga0451793_1356714 | 3300041452 | Bacteria | 2315 |
| 322 | Ga0451795_0359733 | 3300041456 | Bacteria | 2083 |
| 323 | Ga0451806_135764 | 3300041462 | Bacteria | 1284 |
| 324 | Ga0439431_0002820 | 3300041997 | Bacteria | 3822 |
| 325 | Ga0439431_0034457 | 3300041997 | Bacteria | 1269 |
| 326 | Ga0439442_004448 | 3300042002 | Bacteria | 2783 |
| 327 | Ga0439445_0001825 | 3300042004 | Bacteria | 4695 |
| 328 | Ga0439445_0002825 | 3300042004 | Bacteria | 3880 |
| 329 | Ga0439434_0014646 | 3300042435 | Bacteria | 2334 |
| 330 | Ga0439460_0107543 | 3300042461 | Bacteria | 902 |
| 331 | Ga0466969_0034754 | 3300044656 | Bacteria | 2553 |
| 332 | Ga0466972_0001669 | 3300044658 | Bacteria | 10860 |
| 333 | Ga0466972_0009736 | 3300044658 | Bacteria | 4824 |
| 334 | Ga0466972_0017973 | 3300044658 | Bacteria | 3536 |
| 335 | Ga0466972_0131399 | 3300044658 | Bacteria | 1179 |
| 336 | Ga0466965_0002816 | 3300044683 | Bacteria | 7494 |
| 337 | Ga0466965_0004402 | 3300044683 | Bacteria | 6262 |
| 338 | Ga0466965_0016628 | 3300044683 | Bacteria | 3504 |
| 339 | Ga0466965_0071608 | 3300044683 | Bacteria | 1744 |
| 340 | Ga0466965_0125477 | 3300044683 | Bacteria | 1328 |
| 341 | Ga0466966_0001426 | 3300044684 | Bacteria | 15385 |
| 342 | Ga0466966_0039215 | 3300044684 | Bacteria | 3051 |
| 343 | Ga0466961_0001731 | 3300044693 | Bacteria | 13574 |
| 344 | Ga0466961_0027878 | 3300044693 | Bacteria | 3631 |
| 345 | Ga0466963_0092507 | 3300044694 | Bacteria | 2060 |
| 346 | Ga0466963_0235968 | 3300044694 | Bacteria | 1282 |
| 347 | Ga0466963_0559997 | 3300044694 | Bacteria | 807 |
| 348 | Ga0466964_0022135 | 3300044706 | Bacteria | 2463 |
| 349 | Ga0466964_0028839 | 3300044706 | Bacteria | 2189 |
| 350 | Ga0466964_0090979 | 3300044706 | Bacteria | 1328 |
| 351 | Ga0466971_0023472 | 3300044719 | Bacteria | 2750 |
| 352 | Ga0466968_0035826 | 3300044735 | Bacteria | 2077 |
| 353 | Ga0466970_0002428 | 3300044765 | Bacteria | 9004 |
| 354 | Ga0466970_0013109 | 3300044765 | Bacteria | 4248 |
| 355 | Ga0466957_0002495 | 3300044842 | Bacteria | 9888 |
| 356 | Ga0466957_0018332 | 3300044842 | Bacteria | 4110 |
| 357 | Ga0466957_0066819 | 3300044842 | Bacteria | 2217 |
| 358 | Ga0466957_0091268 | 3300044842 | Bacteria | 1909 |
| 359 | Ga0466957_0130355 | 3300044842 | Bacteria | 1610 |
| 360 | Ga0466960_0000201 | 3300044901 | Bacteria | 20658 |
| 361 | Ga0466960_0001933 | 3300044901 | Bacteria | 7659 |
| 362 | Ga0466960_0048242 | 3300044901 | Bacteria | 2046 |
| 363 | Ga0466960_0210670 | 3300044901 | Bacteria | 1065 |
| 364 | Ga0466960_0361481 | 3300044901 | Bacteria | 830 |
| 365 | Ga0466959_0027800 | 3300045049 | Bacteria | 4195 |
| 366 | Ga0466959_0028309 | 3300045049 | Bacteria | 4155 |
| 367 | Ga0466958_0000266 | 3300045836 | Bacteria | 20187 |
| 368 | Ga0466958_0039965 | 3300045836 | Bacteria | 2819 |
| 369 | Ga0466958_0251852 | 3300045836 | Bacteria | 1130 |
| 370 | Ga0466967_0003022 | 3300045976 | Bacteria | 10790 |
| 371 | Ga0466967_0086733 | 3300045976 | Bacteria | 2836 |
| 372 | Ga0466967_0097927 | 3300045976 | Bacteria | 2677 |
| 373 | Ga0466967_0164938 | 3300045976 | Bacteria | 2081 |
| 374 | Ga0466967_0169338 | 3300045976 | Bacteria | 2054 |
| 375 | Ga0466967_0204257 | 3300045976 | Bacteria | 1872 |
| 376 | Ga0495627_000312 | 3300046453 | Bacteria | 47799 |
| 377 | Ga0495629_0045413 | 3300046459 | Bacteria | 3082 |
| 378 | Ga0495638_0000244 | 3300046460 | Bacteria | 74504 |
| 379 | Ga0495638_0119569 | 3300046460 | Bacteria | 1558 |
| 380 | Ga0495641_0032411 | 3300046461 | Bacteria | 2487 |
| 381 | Ga0495582_0146481 | 3300046473 | Bacteria | 1340 |
| 382 | Ga0495606_0011728 | 3300046507 | Bacteria | 7112 |
| 383 | Ga0495620_0189370 | 3300046515 | Bacteria | 794 |
| 384 | Ga0495648_0017697 | 3300046524 | Bacteria | 5083 |
| 385 | Ga0495665_0007328 | 3300046531 | Bacteria | 5961 |
| 386 | Ga0495668_0163045 | 3300046616 | Bacteria | 1221 |
| 387 | Ga0495624_0152755 | 3300046690 | Bacteria | 1412 |
| 388 | Ga0495670_0172741 | 3300046691 | Bacteria | 1139 |
| 389 | Ga0495581_0034656 | 3300047315 | Bacteria | 2920 |
| 390 | Ga0495674_0043857 | 3300047319 | Bacteria | 3978 |
| 391 | Ga0495672_0002688 | 3300047320 | Bacteria | 16001 |
| 392 | Ga0495672_0092493 | 3300047320 | Bacteria | 1658 |
| 393 | Ga0495672_0120274 | 3300047320 | Bacteria | 1397 |
| 394 | Ga0495673_0000723 | 3300047469 | Bacteria | 31706 |
| 395 | Ga0495686_0003616 | 3300047472 | Bacteria | 13260 |
| 396 | Ga0495593_0012633 | 3300047673 | Bacteria | 4824 |
| 397 | Ga0495614_0120564 | 3300048089 | Bacteria | 1156 |
| 398 | Ga0496100_0000127 | 3300048903 | Bacteria | 42888 |
| 399 | Ga0496100_0000505 | 3300048903 | Bacteria | 18747 |
| 400 | Ga0496100_0017532 | 3300048903 | Bacteria | 4229 |
| 401 | Ga0496100_0080538 | 3300048903 | Bacteria | 2198 |
| 402 | Ga0496100_0240241 | 3300048903 | Bacteria | 1336 |
| 403 | Ga0496101_0000068 | 3300048904 | Bacteria | 120985 |
| 404 | Ga0496101_0000077 | 3300048904 | Bacteria | 109236 |
| 405 | Ga0496101_0050228 | 3300048904 | Bacteria | 3001 |
| 406 | Ga0496101_0233862 | 3300048904 | Bacteria | 1429 |
| 407 | Ga0496101_0284767 | 3300048904 | Bacteria | 1292 |
| 408 | Ga0496102_0000037 | 3300048905 | Bacteria | 199368 |
| 409 | Ga0496102_0000594 | 3300048905 | Bacteria | 38107 |
| 410 | Ga0496102_0007572 | 3300048905 | Bacteria | 9276 |
| 411 | Ga0496102_0024070 | 3300048905 | Bacteria | 5412 |
| 412 | Ga0496102_0033049 | 3300048905 | Bacteria | 4647 |
| 413 | Ga0496102_0128960 | 3300048905 | Bacteria | 2366 |
| 414 | Ga0496102_0206832 | 3300048905 | Bacteria | 1850 |
| 415 | Ga0496102_0694181 | 3300048905 | Bacteria | 941 |
| 416 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 417 | Ga0496103_0000450 | 3300048906 | Bacteria | 35078 |
| 418 | Ga0496103_0000790 | 3300048906 | Bacteria | 23307 |
| 419 | Ga0496103_0005646 | 3300048906 | Bacteria | 7479 |
| 420 | Ga0496103_0035441 | 3300048906 | Bacteria | 3055 |
| 421 | Ga0496104_0000418 | 3300048907 | Bacteria | 37221 |
| 422 | Ga0496104_0050862 | 3300048907 | Bacteria | 3909 |
| 423 | Ga0496105_0029102 | 3300048908 | Bacteria | 4521 |
| 424 | Ga0496105_0029487 | 3300048908 | Bacteria | 4491 |
| 425 | Ga0496106_0001341 | 3300048909 | Bacteria | 18465 |
| 426 | Ga0496106_0014139 | 3300048909 | Bacteria | 5896 |
| 427 | Ga0496106_0014226 | 3300048909 | Bacteria | 5876 |
| 428 | Ga0496106_0042481 | 3300048909 | Bacteria | 3410 |
| 429 | Ga0496106_0108513 | 3300048909 | Bacteria | 2159 |
| 430 | Ga0496107_0000392 | 3300048910 | Bacteria | 23713 |
| 431 | Ga0496107_0001228 | 3300048910 | Bacteria | 15646 |
| 432 | Ga0496107_0016429 | 3300048910 | Bacteria | 5198 |
| 433 | Ga0496107_0022615 | 3300048910 | Bacteria | 4443 |
| 434 | Ga0496107_0024454 | 3300048910 | Bacteria | 4273 |
| 435 | Ga0496107_0108430 | 3300048910 | Bacteria | 2039 |
| 436 | Ga0496107_0617670 | 3300048910 | Bacteria | 800 |
| 437 | Ga0496108_0004384 | 3300048911 | Bacteria | 11359 |
| 438 | Ga0496108_0015138 | 3300048911 | Bacteria | 6293 |
| 439 | Ga0496108_0029070 | 3300048911 | Bacteria | 4575 |
| 440 | Ga0496108_0134855 | 3300048911 | Bacteria | 2123 |
| 441 | Ga0496109_0001366 | 3300048912 | Bacteria | 20228 |
| 442 | Ga0496109_0006296 | 3300048912 | Bacteria | 9991 |
| 443 | Ga0496109_0031691 | 3300048912 | Bacteria | 4747 |
| 444 | Ga0496109_0035094 | 3300048912 | Bacteria | 4522 |
| 445 | Ga0496109_0081120 | 3300048912 | Bacteria | 2989 |
| 446 | Ga0496109_0917108 | 3300048912 | Bacteria | 814 |
| 447 | Ga0496110_0001103 | 3300048913 | Bacteria | 19045 |
| 448 | Ga0496110_0044601 | 3300048913 | Bacteria | 3872 |
| 449 | Ga0496110_0080650 | 3300048913 | Bacteria | 2900 |
| 450 | Ga0496110_0238058 | 3300048913 | Bacteria | 1656 |
| 451 | Ga0496111_0005185 | 3300048914 | Bacteria | 8307 |
| 452 | Ga0496111_0174712 | 3300048914 | Bacteria | 1596 |
| 453 | Ga0496112_0006704 | 3300048915 | Bacteria | 10142 |
| 454 | Ga0496112_0034049 | 3300048915 | Bacteria | 4956 |
| 455 | Ga0496112_0056529 | 3300048915 | Bacteria | 3862 |
| 456 | Ga0496112_0088656 | 3300048915 | Bacteria | 3062 |
| 457 | Ga0496112_0102352 | 3300048915 | Bacteria | 2834 |
| 458 | Ga0496113_0008358 | 3300048916 | Bacteria | 6741 |
| 459 | Ga0496113_0107241 | 3300048916 | Bacteria | 2170 |
| 460 | Ga0496113_0233233 | 3300048916 | Bacteria | 1468 |
| 461 | Ga0496113_0313402 | 3300048916 | Bacteria | 1257 |
| 462 | Ga0496114_0000110 | 3300048917 | Bacteria | 59135 |
| 463 | Ga0496114_0002485 | 3300048917 | Bacteria | 14085 |
| 464 | Ga0496114_0017992 | 3300048917 | Bacteria | 5709 |
| 465 | Ga0496114_0047285 | 3300048917 | Bacteria | 3579 |
| 466 | Ga0496114_0470395 | 3300048917 | Bacteria | 1112 |
| 467 | Ga0496115_0030537 | 3300048918 | Bacteria | 4240 |
| 468 | Ga0496115_0103122 | 3300048918 | Bacteria | 2340 |
| 469 | Ga0496115_0332187 | 3300048918 | Bacteria | 1242 |
| 470 | Ga0496116_0000056 | 3300048919 | Bacteria | 282554 |
| 471 | Ga0496116_0007028 | 3300048919 | Bacteria | 10075 |
| 472 | Ga0496116_0017744 | 3300048919 | Bacteria | 5513 |
| 473 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 474 | Ga0496117_0000206 | 3300048920 | Bacteria | 114638 |
| 475 | Ga0496117_0000808 | 3300048920 | Bacteria | 48592 |
| 476 | Ga0496117_0061728 | 3300048920 | Bacteria | 2574 |
| 477 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 478 | Ga0496118_0000364 | 3300048921 | Bacteria | 76481 |
| 479 | Ga0496118_0000905 | 3300048921 | Bacteria | 46324 |
| 480 | Ga0496118_0004720 | 3300048921 | Bacteria | 15955 |
| 481 | Ga0496118_0016303 | 3300048921 | Bacteria | 6822 |
| 482 | Ga0496118_0022022 | 3300048921 | Bacteria | 5588 |
| 483 | Ga0496119_0001959 | 3300048922 | Bacteria | 23406 |
| 484 | Ga0496119_0002043 | 3300048922 | Bacteria | 22843 |
| 485 | Ga0496119_0005342 | 3300048922 | Bacteria | 12357 |
| 486 | Ga0496119_0006924 | 3300048922 | Bacteria | 10340 |
| 487 | Ga0496119_0014032 | 3300048922 | Bacteria | 6309 |
| 488 | Ga0496119_0077648 | 3300048922 | Bacteria | 1923 |
| 489 | Ga0496120_0006295 | 3300048923 | Bacteria | 9152 |
| 490 | Ga0496120_0017809 | 3300048923 | Bacteria | 4592 |
| 491 | Ga0496120_0028222 | 3300048923 | Bacteria | 3440 |
| 492 | Ga0496121_0000023 | 3300048924 | Bacteria | 463448 |
| 493 | Ga0496121_0000790 | 3300048924 | Bacteria | 57884 |
| 494 | Ga0496121_0014805 | 3300048924 | Bacteria | 8235 |
| 495 | Ga0496122_0000038 | 3300048925 | Bacteria | 295624 |
| 496 | Ga0496122_0000235 | 3300048925 | Bacteria | 124769 |
| 497 | Ga0496122_0003643 | 3300048925 | Bacteria | 20024 |
| 498 | Ga0496122_0073782 | 3300048925 | Bacteria | 2417 |
| 499 | Ga0496122_0276856 | 3300048925 | Bacteria | 920 |
| 500 | Ga0496123_0000036 | 3300048926 | Bacteria | 265722 |
| 501 | Ga0496123_0011888 | 3300048926 | Bacteria | 7482 |
| 502 | Ga0496123_0035768 | 3300048926 | Bacteria | 3533 |
| 503 | Ga0496124_0000014 | 3300048927 | Bacteria | 463448 |
| 504 | Ga0496124_0002889 | 3300048927 | Bacteria | 21677 |
| 505 | Ga0496124_0050478 | 3300048927 | Bacteria | 3544 |
| 506 | Ga0496124_0094456 | 3300048927 | Bacteria | 2432 |
| 507 | Ga0496125_0000020 | 3300048928 | Bacteria | 463448 |
| 508 | Ga0496125_0012064 | 3300048928 | Bacteria | 8598 |
| 509 | Ga0496125_0048094 | 3300048928 | Bacteria | 3560 |
| 510 | Ga0496125_0081135 | 3300048928 | Bacteria | 2479 |
| 511 | Ga0496125_0081787 | 3300048928 | Bacteria | 2466 |
| 512 | Ga0496126_0000023 | 3300048929 | Bacteria | 463448 |
| 513 | Ga0496126_0000912 | 3300048929 | Bacteria | 51111 |
| 514 | Ga0496126_0004156 | 3300048929 | Bacteria | 17477 |
| 515 | Ga0496126_0025068 | 3300048929 | Bacteria | 5747 |
| 516 | Ga0496126_0035324 | 3300048929 | Bacteria | 4687 |
| 517 | Ga0496126_0070492 | 3300048929 | Bacteria | 3114 |
| 518 | Ga0501032_0002220 | 3300049569 | Bacteria | 15287 |
| 519 | Ga0501032_0013764 | 3300049569 | Bacteria | 5740 |
| 520 | Ga0501033_0002350 | 3300049570 | Bacteria | 16130 |
| 521 | Ga0501034_0001656 | 3300049571 | Bacteria | 28757 |
| 522 | Ga0501034_0016305 | 3300049571 | Bacteria | 7628 |
| 523 | Ga0501034_0033635 | 3300049571 | Bacteria | 5199 |
| 524 | Ga0501034_0055735 | 3300049571 | Bacteria | 3977 |
| 525 | Ga0501034_0268114 | 3300049571 | Bacteria | 1649 |
| 526 | Ga0501036_0022652 | 3300049572 | Bacteria | 5286 |
| 527 | Ga0501037_0001024 | 3300049573 | Bacteria | 20661 |
| 528 | Ga0501038_0008021 | 3300049574 | Bacteria | 9726 |
| 529 | Ga0501039_0001582 | 3300049575 | Bacteria | 16761 |
| 530 | Ga0501039_0034454 | 3300049575 | Bacteria | 3907 |
| 531 | Ga0501043_0002179 | 3300049579 | Bacteria | 16718 |
| 532 | Ga0501043_0034760 | 3300049579 | Bacteria | 3964 |
| 533 | Ga0501043_0132255 | 3300049579 | Bacteria | 1955 |
| 534 | Ga0501046_0039066 | 3300049580 | Bacteria | 3803 |
| 535 | Ga0501047_0028440 | 3300049581 | Bacteria | 5389 |
| 536 | Ga0501047_0492231 | 3300049581 | Bacteria | 1053 |
| 537 | Ga0501048_0018424 | 3300049582 | Bacteria | 5135 |
| 538 | Ga0501069_0118772 | 3300049585 | Bacteria | 1509 |
| 539 | Ga0501069_0204860 | 3300049585 | Bacteria | 1144 |
| 540 | Ga0501070_0002338 | 3300049586 | Bacteria | 16653 |
| 541 | Ga0501070_0002467 | 3300049586 | Bacteria | 16202 |
| 542 | Ga0501070_0008341 | 3300049586 | Bacteria | 8755 |
| 543 | Ga0501071_0002594 | 3300049587 | Bacteria | 11042 |
| 544 | Ga0501073_0045427 | 3300049589 | Bacteria | 3093 |
| 545 | Ga0501073_0117204 | 3300049589 | Bacteria | 1845 |
| 546 | Ga0501077_0224723 | 3300049593 | Bacteria | 1193 |
| 547 | Ga0501080_0130851 | 3300049742 | Bacteria | 2323 |
| 548 | Ga0501035_0008115 | 3300049822 | Bacteria | 9784 |
| 549 | Ga0501044_0002686 | 3300049823 | Bacteria | 20228 |
| 550 | nmdc:mga03683_3424_c1 | 3300050489 | Bacteria | 5115 |
| 551 | nmdc:mga03n38_12438_c1 | 3300050490 | Bacteria | 3203 |
| 552 | nmdc:mga03n38_16039_c1 | 3300050490 | Bacteria | 2907 |
| 553 | nmdc:mga03n38_24671_c1 | 3300050490 | Bacteria | 2460 |
| 554 | nmdc:mga03n38_93749_c1 | 3300050490 | Bacteria | 1435 |
| 555 | nmdc:mga00v17_11417_c1 | 3300050491 | Bacteria | 4882 |
| 556 | nmdc:mga00v17_143562_c1 | 3300050491 | Bacteria | 1532 |
| 557 | nmdc:mga00v17_147033_c1 | 3300050491 | Bacteria | 1513 |
| 558 | nmdc:mga00v17_202750_c1 | 3300050491 | Bacteria | 1282 |
| 559 | nmdc:mga00v17_23631_c1 | 3300050491 | Bacteria | 3557 |
| 560 | nmdc:mga00v17_346539_c1 | 3300050491 | Bacteria | 966 |
| 561 | nmdc:mga00v17_410943_c1 | 3300050491 | Bacteria | 879 |
| 562 | nmdc:mga00v17_6778_c1 | 3300050491 | Bacteria | 6087 |
| 563 | nmdc:mga07m45_101660_c1 | 3300050496 | Bacteria | 1651 |
| 564 | nmdc:mga07m45_106057_c1 | 3300050496 | Bacteria | 1616 |
| 565 | nmdc:mga07m45_2024_c1 | 3300050496 | Bacteria | 9406 |
| 566 | nmdc:mga05p37_26068_c1 | 3300050507 | Bacteria | 7108 |
| 567 | nmdc:mga0qj67_104168_c2 | 3300050509 | Bacteria | 1949 |
| 568 | nmdc:mga06r32_137043_c1 | 3300050510 | Bacteria | 2422 |
| 569 | nmdc:mga08y16_590475_c1 | 3300050511 | Bacteria | 1120 |
| 570 | nmdc:mga0sz30_53687_c1 | 3300050516 | Bacteria | 1713 |
| 571 | Ga0500610_0005649 | 3300053079 | Bacteria | 5157 |
| 572 | Ga0495619_0134277 | 3300053085 | Bacteria | 1702 |
| 573 | Ga0500556_0002637 | 3300053104 | Bacteria | 5607 |
| 574 | Ga0500562_006222 | 3300053108 | Bacteria | 3012 |
| 575 | Ga0500569_073019 | 3300053109 | Bacteria | 1083 |
| 576 | Ga0500642_0008941 | 3300053130 | Bacteria | 3453 |
| 577 | Ga0500568_0039594 | 3300053139 | Bacteria | 1902 |
| 578 | Ga0500573_0137653 | 3300053140 | Bacteria | 1347 |
| 579 | Ga0500616_0010055 | 3300053153 | Bacteria | 5685 |
| 580 | Ga0466962_0009981 | 3300061719 | Bacteria | 4555 |
| 581 | Ga0466962_0021451 | 3300061719 | Bacteria | 3101 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100663178 | Ga0070714_1006631781 | 194 |
| 2 | 3300049571 | Ga0501034_0033635 | Ga0501034_0033635_2755_3438 | 194 |
| 3 | 3300049587 | Ga0501071_0002594 | Ga0501071_0002594_4560_5243 | 194 |
| 4 | 3300003792 | Ga0055540_1000029 | Ga0055540_100002983 | 197 |
| 5 | 3300005335 | Ga0070666_10202667 | Ga0070666_102026672 | 197 |
| 6 | 3300005367 | Ga0070667_100000831 | Ga0070667_10000083122 | 197 |
| 7 | 3300025986 | Ga0207658_10000740 | Ga0207658_1000074024 | 197 |
| 8 | 3300031251 | Ga0265327_10001843 | Ga0265327_1000184323 | 197 |
| 9 | 3300041452 | Ga0451793_0087177 | Ga0451793_0087177_13_612 | 198 |
| 10 | 3300048905 | Ga0496102_0694181 | Ga0496102_0694181_45_644 | 198 |
| 11 | 3300048910 | Ga0496107_0024454 | Ga0496107_0024454_3636_4235 | 198 |
| 12 | 3300048916 | Ga0496113_0107241 | Ga0496113_0107241_56_655 | 198 |
| 13 | 3300049586 | Ga0501070_0008341 | Ga0501070_0008341_346_1047 | 198 |
| 14 | 3300050491 | nmdc:mga00v17_346539_c1 | nmdc:mga00v17_346539_c1_23_622 | 198 |
| 15 | 3300045976 | Ga0466967_0164938 | Ga0466967_0164938_22_630 | 202 |
| 16 | 3300053153 | Ga0500616_0010055 | Ga0500616_0010055_2575_3279 | 202 |
| 17 | 3300049585 | Ga0501069_0204860 | Ga0501069_0204860_116_811 | 204 |
| 18 | iso_pu_bacteria | 2946041624 | 2946041680 | 204 |
| 19 | iso_pu_bacteria | 2643221630 | 2644171742 | 205 |
| 20 | iso_pu_bacteria | 2643221724 | 2644681504 | 205 |
| 21 | iso_pu_bacteria | 2728369380 | 2730231092 | 205 |
| 22 | iso_pu_bacteria | 2747842429 | 2747954946 | 205 |
| 23 | iso_pu_bacteria | 2857723135 | 2857726431 | 205 |
| 24 | iso_pu_bacteria | 2919395869 | 2919397546 | 205 |
| 25 | iso_pu_bacteria | 2945968032 | 2945969228 | 205 |
| 26 | iso_pu_bacteria | 2946033335 | 2946035911 | 205 |
| 27 | iso_pu_bacteria | 8004182704 | 8004184061 | 205 |
| 28 | 3300044901 | Ga0466960_0361481 | Ga0466960_0361481_144_791 | 206 |
| 29 | iso_pu_bacteria | 2643221597 | 2643997116 | 206 |
| 30 | iso_pu_bacteria | 2808606306 | 2808629249 | 206 |
| 31 | iso_pu_bacteria | 2939660829 | 2939661590 | 206 |
| 32 | 3300046453 | Ga0495627_000312 | Ga0495627_000312_21031_21660 | 207 |
| 33 | 3300048920 | Ga0496117_0000808 | Ga0496117_0000808_26974_27603 | 207 |
| 34 | 3300048921 | Ga0496118_0022022 | Ga0496118_0022022_2568_3197 | 207 |
| 35 | 3300048922 | Ga0496119_0077648 | Ga0496119_0077648_1173_1802 | 207 |
| 36 | 3300048925 | Ga0496122_0073782 | Ga0496122_0073782_446_1075 | 207 |
| 37 | 3300048929 | Ga0496126_0000912 | Ga0496126_0000912_29528_30157 | 207 |
| 38 | 3300048929 | Ga0496126_0070492 | Ga0496126_0070492_877_1506 | 207 |
| 39 | 3300049571 | Ga0501034_0001656 | Ga0501034_0001656_18771_19400 | 207 |
| 40 | iso_pu_bacteria | 2643221572 | 2643876931 | 207 |
| 41 | iso_pu_bacteria | 2643221649 | 2644278234 | 207 |
| 42 | iso_pu_bacteria | 2643221669 | 2644383986 | 207 |
| 43 | iso_pu_bacteria | 2895660088 | 2895662289 | 207 |
| 44 | iso_pu_bacteria | 2984580707 | 2984583330 | 207 |
| 45 | 3300006051 | Ga0075364_10117578 | Ga0075364_101175783 | 208 |
| 46 | 3300025246 | Ga0209646_1000014 | Ga0209646_1000014496 | 208 |
| 47 | 3300031903 | Ga0307407_10363796 | Ga0307407_103637962 | 208 |
| 48 | 3300032004 | Ga0307414_10631887 | Ga0307414_106318872 | 208 |
| 49 | 3300044842 | Ga0466957_0091268 | Ga0466957_0091268_1264_1896 | 208 |
| 50 | 3300048925 | Ga0496122_0003643 | Ga0496122_0003643_14942_15574 | 208 |
| 51 | 3300048925 | Ga0496122_0276856 | Ga0496122_0276856_162_794 | 208 |
| 52 | 3300048927 | Ga0496124_0094456 | Ga0496124_0094456_1610_2242 | 208 |
| 53 | 3300048928 | Ga0496125_0012064 | Ga0496125_0012064_2073_2705 | 208 |
| 54 | 3300050491 | nmdc:mga00v17_147033_c1 | nmdc:mga00v17_147033_c1_208_840 | 208 |
| 55 | 3300050491 | nmdc:mga00v17_410943_c1 | nmdc:mga00v17_410943_c1_85_717 | 208 |
| 56 | 3300013250 | Ga0171462_1002 | Ga0171462_1002332 | 209 |
| 57 | 3300032002 | Ga0307416_100827475 | Ga0307416_1008274751 | 209 |
| 58 | 3300041452 | Ga0451793_1356714 | Ga0451793_1356714_603_1325 | 209 |
| 59 | 3300046515 | Ga0495620_0189370 | Ga0495620_0189370_134_775 | 209 |
| 60 | 3300048921 | Ga0496118_0004720 | Ga0496118_0004720_2218_2862 | 209 |
| 61 | 3300048922 | Ga0496119_0001959 | Ga0496119_0001959_5066_5710 | 209 |
| 62 | 3300048922 | Ga0496119_0002043 | Ga0496119_0002043_14991_15632 | 209 |
| 63 | 3300048923 | Ga0496120_0028222 | Ga0496120_0028222_1492_2136 | 209 |
| 64 | 3300048925 | Ga0496122_0000235 | Ga0496122_0000235_98143_98787 | 209 |
| 65 | 3300048926 | Ga0496123_0000036 | Ga0496123_0000036_25987_26631 | 209 |
| 66 | 3300048927 | Ga0496124_0002889 | Ga0496124_0002889_16266_16910 | 209 |
| 67 | 3300048928 | Ga0496125_0048094 | Ga0496125_0048094_1464_2108 | 209 |
| 68 | 3300049575 | Ga0501039_0034454 | Ga0501039_0034454_1377_2012 | 209 |
| 69 | 3300049579 | Ga0501043_0132255 | Ga0501043_0132255_1186_1821 | 209 |
| 70 | iso_pu_bacteria | 2773857763 | 2774397689 | 209 |
| 71 | 3300025909 | Ga0207705_10504232 | Ga0207705_105042321 | 210 |
| 72 | 3300025921 | Ga0207652_10660812 | Ga0207652_106608122 | 210 |
| 73 | 3300025932 | Ga0207690_10433789 | Ga0207690_104337892 | 210 |
| 74 | iso_pu_bacteria | 2852643534 | 2852644957 | 211 |
| 75 | 3300005347 | Ga0070668_100208673 | Ga0070668_1002086732 | 213 |
| 76 | 3300005617 | Ga0068859_100891845 | Ga0068859_1008918451 | 213 |
| 77 | 3300006931 | Ga0097620_100891894 | Ga0097620_1008918941 | 213 |
| 78 | 3300009036 | Ga0105244_10069180 | Ga0105244_100691802 | 213 |
| 79 | 3300009094 | Ga0111539_10466556 | Ga0111539_104665562 | 213 |
| 80 | 3300011119 | Ga0105246_10070110 | Ga0105246_100701101 | 213 |
| 81 | 3300025935 | Ga0207709_10032619 | Ga0207709_100326192 | 213 |
| 82 | 3300026116 | Ga0207674_10103385 | Ga0207674_101033852 | 213 |
| 83 | 3300027907 | Ga0207428_10330208 | Ga0207428_103302082 | 213 |
| 84 | 3300031995 | Ga0307409_100251989 | Ga0307409_1002519892 | 213 |
| 85 | 3300032004 | Ga0307414_10159723 | Ga0307414_101597232 | 213 |
| 86 | 3300032004 | Ga0307414_10324032 | Ga0307414_103240321 | 213 |
| 87 | 3300042461 | Ga0439460_0107543 | Ga0439460_0107543_231_884 | 213 |
| 88 | 3300046460 | Ga0495638_0119569 | Ga0495638_0119569_166_819 | 213 |
| 89 | 3300048916 | Ga0496113_0233233 | Ga0496113_0233233_202_855 | 213 |
| 90 | 3300048928 | Ga0496125_0081787 | Ga0496125_0081787_1227_1880 | 213 |
| 91 | 3300050511 | nmdc:mga08y16_590475_c1 | nmdc:mga08y16_590475_c1_176_829 | 213 |
| 92 | iso_pu_bacteria | 2585428094 | 2587861644 | 213 |
| 93 | iso_pu_bacteria | 2643221549 | 2643769150 | 213 |
| 94 | iso_pu_bacteria | 2643221619 | 2644112612 | 213 |
| 95 | iso_pu_bacteria | 2808606372 | 2808900363 | 213 |
| 96 | 3300005549 | Ga0070704_100181471 | Ga0070704_1001814712 | 214 |
| 97 | 3300044683 | Ga0466965_0125477 | Ga0466965_0125477_625_1278 | 214 |
| 98 | 3300053140 | Ga0500573_0137653 | Ga0500573_0137653_266_931 | 216 |
| 99 | 3300009177 | Ga0105248_10514539 | Ga0105248_105145392 | 217 |
| 100 | 3300025303 | Ga0209051_1045594 | Ga0209051_10455942 | 217 |
| 101 | 3300046691 | Ga0495670_0172741 | Ga0495670_0172741_124_783 | 217 |
| 102 | iso_pu_bacteria | 2919443155 | 2919444983 | 217 |
| 103 | 3300041462 | Ga0451806_135764 | Ga0451806_135764_361_1032 | 219 |
| 104 | 3300005456 | Ga0070678_100095400 | Ga0070678_1000954003 | 220 |
| 105 | 3300005347 | Ga0070668_100011834 | Ga0070668_1000118348 | 221 |
| 106 | 3300005548 | Ga0070665_100008244 | Ga0070665_1000082445 | 221 |
| 107 | 3300005617 | Ga0068859_100011242 | Ga0068859_1000112426 | 221 |
| 108 | 3300005841 | Ga0068863_100001801 | Ga0068863_10000180119 | 221 |
| 109 | 3300005842 | Ga0068858_100037254 | Ga0068858_1000372544 | 221 |
| 110 | 3300005843 | Ga0068860_100000231 | Ga0068860_10000023133 | 221 |
| 111 | 3300005844 | Ga0068862_100000060 | Ga0068862_10000006053 | 221 |
| 112 | 3300006931 | Ga0097620_100011242 | Ga0097620_1000112426 | 221 |
| 113 | 3300025900 | Ga0207710_10000085 | Ga0207710_10000085105 | 221 |
| 114 | 3300025923 | Ga0207681_10004313 | Ga0207681_100043138 | 221 |
| 115 | 3300025941 | Ga0207711_10000893 | Ga0207711_100008933 | 221 |
| 116 | 3300025961 | Ga0207712_10000040 | Ga0207712_1000004083 | 221 |
| 117 | 3300025986 | Ga0207658_10004291 | Ga0207658_100042913 | 221 |
| 118 | 3300026088 | Ga0207641_10001736 | Ga0207641_1000173610 | 221 |
| 119 | 3300028380 | Ga0268265_10000004 | Ga0268265_10000004555 | 221 |
| 120 | 3300028381 | Ga0268264_10000133 | Ga0268264_1000013382 | 221 |
| 121 | 3300037471 | Ga0395905_0244100 | Ga0395905_0244100_243_968 | 221 |
| 122 | 3300047320 | Ga0495672_0120274 | Ga0495672_0120274_237_902 | 221 |
| 123 | 3300048918 | Ga0496115_0332187 | Ga0496115_0332187_313_981 | 221 |
| 124 | 3300048927 | Ga0496124_0050478 | Ga0496124_0050478_2248_2916 | 221 |
| 125 | 3300005347 | Ga0070668_100534600 | Ga0070668_1005346001 | 222 |
| 126 | 3300006038 | Ga0075365_10008621 | Ga0075365_100086215 | 222 |
| 127 | 3300006038 | Ga0075365_10086747 | Ga0075365_100867471 | 222 |
| 128 | 3300006048 | Ga0075363_100031886 | Ga0075363_1000318862 | 222 |
| 129 | 3300006353 | Ga0075370_10006244 | Ga0075370_100062442 | 222 |
| 130 | 3300006353 | Ga0075370_10007350 | Ga0075370_100073502 | 222 |
| 131 | 3300009176 | Ga0105242_10582979 | Ga0105242_105829792 | 222 |
| 132 | 3300031852 | Ga0307410_10003289 | Ga0307410_100032895 | 222 |
| 133 | 3300031903 | Ga0307407_10018506 | Ga0307407_100185063 | 222 |
| 134 | 3300031995 | Ga0307409_100043962 | Ga0307409_1000439624 | 222 |
| 135 | 3300032002 | Ga0307416_100008398 | Ga0307416_1000083982 | 222 |
| 136 | 3300032005 | Ga0307411_10054018 | Ga0307411_100540182 | 222 |
| 137 | 3300050490 | nmdc:mga03n38_12438_c1 | nmdc:mga03n38_12438_c1_332_1003 | 222 |
| 138 | 3300050490 | nmdc:mga03n38_24671_c1 | nmdc:mga03n38_24671_c1_1678_2349 | 222 |
| 139 | 3300050496 | nmdc:mga07m45_101660_c1 | nmdc:mga07m45_101660_c1_45_716 | 222 |
| 140 | 3300050496 | nmdc:mga07m45_2024_c1 | nmdc:mga07m45_2024_c1_3343_4014 | 222 |
| 141 | 3300053109 | Ga0500569_073019 | Ga0500569_073019_291_962 | 222 |
| 142 | iso_pu_bacteria | 2643221635 | 2644198379 | 222 |
| 143 | iso_pu_bacteria | 8046352972 | 8046354302 | 222 |
| 144 | 3300036712 | Ga0316584_0040693 | Ga0316584_0040693_244_921 | 223 |
| 145 | 3300009092 | Ga0105250_10033787 | Ga0105250_100337873 | 224 |
| 146 | 3300013306 | Ga0163162_10058625 | Ga0163162_100586252 | 224 |
| 147 | 3300041413 | Ga0439465_0008519 | Ga0439465_0008519_2532_3209 | 224 |
| 148 | 3300050490 | nmdc:mga03n38_16039_c1 | nmdc:mga03n38_16039_c1_957_1634 | 224 |
| 149 | 3300050491 | nmdc:mga00v17_6778_c1 | nmdc:mga00v17_6778_c1_2121_2798 | 224 |
| 150 | iso_pu_bacteria | 2939582691 | 2939587421 | 224 |
| 151 | 3300005842 | Ga0068858_100200083 | Ga0068858_1002000832 | 225 |
| 152 | 3300009101 | Ga0105247_10128028 | Ga0105247_101280281 | 225 |
| 153 | 3300048909 | Ga0496106_0108513 | Ga0496106_0108513_1357_2073 | 225 |
| 154 | 3300048910 | Ga0496107_0617670 | Ga0496107_0617670_45_773 | 225 |
| 155 | 3300048917 | Ga0496114_0470395 | Ga0496114_0470395_187_915 | 225 |
| 156 | iso_pu_bacteria | 2643221687 | 2644486346 | 226 |
| 157 | iso_pu_bacteria | 2643221715 | 2644637386 | 226 |
| 158 | iso_pu_bacteria | 2902810491 | 2902815422 | 226 |
| 159 | iso_pu_bacteria | 2902837492 | 2902840234 | 226 |
| 160 | 3300026118 | Ga0207675_100176934 | Ga0207675_1001769342 | 227 |
| 161 | iso_pu_bacteria | 2929212328 | 2929215066 | 227 |
| 162 | 3300003792 | Ga0055540_1003364 | Ga0055540_10033644 | 228 |
| 163 | 3300025303 | Ga0209051_1000581 | Ga0209051_100058134 | 228 |
| 164 | 3300049571 | Ga0501034_0268114 | Ga0501034_0268114_341_1030 | 228 |
| 165 | 3300005435 | Ga0070714_100213327 | Ga0070714_1002133272 | 229 |
| 166 | 3300006038 | Ga0075365_10031963 | Ga0075365_100319632 | 229 |
| 167 | 3300006048 | Ga0075363_100002167 | Ga0075363_1000021673 | 229 |
| 168 | 3300021384 | Ga0213876_10009186 | Ga0213876_100091864 | 229 |
| 169 | 3300025929 | Ga0207664_10182481 | Ga0207664_101824812 | 229 |
| 170 | 3300037853 | Ga0436364_0385449 | Ga0436364_0385449_3432_4124 | 229 |
| 171 | 3300037853 | Ga0436364_0572184 | Ga0436364_0572184_1250_1954 | 229 |
| 172 | 3300039437 | Ga0436365_0259894 | Ga0436365_0259894_11970_12674 | 229 |
| 173 | 3300039437 | Ga0436365_1378611 | Ga0436365_1378611_119692_120384 | 229 |
| 174 | 3300039437 | Ga0436365_1469068 | Ga0436365_1469068_28823_29527 | 229 |
| 175 | 3300039450 | Ga0436363_0540344 | Ga0436363_0540344_64_765 | 229 |
| 176 | 3300041413 | Ga0439465_0000470 | Ga0439465_0000470_593_1288 | 229 |
| 177 | 3300044694 | Ga0466963_0092507 | Ga0466963_0092507_1318_2022 | 229 |
| 178 | 3300044694 | Ga0466963_0559997 | Ga0466963_0559997_58_750 | 229 |
| 179 | 3300044719 | Ga0466971_0023472 | Ga0466971_0023472_1665_2369 | 229 |
| 180 | 3300044842 | Ga0466957_0130355 | Ga0466957_0130355_729_1433 | 229 |
| 181 | 3300045976 | Ga0466967_0003022 | Ga0466967_0003022_2597_3289 | 229 |
| 182 | 3300045976 | Ga0466967_0169338 | Ga0466967_0169338_1279_1983 | 229 |
| 183 | 3300048920 | Ga0496117_0061728 | Ga0496117_0061728_391_1134 | 229 |
| 184 | 3300048921 | Ga0496118_0000364 | Ga0496118_0000364_8473_9216 | 229 |
| 185 | 3300049569 | Ga0501032_0013764 | Ga0501032_0013764_2953_3657 | 229 |
| 186 | 3300049570 | Ga0501033_0002350 | Ga0501033_0002350_12750_13454 | 229 |
| 187 | 3300049571 | Ga0501034_0055735 | Ga0501034_0055735_44_748 | 229 |
| 188 | 3300049579 | Ga0501043_0034760 | Ga0501043_0034760_2875_3579 | 229 |
| 189 | 3300049580 | Ga0501046_0039066 | Ga0501046_0039066_32_736 | 229 |
| 190 | 3300049581 | Ga0501047_0028440 | Ga0501047_0028440_4261_4965 | 229 |
| 191 | 3300049581 | Ga0501047_0492231 | Ga0501047_0492231_336_1040 | 229 |
| 192 | 3300049582 | Ga0501048_0018424 | Ga0501048_0018424_3664_4368 | 229 |
| 193 | 3300049585 | Ga0501069_0118772 | Ga0501069_0118772_297_1001 | 229 |
| 194 | 3300049586 | Ga0501070_0002338 | Ga0501070_0002338_4073_4777 | 229 |
| 195 | 3300049589 | Ga0501073_0117204 | Ga0501073_0117204_820_1524 | 229 |
| 196 | 3300049742 | Ga0501080_0130851 | Ga0501080_0130851_953_1657 | 229 |
| 197 | 3300049822 | Ga0501035_0008115 | Ga0501035_0008115_5254_5958 | 229 |
| 198 | 3300049823 | Ga0501044_0002686 | Ga0501044_0002686_12785_13489 | 229 |
| 199 | 3300053130 | Ga0500642_0008941 | Ga0500642_0008941_2516_3208 | 229 |
| 200 | 3300061719 | Ga0466962_0021451 | Ga0466962_0021451_381_1085 | 229 |
| 201 | iso_pu_bacteria | 2842134933 | 2842138341 | 229 |
| 202 | iso_pu_bacteria | 2902792274 | 2902798546 | 229 |
| 203 | 3300003792 | Ga0055540_1002534 | Ga0055540_10025347 | 230 |
| 204 | 3300003792 | Ga0055540_1015764 | Ga0055540_10157642 | 230 |
| 205 | 3300005458 | Ga0070681_10725468 | Ga0070681_107254681 | 230 |
| 206 | 3300005539 | Ga0068853_100050178 | Ga0068853_1000501782 | 230 |
| 207 | 3300006051 | Ga0075364_10028730 | Ga0075364_100287305 | 230 |
| 208 | 3300006186 | Ga0075369_10038054 | Ga0075369_100380542 | 230 |
| 209 | 3300025303 | Ga0209051_1010244 | Ga0209051_10102445 | 230 |
| 210 | 3300025303 | Ga0209051_1025671 | Ga0209051_10256712 | 230 |
| 211 | 3300025939 | Ga0207665_10285344 | Ga0207665_102853442 | 230 |
| 212 | 3300026041 | Ga0207639_10011231 | Ga0207639_100112317 | 230 |
| 213 | 3300026067 | Ga0207678_10581084 | Ga0207678_105810841 | 230 |
| 214 | 3300032126 | Ga0307415_100818546 | Ga0307415_1008185461 | 230 |
| 215 | 3300041410 | Ga0439461_0008188 | Ga0439461_0008188_312_1010 | 230 |
| 216 | 3300041411 | Ga0439466_0002959 | Ga0439466_0002959_5444_6142 | 230 |
| 217 | 3300041452 | Ga0451793_0020002 | Ga0451793_0020002_344_1042 | 230 |
| 218 | 3300041456 | Ga0451795_0359733 | Ga0451795_0359733_429_1127 | 230 |
| 219 | 3300041997 | Ga0439431_0002820 | Ga0439431_0002820_3070_3768 | 230 |
| 220 | 3300042004 | Ga0439445_0001825 | Ga0439445_0001825_2899_3597 | 230 |
| 221 | 3300044658 | Ga0466972_0017973 | Ga0466972_0017973_1177_1869 | 230 |
| 222 | 3300044658 | Ga0466972_0131399 | Ga0466972_0131399_347_1039 | 230 |
| 223 | 3300044684 | Ga0466966_0039215 | Ga0466966_0039215_179_871 | 230 |
| 224 | 3300044693 | Ga0466961_0027878 | Ga0466961_0027878_2571_3263 | 230 |
| 225 | 3300044706 | Ga0466964_0022135 | Ga0466964_0022135_1684_2376 | 230 |
| 226 | 3300044706 | Ga0466964_0090979 | Ga0466964_0090979_386_1078 | 230 |
| 227 | 3300044765 | Ga0466970_0013109 | Ga0466970_0013109_2033_2725 | 230 |
| 228 | 3300044842 | Ga0466957_0066819 | Ga0466957_0066819_1440_2132 | 230 |
| 229 | 3300045049 | Ga0466959_0027800 | Ga0466959_0027800_2570_3262 | 230 |
| 230 | 3300045836 | Ga0466958_0039965 | Ga0466958_0039965_1540_2232 | 230 |
| 231 | 3300045836 | Ga0466958_0251852 | Ga0466958_0251852_244_936 | 230 |
| 232 | 3300046459 | Ga0495629_0045413 | Ga0495629_0045413_1944_2636 | 230 |
| 233 | 3300046461 | Ga0495641_0032411 | Ga0495641_0032411_450_1142 | 230 |
| 234 | 3300046473 | Ga0495582_0146481 | Ga0495582_0146481_375_1067 | 230 |
| 235 | 3300046507 | Ga0495606_0011728 | Ga0495606_0011728_2725_3417 | 230 |
| 236 | 3300046531 | Ga0495665_0007328 | Ga0495665_0007328_3130_3822 | 230 |
| 237 | 3300046690 | Ga0495624_0152755 | Ga0495624_0152755_222_914 | 230 |
| 238 | 3300047315 | Ga0495581_0034656 | Ga0495581_0034656_1629_2321 | 230 |
| 239 | 3300047319 | Ga0495674_0043857 | Ga0495674_0043857_2395_3087 | 230 |
| 240 | 3300047472 | Ga0495686_0003616 | Ga0495686_0003616_6638_7336 | 230 |
| 241 | 3300047673 | Ga0495593_0012633 | Ga0495593_0012633_1726_2418 | 230 |
| 242 | 3300048089 | Ga0495614_0120564 | Ga0495614_0120564_439_1131 | 230 |
| 243 | 3300050491 | nmdc:mga00v17_11417_c1 | nmdc:mga00v17_11417_c1_1186_1884 | 230 |
| 244 | 3300050491 | nmdc:mga00v17_23631_c1 | nmdc:mga00v17_23631_c1_872_1570 | 230 |
| 245 | 3300053085 | Ga0495619_0134277 | Ga0495619_0134277_112_804 | 230 |
| 246 | 3300061719 | Ga0466962_0009981 | Ga0466962_0009981_3605_4297 | 230 |
| 247 | 3300006844 | Ga0075428_100014477 | Ga0075428_1000144774 | 231 |
| 248 | 3300006846 | Ga0075430_100234431 | Ga0075430_1002344312 | 231 |
| 249 | 3300006847 | Ga0075431_100054720 | Ga0075431_1000547204 | 231 |
| 250 | 3300009147 | Ga0114129_10041263 | Ga0114129_100412634 | 231 |
| 251 | 3300009545 | Ga0105237_10008410 | Ga0105237_100084103 | 231 |
| 252 | 3300010375 | Ga0105239_10006534 | Ga0105239_100065348 | 231 |
| 253 | 3300025914 | Ga0207671_10008558 | Ga0207671_100085583 | 231 |
| 254 | 3300046524 | Ga0495648_0017697 | Ga0495648_0017697_1687_2391 | 231 |
| 255 | 3300047320 | Ga0495672_0002688 | Ga0495672_0002688_13368_14072 | 231 |
| 256 | 3300047469 | Ga0495673_0000723 | Ga0495673_0000723_22057_22761 | 231 |
| 257 | 3300048903 | Ga0496100_0000505 | Ga0496100_0000505_16436_17176 | 231 |
| 258 | 3300048904 | Ga0496101_0000077 | Ga0496101_0000077_13010_13750 | 231 |
| 259 | 3300048905 | Ga0496102_0000037 | Ga0496102_0000037_185400_186140 | 231 |
| 260 | 3300048906 | Ga0496103_0000004 | Ga0496103_0000004_496112_496852 | 231 |
| 261 | 3300048909 | Ga0496106_0042481 | Ga0496106_0042481_356_1096 | 231 |
| 262 | 3300048910 | Ga0496107_0016429 | Ga0496107_0016429_1683_2423 | 231 |
| 263 | 3300048919 | Ga0496116_0000056 | Ga0496116_0000056_185843_186583 | 231 |
| 264 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_1694515_1695255 | 231 |
| 265 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_1694518_1695258 | 231 |
| 266 | 3300048922 | Ga0496119_0014032 | Ga0496119_0014032_180_920 | 231 |
| 267 | 3300048923 | Ga0496120_0006295 | Ga0496120_0006295_97_837 | 231 |
| 268 | 3300048924 | Ga0496121_0000790 | Ga0496121_0000790_6247_6987 | 231 |
| 269 | 3300048929 | Ga0496126_0004156 | Ga0496126_0004156_13757_14497 | 231 |
| 270 | 3300050507 | nmdc:mga05p37_26068_c1 | nmdc:mga05p37_26068_c1_534_1229 | 231 |
| 271 | 3300050509 | nmdc:mga0qj67_104168_c2 | nmdc:mga0qj67_104168_c2_654_1349 | 231 |
| 272 | 3300050510 | nmdc:mga06r32_137043_c1 | nmdc:mga06r32_137043_c1_1588_2283 | 231 |
| 273 | 3300009098 | Ga0105245_10419384 | Ga0105245_104193841 | 232 |
| 274 | 3300010375 | Ga0105239_10051721 | Ga0105239_100517212 | 232 |
| 275 | 3300025303 | Ga0209051_1000042 | Ga0209051_1000042229 | 232 |
| 276 | 3300025903 | Ga0207680_10098755 | Ga0207680_100987552 | 232 |
| 277 | 3300025927 | Ga0207687_10348566 | Ga0207687_103485661 | 232 |
| 278 | 3300044656 | Ga0466969_0034754 | Ga0466969_0034754_113_853 | 232 |
| 279 | 3300044683 | Ga0466965_0002816 | Ga0466965_0002816_3753_4463 | 232 |
| 280 | 3300044684 | Ga0466966_0001426 | Ga0466966_0001426_4078_4818 | 232 |
| 281 | 3300044693 | Ga0466961_0001731 | Ga0466961_0001731_4852_5592 | 232 |
| 282 | 3300044694 | Ga0466963_0235968 | Ga0466963_0235968_479_1219 | 232 |
| 283 | 3300044842 | Ga0466957_0002495 | Ga0466957_0002495_4563_5303 | 232 |
| 284 | 3300045836 | Ga0466958_0000266 | Ga0466958_0000266_7131_7871 | 232 |
| 285 | 3300045976 | Ga0466967_0097927 | Ga0466967_0097927_1140_1850 | 232 |
| 286 | 3300048903 | Ga0496100_0000127 | Ga0496100_0000127_32306_33016 | 232 |
| 287 | 3300048904 | Ga0496101_0000068 | Ga0496101_0000068_106404_107114 | 232 |
| 288 | 3300048904 | Ga0496101_0284767 | Ga0496101_0284767_565_1266 | 232 |
| 289 | 3300048905 | Ga0496102_0007572 | Ga0496102_0007572_7805_8515 | 232 |
| 290 | 3300048906 | Ga0496103_0000790 | Ga0496103_0000790_7546_8256 | 232 |
| 291 | 3300048910 | Ga0496107_0001228 | Ga0496107_0001228_12738_13448 | 232 |
| 292 | 3300048911 | Ga0496108_0015138 | Ga0496108_0015138_3601_4311 | 232 |
| 293 | 3300048911 | Ga0496108_0029070 | Ga0496108_0029070_274_984 | 232 |
| 294 | 3300048912 | Ga0496109_0001366 | Ga0496109_0001366_7357_8067 | 232 |
| 295 | 3300048912 | Ga0496109_0035094 | Ga0496109_0035094_1871_2581 | 232 |
| 296 | 3300048913 | Ga0496110_0001103 | Ga0496110_0001103_8153_8863 | 232 |
| 297 | 3300048914 | Ga0496111_0005185 | Ga0496111_0005185_6761_7471 | 232 |
| 298 | 3300048916 | Ga0496113_0008358 | Ga0496113_0008358_5832_6533 | 232 |
| 299 | 3300048917 | Ga0496114_0000110 | Ga0496114_0000110_21937_22647 | 232 |
| 300 | 3300048918 | Ga0496115_0030537 | Ga0496115_0030537_1306_2016 | 232 |
| 301 | 3300048919 | Ga0496116_0017744 | Ga0496116_0017744_470_1180 | 232 |
| 302 | 3300048921 | Ga0496118_0016303 | Ga0496118_0016303_2490_3200 | 232 |
| 303 | 3300048922 | Ga0496119_0006924 | Ga0496119_0006924_1305_2015 | 232 |
| 304 | 3300048924 | Ga0496121_0000023 | Ga0496121_0000023_149017_149727 | 232 |
| 305 | 3300048925 | Ga0496122_0000038 | Ga0496122_0000038_149017_149727 | 232 |
| 306 | 3300048926 | Ga0496123_0011888 | Ga0496123_0011888_5301_6011 | 232 |
| 307 | 3300048926 | Ga0496123_0035768 | Ga0496123_0035768_955_1656 | 232 |
| 308 | 3300048927 | Ga0496124_0000014 | Ga0496124_0000014_149017_149727 | 232 |
| 309 | 3300048928 | Ga0496125_0000020 | Ga0496125_0000020_313722_314432 | 232 |
| 310 | 3300048929 | Ga0496126_0000023 | Ga0496126_0000023_149017_149727 | 232 |
| 311 | 3300048929 | Ga0496126_0035324 | Ga0496126_0035324_1412_2113 | 232 |
| 312 | 3300050496 | nmdc:mga07m45_106057_c1 | nmdc:mga07m45_106057_c1_419_1117 | 232 |
| 313 | 3300001977 | JGI24746J21847_1007734 | JGI24746J21847_10077342 | 233 |
| 314 | 3300001989 | JGI24739J22299_10085623 | JGI24739J22299_100856232 | 233 |
| 315 | 3300002070 | JGI24750J21931_1001193 | JGI24750J21931_10011932 | 233 |
| 316 | 3300002077 | JGI24744J21845_10002079 | JGI24744J21845_100020792 | 233 |
| 317 | 3300002077 | JGI24744J21845_10007863 | JGI24744J21845_100078632 | 233 |
| 318 | 3300002239 | JGI24034J26672_10013415 | JGI24034J26672_100134152 | 233 |
| 319 | 3300002244 | JGI24742J22300_10000911 | JGI24742J22300_100009112 | 233 |
| 320 | 3300002244 | JGI24742J22300_10032469 | JGI24742J22300_100324691 | 233 |
| 321 | 3300005328 | Ga0070676_10061696 | Ga0070676_100616961 | 233 |
| 322 | 3300005329 | Ga0070683_100146586 | Ga0070683_1001465862 | 233 |
| 323 | 3300005334 | Ga0068869_100205057 | Ga0068869_1002050572 | 233 |
| 324 | 3300005335 | Ga0070666_10052854 | Ga0070666_100528543 | 233 |
| 325 | 3300005335 | Ga0070666_10225083 | Ga0070666_102250831 | 233 |
| 326 | 3300005337 | Ga0070682_100015442 | Ga0070682_1000154424 | 233 |
| 327 | 3300005337 | Ga0070682_100029056 | Ga0070682_1000290565 | 233 |
| 328 | 3300005338 | Ga0068868_100001612 | Ga0068868_1000016129 | 233 |
| 329 | 3300005340 | Ga0070689_100030572 | Ga0070689_1000305722 | 233 |
| 330 | 3300005341 | Ga0070691_10014157 | Ga0070691_100141572 | 233 |
| 331 | 3300005347 | Ga0070668_100022683 | Ga0070668_1000226833 | 233 |
| 332 | 3300005347 | Ga0070668_100135030 | Ga0070668_1001350302 | 233 |
| 333 | 3300005354 | Ga0070675_100128870 | Ga0070675_1001288702 | 233 |
| 334 | 3300005356 | Ga0070674_100002940 | Ga0070674_1000029402 | 233 |
| 335 | 3300005356 | Ga0070674_100065393 | Ga0070674_1000653933 | 233 |
| 336 | 3300005364 | Ga0070673_100091600 | Ga0070673_1000916003 | 233 |
| 337 | 3300005365 | Ga0070688_100032775 | Ga0070688_1000327752 | 233 |
| 338 | 3300005366 | Ga0070659_100086836 | Ga0070659_1000868362 | 233 |
| 339 | 3300005367 | Ga0070667_100000630 | Ga0070667_10000063032 | 233 |
| 340 | 3300005367 | Ga0070667_100046633 | Ga0070667_1000466332 | 233 |
| 341 | 3300005367 | Ga0070667_100268632 | Ga0070667_1002686322 | 233 |
| 342 | 3300005434 | Ga0070709_10011706 | Ga0070709_100117064 | 233 |
| 343 | 3300005434 | Ga0070709_10086658 | Ga0070709_100866582 | 233 |
| 344 | 3300005437 | Ga0070710_10001814 | Ga0070710_1000181410 | 233 |
| 345 | 3300005437 | Ga0070710_10030703 | Ga0070710_100307034 | 233 |
| 346 | 3300005439 | Ga0070711_100004140 | Ga0070711_1000041407 | 233 |
| 347 | 3300005439 | Ga0070711_100021930 | Ga0070711_1000219302 | 233 |
| 348 | 3300005440 | Ga0070705_100033952 | Ga0070705_1000339523 | 233 |
| 349 | 3300005441 | Ga0070700_100010917 | Ga0070700_1000109174 | 233 |
| 350 | 3300005444 | Ga0070694_100287910 | Ga0070694_1002879101 | 233 |
| 351 | 3300005455 | Ga0070663_100063385 | Ga0070663_1000633853 | 233 |
| 352 | 3300005455 | Ga0070663_100416063 | Ga0070663_1004160631 | 233 |
| 353 | 3300005456 | Ga0070678_100028925 | Ga0070678_1000289253 | 233 |
| 354 | 3300005456 | Ga0070678_100296246 | Ga0070678_1002962461 | 233 |
| 355 | 3300005457 | Ga0070662_100043124 | Ga0070662_1000431242 | 233 |
| 356 | 3300005459 | Ga0068867_100133741 | Ga0068867_1001337412 | 233 |
| 357 | 3300005466 | Ga0070685_10046240 | Ga0070685_100462403 | 233 |
| 358 | 3300005539 | Ga0068853_100024683 | Ga0068853_1000246834 | 233 |
| 359 | 3300005545 | Ga0070695_100055867 | Ga0070695_1000558672 | 233 |
| 360 | 3300005545 | Ga0070695_100405504 | Ga0070695_1004055042 | 233 |
| 361 | 3300005546 | Ga0070696_100024989 | Ga0070696_1000249894 | 233 |
| 362 | 3300005547 | Ga0070693_100067435 | Ga0070693_1000674353 | 233 |
| 363 | 3300005548 | Ga0070665_100003013 | Ga0070665_1000030134 | 233 |
| 364 | 3300005548 | Ga0070665_100027844 | Ga0070665_1000278444 | 233 |
| 365 | 3300005548 | Ga0070665_100075491 | Ga0070665_1000754912 | 233 |
| 366 | 3300005549 | Ga0070704_100002135 | Ga0070704_10000213510 | 233 |
| 367 | 3300005549 | Ga0070704_100033410 | Ga0070704_1000334104 | 233 |
| 368 | 3300005564 | Ga0070664_100125355 | Ga0070664_1001253552 | 233 |
| 369 | 3300005578 | Ga0068854_100000630 | Ga0068854_10000063015 | 233 |
| 370 | 3300005578 | Ga0068854_100090814 | Ga0068854_1000908142 | 233 |
| 371 | 3300005578 | Ga0068854_100134966 | Ga0068854_1001349662 | 233 |
| 372 | 3300005614 | Ga0068856_100160713 | Ga0068856_1001607132 | 233 |
| 373 | 3300005615 | Ga0070702_100000790 | Ga0070702_1000007908 | 233 |
| 374 | 3300005615 | Ga0070702_100206733 | Ga0070702_1002067332 | 233 |
| 375 | 3300005616 | Ga0068852_100061558 | Ga0068852_1000615583 | 233 |
| 376 | 3300005616 | Ga0068852_100168042 | Ga0068852_1001680422 | 233 |
| 377 | 3300005617 | Ga0068859_100005238 | Ga0068859_1000052384 | 233 |
| 378 | 3300005617 | Ga0068859_100072360 | Ga0068859_1000723602 | 233 |
| 379 | 3300005618 | Ga0068864_100368031 | Ga0068864_1003680312 | 233 |
| 380 | 3300005718 | Ga0068866_10007220 | Ga0068866_100072203 | 233 |
| 381 | 3300005719 | Ga0068861_100002991 | Ga0068861_10000299111 | 233 |
| 382 | 3300005719 | Ga0068861_100757340 | Ga0068861_1007573401 | 233 |
| 383 | 3300005841 | Ga0068863_100035405 | Ga0068863_1000354054 | 233 |
| 384 | 3300005841 | Ga0068863_100416546 | Ga0068863_1004165462 | 233 |
| 385 | 3300005842 | Ga0068858_100220055 | Ga0068858_1002200552 | 233 |
| 386 | 3300005843 | Ga0068860_100002676 | Ga0068860_10000267612 | 233 |
| 387 | 3300005843 | Ga0068860_100052794 | Ga0068860_1000527942 | 233 |
| 388 | 3300005844 | Ga0068862_100005303 | Ga0068862_1000053034 | 233 |
| 389 | 3300006038 | Ga0075365_10002478 | Ga0075365_100024783 | 233 |
| 390 | 3300006048 | Ga0075363_100047914 | Ga0075363_1000479142 | 233 |
| 391 | 3300006051 | Ga0075364_10001593 | Ga0075364_100015937 | 233 |
| 392 | 3300006163 | Ga0070715_10001473 | Ga0070715_100014735 | 233 |
| 393 | 3300006173 | Ga0070716_100003182 | Ga0070716_1000031823 | 233 |
| 394 | 3300006173 | Ga0070716_100013912 | Ga0070716_1000139122 | 233 |
| 395 | 3300006175 | Ga0070712_100042742 | Ga0070712_1000427423 | 233 |
| 396 | 3300006177 | Ga0075362_10003816 | Ga0075362_100038162 | 233 |
| 397 | 3300006178 | Ga0075367_10007733 | Ga0075367_100077333 | 233 |
| 398 | 3300006186 | Ga0075369_10000862 | Ga0075369_1000086210 | 233 |
| 399 | 3300006186 | Ga0075369_10002150 | Ga0075369_100021504 | 233 |
| 400 | 3300006237 | Ga0097621_100433321 | Ga0097621_1004333211 | 233 |
| 401 | 3300006358 | Ga0068871_100149084 | Ga0068871_1001490842 | 233 |
| 402 | 3300006931 | Ga0097620_100005238 | Ga0097620_1000052384 | 233 |
| 403 | 3300006931 | Ga0097620_100072357 | Ga0097620_1000723572 | 233 |
| 404 | 3300007788 | Ga0099795_10042009 | Ga0099795_100420091 | 233 |
| 405 | 3300009092 | Ga0105250_10126648 | Ga0105250_101266482 | 233 |
| 406 | 3300009092 | Ga0105250_10207429 | Ga0105250_102074291 | 233 |
| 407 | 3300009098 | Ga0105245_10304822 | Ga0105245_103048222 | 233 |
| 408 | 3300009101 | Ga0105247_10000058 | Ga0105247_10000058107 | 233 |
| 409 | 3300009101 | Ga0105247_10000570 | Ga0105247_100005702 | 233 |
| 410 | 3300009101 | Ga0105247_10030307 | Ga0105247_100303073 | 233 |
| 411 | 3300009147 | Ga0114129_10366563 | Ga0114129_103665632 | 233 |
| 412 | 3300009148 | Ga0105243_10001753 | Ga0105243_1000175313 | 233 |
| 413 | 3300009174 | Ga0105241_10463878 | Ga0105241_104638782 | 233 |
| 414 | 3300009176 | Ga0105242_10000909 | Ga0105242_100009094 | 233 |
| 415 | 3300009176 | Ga0105242_10314795 | Ga0105242_103147952 | 233 |
| 416 | 3300009177 | Ga0105248_10000325 | Ga0105248_100003254 | 233 |
| 417 | 3300009177 | Ga0105248_10010646 | Ga0105248_100106468 | 233 |
| 418 | 3300009177 | Ga0105248_10155227 | Ga0105248_101552272 | 233 |
| 419 | 3300009177 | Ga0105248_10459240 | Ga0105248_104592402 | 233 |
| 420 | 3300009545 | Ga0105237_10033885 | Ga0105237_100338851 | 233 |
| 421 | 3300009545 | Ga0105237_10270874 | Ga0105237_102708742 | 233 |
| 422 | 3300009551 | Ga0105238_10109994 | Ga0105238_101099942 | 233 |
| 423 | 3300009553 | Ga0105249_10000087 | Ga0105249_1000008732 | 233 |
| 424 | 3300009553 | Ga0105249_10001452 | Ga0105249_100014528 | 233 |
| 425 | 3300009553 | Ga0105249_10179896 | Ga0105249_101798962 | 233 |
| 426 | 3300010159 | Ga0099796_10048894 | Ga0099796_100488942 | 233 |
| 427 | 3300010375 | Ga0105239_10004193 | Ga0105239_100041937 | 233 |
| 428 | 3300013102 | Ga0157371_10194850 | Ga0157371_101948502 | 233 |
| 429 | 3300013105 | Ga0157369_10935180 | Ga0157369_109351801 | 233 |
| 430 | 3300013296 | Ga0157374_10078134 | Ga0157374_100781343 | 233 |
| 431 | 3300013297 | Ga0157378_10000869 | Ga0157378_100008698 | 233 |
| 432 | 3300013297 | Ga0157378_10143708 | Ga0157378_101437082 | 233 |
| 433 | 3300013306 | Ga0163162_10025393 | Ga0163162_100253934 | 233 |
| 434 | 3300013306 | Ga0163162_10412549 | Ga0163162_104125492 | 233 |
| 435 | 3300013307 | Ga0157372_10021535 | Ga0157372_100215354 | 233 |
| 436 | 3300013307 | Ga0157372_10260324 | Ga0157372_102603242 | 233 |
| 437 | 3300013308 | Ga0157375_10079810 | Ga0157375_100798103 | 233 |
| 438 | 3300014325 | Ga0163163_10002753 | Ga0163163_1000275313 | 233 |
| 439 | 3300014326 | Ga0157380_10272803 | Ga0157380_102728032 | 233 |
| 440 | 3300014745 | Ga0157377_10050566 | Ga0157377_100505663 | 233 |
| 441 | 3300014968 | Ga0157379_10008443 | Ga0157379_100084434 | 233 |
| 442 | 3300014968 | Ga0157379_10253320 | Ga0157379_102533202 | 233 |
| 443 | 3300014969 | Ga0157376_10374191 | Ga0157376_103741911 | 233 |
| 444 | 3300017792 | Ga0163161_10005171 | Ga0163161_100051718 | 233 |
| 445 | 3300025711 | Ga0207696_1032663 | Ga0207696_10326632 | 233 |
| 446 | 3300025898 | Ga0207692_10000814 | Ga0207692_100008144 | 233 |
| 447 | 3300025898 | Ga0207692_10070552 | Ga0207692_100705522 | 233 |
| 448 | 3300025899 | Ga0207642_10000644 | Ga0207642_1000064410 | 233 |
| 449 | 3300025901 | Ga0207688_10001946 | Ga0207688_100019466 | 233 |
| 450 | 3300025901 | Ga0207688_10006102 | Ga0207688_100061026 | 233 |
| 451 | 3300025904 | Ga0207647_10086182 | Ga0207647_100861823 | 233 |
| 452 | 3300025905 | Ga0207685_10001708 | Ga0207685_100017083 | 233 |
| 453 | 3300025906 | Ga0207699_10085912 | Ga0207699_100859122 | 233 |
| 454 | 3300025907 | Ga0207645_10053987 | Ga0207645_100539871 | 233 |
| 455 | 3300025907 | Ga0207645_10060293 | Ga0207645_100602933 | 233 |
| 456 | 3300025915 | Ga0207693_10001502 | Ga0207693_100015024 | 233 |
| 457 | 3300025916 | Ga0207663_10001892 | Ga0207663_100018929 | 233 |
| 458 | 3300025918 | Ga0207662_10088083 | Ga0207662_100880832 | 233 |
| 459 | 3300025919 | Ga0207657_10195782 | Ga0207657_101957822 | 233 |
| 460 | 3300025924 | Ga0207694_10098702 | Ga0207694_100987022 | 233 |
| 461 | 3300025925 | Ga0207650_10307173 | Ga0207650_103071732 | 233 |
| 462 | 3300025926 | Ga0207659_10135336 | Ga0207659_101353362 | 233 |
| 463 | 3300025927 | Ga0207687_10001805 | Ga0207687_100018059 | 233 |
| 464 | 3300025927 | Ga0207687_10097814 | Ga0207687_100978142 | 233 |
| 465 | 3300025931 | Ga0207644_10067164 | Ga0207644_100671642 | 233 |
| 466 | 3300025932 | Ga0207690_10081976 | Ga0207690_100819762 | 233 |
| 467 | 3300025934 | Ga0207686_10313465 | Ga0207686_103134652 | 233 |
| 468 | 3300025935 | Ga0207709_10003346 | Ga0207709_100033467 | 233 |
| 469 | 3300025935 | Ga0207709_10095923 | Ga0207709_100959232 | 233 |
| 470 | 3300025936 | Ga0207670_10035996 | Ga0207670_100359963 | 233 |
| 471 | 3300025936 | Ga0207670_10206431 | Ga0207670_102064312 | 233 |
| 472 | 3300025937 | Ga0207669_10000374 | Ga0207669_1000037413 | 233 |
| 473 | 3300025938 | Ga0207704_10001199 | Ga0207704_1000119910 | 233 |
| 474 | 3300025938 | Ga0207704_10263603 | Ga0207704_102636032 | 233 |
| 475 | 3300025939 | Ga0207665_10000595 | Ga0207665_1000059518 | 233 |
| 476 | 3300025939 | Ga0207665_10002059 | Ga0207665_100020594 | 233 |
| 477 | 3300025941 | Ga0207711_10015782 | Ga0207711_100157826 | 233 |
| 478 | 3300025942 | Ga0207689_10046755 | Ga0207689_100467553 | 233 |
| 479 | 3300025945 | Ga0207679_10205496 | Ga0207679_102054962 | 233 |
| 480 | 3300025949 | Ga0207667_10203163 | Ga0207667_102031632 | 233 |
| 481 | 3300025960 | Ga0207651_10029288 | Ga0207651_100292884 | 233 |
| 482 | 3300025960 | Ga0207651_10365420 | Ga0207651_103654201 | 233 |
| 483 | 3300025961 | Ga0207712_10002257 | Ga0207712_100022577 | 233 |
| 484 | 3300025961 | Ga0207712_10195933 | Ga0207712_101959331 | 233 |
| 485 | 3300025972 | Ga0207668_10025467 | Ga0207668_100254674 | 233 |
| 486 | 3300025972 | Ga0207668_10110376 | Ga0207668_101103762 | 233 |
| 487 | 3300025972 | Ga0207668_10400468 | Ga0207668_104004682 | 233 |
| 488 | 3300025972 | Ga0207668_10667009 | Ga0207668_106670091 | 233 |
| 489 | 3300025981 | Ga0207640_10002335 | Ga0207640_1000233510 | 233 |
| 490 | 3300025981 | Ga0207640_10097099 | Ga0207640_100970992 | 233 |
| 491 | 3300025981 | Ga0207640_10281144 | Ga0207640_102811441 | 233 |
| 492 | 3300025986 | Ga0207658_10014508 | Ga0207658_100145083 | 233 |
| 493 | 3300025986 | Ga0207658_10044474 | Ga0207658_100444742 | 233 |
| 494 | 3300026023 | Ga0207677_10145948 | Ga0207677_101459482 | 233 |
| 495 | 3300026035 | Ga0207703_10026853 | Ga0207703_100268534 | 233 |
| 496 | 3300026035 | Ga0207703_10360041 | Ga0207703_103600412 | 233 |
| 497 | 3300026035 | Ga0207703_10474036 | Ga0207703_104740361 | 233 |
| 498 | 3300026067 | Ga0207678_10036482 | Ga0207678_100364822 | 233 |
| 499 | 3300026075 | Ga0207708_10000982 | Ga0207708_1000098220 | 233 |
| 500 | 3300026075 | Ga0207708_10004706 | Ga0207708_100047069 | 233 |
| 501 | 3300026088 | Ga0207641_10016504 | Ga0207641_100165044 | 233 |
| 502 | 3300026088 | Ga0207641_10221864 | Ga0207641_102218642 | 233 |
| 503 | 3300026089 | Ga0207648_10000599 | Ga0207648_1000059926 | 233 |
| 504 | 3300026089 | Ga0207648_10006604 | Ga0207648_1000660415 | 233 |
| 505 | 3300026118 | Ga0207675_100080332 | Ga0207675_1000803324 | 233 |
| 506 | 3300026118 | Ga0207675_100123489 | Ga0207675_1001234891 | 233 |
| 507 | 3300026121 | Ga0207683_10007631 | Ga0207683_100076312 | 233 |
| 508 | 3300026121 | Ga0207683_10111488 | Ga0207683_101114882 | 233 |
| 509 | 3300026142 | Ga0207698_10022934 | Ga0207698_100229342 | 233 |
| 510 | 3300026142 | Ga0207698_10155817 | Ga0207698_101558173 | 233 |
| 511 | 3300028379 | Ga0268266_10011626 | Ga0268266_1001162610 | 233 |
| 512 | 3300028379 | Ga0268266_10256744 | Ga0268266_102567442 | 233 |
| 513 | 3300028380 | Ga0268265_10032003 | Ga0268265_100320033 | 233 |
| 514 | 3300028380 | Ga0268265_10487995 | Ga0268265_104879951 | 233 |
| 515 | 3300028381 | Ga0268264_10004587 | Ga0268264_1000458710 | 233 |
| 516 | 3300028381 | Ga0268264_10616825 | Ga0268264_106168252 | 233 |
| 517 | 3300031824 | Ga0307413_10615925 | Ga0307413_106159251 | 233 |
| 518 | 3300035115 | Ga0373941_0033606 | Ga0373941_0033606_629_1330 | 233 |
| 519 | 3300035691 | Ga0373931_0089890 | Ga0373931_0089890_560_1261 | 233 |
| 520 | 3300039450 | Ga0436363_1310990 | Ga0436363_1310990_601_1305 | 233 |
| 521 | 3300041411 | Ga0439466_0005537 | Ga0439466_0005537_3934_4638 | 233 |
| 522 | 3300041413 | Ga0439465_0017299 | Ga0439465_0017299_184_888 | 233 |
| 523 | 3300041443 | Ga0451789_0443718 | Ga0451789_0443718_727_1431 | 233 |
| 524 | 3300041997 | Ga0439431_0034457 | Ga0439431_0034457_428_1132 | 233 |
| 525 | 3300042002 | Ga0439442_004448 | Ga0439442_004448_101_805 | 233 |
| 526 | 3300042004 | Ga0439445_0002825 | Ga0439445_0002825_1283_1987 | 233 |
| 527 | 3300042435 | Ga0439434_0014646 | Ga0439434_0014646_1021_1725 | 233 |
| 528 | 3300044658 | Ga0466972_0001669 | Ga0466972_0001669_4749_5450 | 233 |
| 529 | 3300044658 | Ga0466972_0009736 | Ga0466972_0009736_2737_3441 | 233 |
| 530 | 3300044683 | Ga0466965_0004402 | Ga0466965_0004402_3717_4433 | 233 |
| 531 | 3300044683 | Ga0466965_0016628 | Ga0466965_0016628_2019_2720 | 233 |
| 532 | 3300044683 | Ga0466965_0071608 | Ga0466965_0071608_650_1354 | 233 |
| 533 | 3300044706 | Ga0466964_0028839 | Ga0466964_0028839_822_1523 | 233 |
| 534 | 3300044735 | Ga0466968_0035826 | Ga0466968_0035826_463_1164 | 233 |
| 535 | 3300044765 | Ga0466970_0002428 | Ga0466970_0002428_5460_6161 | 233 |
| 536 | 3300044842 | Ga0466957_0018332 | Ga0466957_0018332_1739_2440 | 233 |
| 537 | 3300044901 | Ga0466960_0000201 | Ga0466960_0000201_12096_12812 | 233 |
| 538 | 3300044901 | Ga0466960_0001933 | Ga0466960_0001933_1495_2196 | 233 |
| 539 | 3300044901 | Ga0466960_0048242 | Ga0466960_0048242_1126_1830 | 233 |
| 540 | 3300044901 | Ga0466960_0210670 | Ga0466960_0210670_203_907 | 233 |
| 541 | 3300045049 | Ga0466959_0028309 | Ga0466959_0028309_1346_2047 | 233 |
| 542 | 3300045976 | Ga0466967_0086733 | Ga0466967_0086733_1188_1895 | 233 |
| 543 | 3300045976 | Ga0466967_0204257 | Ga0466967_0204257_289_993 | 233 |
| 544 | 3300046460 | Ga0495638_0000244 | Ga0495638_0000244_47934_48647 | 233 |
| 545 | 3300046616 | Ga0495668_0163045 | Ga0495668_0163045_225_938 | 233 |
| 546 | 3300047320 | Ga0495672_0092493 | Ga0495672_0092493_535_1239 | 233 |
| 547 | 3300048903 | Ga0496100_0017532 | Ga0496100_0017532_1242_1943 | 233 |
| 548 | 3300048903 | Ga0496100_0080538 | Ga0496100_0080538_1042_1746 | 233 |
| 549 | 3300048903 | Ga0496100_0240241 | Ga0496100_0240241_37_741 | 233 |
| 550 | 3300048904 | Ga0496101_0050228 | Ga0496101_0050228_2010_2711 | 233 |
| 551 | 3300048904 | Ga0496101_0233862 | Ga0496101_0233862_200_904 | 233 |
| 552 | 3300048905 | Ga0496102_0000594 | Ga0496102_0000594_32586_33290 | 233 |
| 553 | 3300048905 | Ga0496102_0024070 | Ga0496102_0024070_2000_2701 | 233 |
| 554 | 3300048905 | Ga0496102_0033049 | Ga0496102_0033049_1573_2274 | 233 |
| 555 | 3300048905 | Ga0496102_0128960 | Ga0496102_0128960_994_1695 | 233 |
| 556 | 3300048905 | Ga0496102_0206832 | Ga0496102_0206832_1086_1787 | 233 |
| 557 | 3300048906 | Ga0496103_0000450 | Ga0496103_0000450_1427_2131 | 233 |
| 558 | 3300048906 | Ga0496103_0005646 | Ga0496103_0005646_462_1163 | 233 |
| 559 | 3300048906 | Ga0496103_0035441 | Ga0496103_0035441_2004_2708 | 233 |
| 560 | 3300048907 | Ga0496104_0000418 | Ga0496104_0000418_4860_5567 | 233 |
| 561 | 3300048907 | Ga0496104_0050862 | Ga0496104_0050862_2985_3689 | 233 |
| 562 | 3300048908 | Ga0496105_0029102 | Ga0496105_0029102_914_1618 | 233 |
| 563 | 3300048908 | Ga0496105_0029487 | Ga0496105_0029487_1567_2274 | 233 |
| 564 | 3300048909 | Ga0496106_0001341 | Ga0496106_0001341_12998_13699 | 233 |
| 565 | 3300048909 | Ga0496106_0014139 | Ga0496106_0014139_3161_3868 | 233 |
| 566 | 3300048909 | Ga0496106_0014226 | Ga0496106_0014226_2436_3137 | 233 |
| 567 | 3300048910 | Ga0496107_0000392 | Ga0496107_0000392_13431_14132 | 233 |
| 568 | 3300048910 | Ga0496107_0022615 | Ga0496107_0022615_1187_1894 | 233 |
| 569 | 3300048910 | Ga0496107_0108430 | Ga0496107_0108430_1168_1869 | 233 |
| 570 | 3300048911 | Ga0496108_0004384 | Ga0496108_0004384_8854_9555 | 233 |
| 571 | 3300048911 | Ga0496108_0134855 | Ga0496108_0134855_207_911 | 233 |
| 572 | 3300048912 | Ga0496109_0006296 | Ga0496109_0006296_4901_5602 | 233 |
| 573 | 3300048912 | Ga0496109_0031691 | Ga0496109_0031691_3437_4141 | 233 |
| 574 | 3300048912 | Ga0496109_0081120 | Ga0496109_0081120_1276_1980 | 233 |
| 575 | 3300048912 | Ga0496109_0917108 | Ga0496109_0917108_43_747 | 233 |
| 576 | 3300048913 | Ga0496110_0044601 | Ga0496110_0044601_36_740 | 233 |
| 577 | 3300048913 | Ga0496110_0080650 | Ga0496110_0080650_1697_2401 | 233 |
| 578 | 3300048913 | Ga0496110_0238058 | Ga0496110_0238058_815_1516 | 233 |
| 579 | 3300048914 | Ga0496111_0174712 | Ga0496111_0174712_743_1444 | 233 |
| 580 | 3300048915 | Ga0496112_0006704 | Ga0496112_0006704_4169_4873 | 233 |
| 581 | 3300048915 | Ga0496112_0034049 | Ga0496112_0034049_2267_2971 | 233 |
| 582 | 3300048915 | Ga0496112_0056529 | Ga0496112_0056529_2074_2775 | 233 |
| 583 | 3300048915 | Ga0496112_0088656 | Ga0496112_0088656_801_1505 | 233 |
| 584 | 3300048915 | Ga0496112_0102352 | Ga0496112_0102352_1481_2185 | 233 |
| 585 | 3300048916 | Ga0496113_0313402 | Ga0496113_0313402_76_777 | 233 |
| 586 | 3300048917 | Ga0496114_0002485 | Ga0496114_0002485_10438_11145 | 233 |
| 587 | 3300048917 | Ga0496114_0017992 | Ga0496114_0017992_4812_5513 | 233 |
| 588 | 3300048917 | Ga0496114_0047285 | Ga0496114_0047285_2489_3190 | 233 |
| 589 | 3300048918 | Ga0496115_0103122 | Ga0496115_0103122_34_735 | 233 |
| 590 | 3300048919 | Ga0496116_0007028 | Ga0496116_0007028_3965_4669 | 233 |
| 591 | 3300048920 | Ga0496117_0000206 | Ga0496117_0000206_80395_81099 | 233 |
| 592 | 3300048921 | Ga0496118_0000905 | Ga0496118_0000905_11663_12367 | 233 |
| 593 | 3300048922 | Ga0496119_0005342 | Ga0496119_0005342_964_1668 | 233 |
| 594 | 3300048923 | Ga0496120_0017809 | Ga0496120_0017809_2137_2841 | 233 |
| 595 | 3300048924 | Ga0496121_0014805 | Ga0496121_0014805_3318_4022 | 233 |
| 596 | 3300048928 | Ga0496125_0081135 | Ga0496125_0081135_414_1118 | 233 |
| 597 | 3300048929 | Ga0496126_0025068 | Ga0496126_0025068_1582_2286 | 233 |
| 598 | 3300049569 | Ga0501032_0002220 | Ga0501032_0002220_9638_10345 | 233 |
| 599 | 3300049571 | Ga0501034_0016305 | Ga0501034_0016305_3603_4310 | 233 |
| 600 | 3300049572 | Ga0501036_0022652 | Ga0501036_0022652_4540_5247 | 233 |
| 601 | 3300049573 | Ga0501037_0001024 | Ga0501037_0001024_8187_8894 | 233 |
| 602 | 3300049574 | Ga0501038_0008021 | Ga0501038_0008021_4562_5269 | 233 |
| 603 | 3300049575 | Ga0501039_0001582 | Ga0501039_0001582_6705_7412 | 233 |
| 604 | 3300049579 | Ga0501043_0002179 | Ga0501043_0002179_5355_6062 | 233 |
| 605 | 3300049586 | Ga0501070_0002467 | Ga0501070_0002467_4837_5544 | 233 |
| 606 | 3300049589 | Ga0501073_0045427 | Ga0501073_0045427_1529_2236 | 233 |
| 607 | 3300049593 | Ga0501077_0224723 | Ga0501077_0224723_35_742 | 233 |
| 608 | 3300050489 | nmdc:mga03683_3424_c1 | nmdc:mga03683_3424_c1_227_931 | 233 |
| 609 | 3300050490 | nmdc:mga03n38_93749_c1 | nmdc:mga03n38_93749_c1_66_770 | 233 |
| 610 | 3300050491 | nmdc:mga00v17_143562_c1 | nmdc:mga00v17_143562_c1_34_738 | 233 |
| 611 | 3300050491 | nmdc:mga00v17_202750_c1 | nmdc:mga00v17_202750_c1_394_1119 | 233 |
| 612 | 3300050516 | nmdc:mga0sz30_53687_c1 | nmdc:mga0sz30_53687_c1_301_1005 | 233 |
| 613 | 3300053079 | Ga0500610_0005649 | Ga0500610_0005649_97_810 | 233 |
| 614 | 3300053104 | Ga0500556_0002637 | Ga0500556_0002637_2522_3235 | 233 |
| 615 | 3300053108 | Ga0500562_006222 | Ga0500562_006222_221_928 | 233 |
| 616 | 3300053139 | Ga0500568_0039594 | Ga0500568_0039594_876_1589 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zr6-assembly1.cif.gz_B | manganese-dependent transcriptional repressor complex with manganese | 0.9847 | 14 | 232 |
| 5zr6-assembly1.cif.gz_A | manganese-dependent transcriptional repressor complex with manganese | 0.9813 | 14 | 233 |
| 5zr4-assembly1.cif.gz_A | manganese-dependent transcriptional repressor | 0.9747 | 15 | 232 |
| 5zr6-assembly1.cif.gz_A | manganese-dependent transcriptional repressor complex with manganese | 0.9678 | 14 | 233 |
| 5zr6-assembly1.cif.gz_B | manganese-dependent transcriptional repressor complex with manganese | 0.9662 | 14 | 232 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y1Q2_8_79_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 1.008 | 9 | 79 | 1.10.10.10 |
| af_I6Y1Q2_8_79_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9803 | 9 | 79 | 1.10.10.10 |
| af_I6Y1Q2_151_228_2.30.30.90 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.9687 | 151 | 233 | 2.30.30.90 |
| af_Q57988_1_71_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9571 | 10 | 79 | 1.10.10.10 |
| af_I6Y1Q2_151_228_2.30.30.90 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.9564 | 151 | 233 | 2.30.30.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A231HFR8-F1-model_v4 | Manganese transport regulator | 0.9904 | 21 | 233 |
GO:0003700
GO:0005737 GO:0043565 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A399PJQ1-F1-model_v4 | Manganese transport regulator | 0.983 | 5 | 187 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A1H1LF58-F1-model_v4 | Manganese transport regulator | 0.9819 | 10 | 233 |
GO:0003677
GO:0003700 GO:0005737 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A231HFR8-F1-model_v4 | Manganese transport regulator | 0.9809 | 21 | 233 |
GO:0003700
GO:0005737 GO:0043565 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A1A3SL69-F1-model_v4 | Manganese transport regulator | 0.9802 | 1 | 233 |
GO:0003700
GO:0005737 GO:0043565 GO:0045892 GO:0046914 GO:0046983 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar