F469493

General Info

Members Datasets Scaffolds Average Seq Length
615 431 462 101

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_000433|Ga0500618_000433_10392_10748
Length 118
Sequence LCIRLGCLETNLPEITMSAKTTVTSALLATALVSVFATAAHAAPMMKEEGAAKPAAKEKCYGVALKGQNDCAAGPGTSCQGTSTMDYQGNSWKFVPTGTCSSMKVPTGAHGSLMPIKS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
16 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
17 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
20 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
23 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
24 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
25 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
26 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
27 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
28 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
29 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
30 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
31 2643221558 Rhizobium sp. Root149 Isolate Unclassified
32 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
33 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
34 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
35 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
36 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
37 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
38 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
39 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
40 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
41 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
42 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
43 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
44 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
45 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
46 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
47 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
48 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
49 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
50 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
51 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
52 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
53 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
54 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
55 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
56 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
57 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
58 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
59 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
60 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
61 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
62 2855730933 Achromobacter sp. HZ28 Isolate Nodule
63 2855767633 Achromobacter sp. HZ34 Isolate Nodule
64 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
65 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
66 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
67 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
68 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
69 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
70 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
71 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
72 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
73 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
74 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
75 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
76 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
77 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
78 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
79 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
80 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
81 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
82 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
83 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
84 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
85 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
86 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
87 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
88 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
89 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
90 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
91 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
92 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
93 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
94 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
95 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
96 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
97 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
98 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
99 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
100 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
101 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
102 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
103 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
104 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
105 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
106 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
107 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
108 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
109 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
110 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
111 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
112 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
113 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
114 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
115 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
116 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
117 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
118 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
119 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
120 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
121 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
122 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
123 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
124 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
125 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
126 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
127 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
128 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
129 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
130 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
131 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
132 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
133 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
134 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
135 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
136 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
137 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
138 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
139 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
140 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
141 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
142 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
143 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
144 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
145 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
146 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
147 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
148 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
149 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
150 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
151 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
152 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
153 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
154 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
155 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
156 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
157 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
158 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
159 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
160 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
161 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
162 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
163 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
164 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
165 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
166 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
167 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
168 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
169 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
170 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
171 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
172 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
173 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
174 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
175 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
176 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
177 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
178 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
179 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
181 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
182 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
184 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
185 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
186 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
187 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
188 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
189 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
190 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
191 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
192 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
193 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
194 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
195 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
196 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
197 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
198 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
199 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
200 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
201 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
202 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
203 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
204 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
205 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
206 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
207 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
208 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
209 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
210 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
211 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
212 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
213 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
214 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
215 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
216 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
217 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
218 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
219 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
221 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
224 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
225 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
226 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
227 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
228 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
263 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
264 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
265 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
272 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
273 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
274 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
275 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
278 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
279 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
280 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
283 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
284 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
299 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
300 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
301 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
302 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
303 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
304 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
305 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
306 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
307 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
308 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
309 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
310 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
311 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
312 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
313 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
314 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
317 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
318 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
319 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
320 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
321 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
322 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
323 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
324 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
330 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
331 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
343 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
352 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
353 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
354 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
355 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
356 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
359 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
379 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
380 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
381 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
382 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
383 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
395 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
396 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
401 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
402 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
403 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
404 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
407 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
408 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
414 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
415 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
416 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
417 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
418 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
419 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
420 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
421 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
422 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
423 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
424 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
425 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
426 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
427 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
428 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
429 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
430 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
431 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.98
Metatranscriptomes 1.3
Isolates 24.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.69
Nodule 18.21
Rhizoplane 4.72
Rhizosphere 57.24
Stem 0
Stem Tuber 0
Unclassified 14.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001817 3300001979 Bacteria 9779
2 JGI24739J22299_10013493 3300001989 Bacteria 2983
3 JGI24737J22298_10003902 3300001990 Bacteria 5233
4 JGI24735J21928_10021151 3300002067 Bacteria 1988
5 JGI25156J39149_1000017 3300002705 Bacteria 171827
6 JGI25156J39149_1001663 3300002705 Bacteria 8991
7 JGI25156J39149_1001871 3300002705 Bacteria 8221
8 JGI25159J45721_1012046 3300002987 Bacteria 2084
9 JGI25151J46595_10000550 3300003187 Bacteria 34188
10 rootL2_10164238 3300003322 Bacteria 2321
11 rootH1_10008730 3300003316 Bacteria 5409
12 rootH1_10008730 3300003323 Bacteria 8891
13 rootH1_10139894 3300003323 Bacteria 3140
14 JGI25160J50197_1000298 3300003354 Bacteria 35290
15 JGI25161J50226_1000221 3300003374 Bacteria 35290
16 Ga0055539_1021441 3300003752 Bacteria 767
17 Ga0055533_1000350 3300003756 Bacteria 19996
18 Ga0055528_1013537 3300003790 Bacteria 3083
19 Ga0055531_10002582 3300003794 Bacteria 11991
20 Ga0055543_1000722 3300004625 Bacteria 16763
21 Ga0065165_1000983 3300005262 Bacteria 35328
22 Ga0065165_1003357 3300005262 Bacteria 11370
23 Ga0070658_10952087 3300005327 Bacteria 747
24 Ga0070660_101394939 3300005339 Bacteria 595
25 Ga0070689_100114738 3300005340 Bacteria 2146
26 Ga0070675_100471348 3300005354 Bacteria 1128
27 Ga0070659_100888519 3300005366 Bacteria 778
28 Ga0070659_101358312 3300005366 Bacteria 631
29 Ga0070709_10000309 3300005434 Bacteria 30970
30 Ga0070709_10020857 3300005434 Bacteria 3811
31 Ga0070709_10559400 3300005434 Bacteria 876
32 Ga0070709_11081111 3300005434 Bacteria 641
33 Ga0070714_100217104 3300005435 Bacteria 1756
34 Ga0070714_100222257 3300005435 Bacteria 1736
35 Ga0070714_100988288 3300005435 Bacteria 819
36 Ga0070713_100037011 3300005436 Bacteria 3943
37 Ga0070713_100292969 3300005436 Bacteria 1496
38 Ga0070713_100647085 3300005436 Bacteria 1006
39 Ga0070710_10001167 3300005437 Bacteria 12427
40 Ga0070710_10004223 3300005437 Bacteria 6808
41 Ga0070710_10013557 3300005437 Bacteria 4085
42 Ga0070710_10410989 3300005437 Bacteria 909
43 Ga0070711_100010653 3300005439 Bacteria 5696
44 Ga0070711_100021544 3300005439 Bacteria 4169
45 Ga0070711_100081423 3300005439 Bacteria 2307
46 Ga0070711_100124048 3300005439 Bacteria 1915
47 Ga0070711_101692991 3300005439 Bacteria 554
48 Ga0070700_100337869 3300005441 Bacteria 1112
49 Ga0070663_100425954 3300005455 Bacteria 1089
50 Ga0070663_100614496 3300005455 Bacteria 916
51 Ga0070662_100858204 3300005457 Bacteria 773
52 Ga0070706_100814260 3300005467 Bacteria 864
53 Ga0070684_100638999 3300005535 Bacteria 990
54 Ga0070695_101891625 3300005545 Bacteria 501
55 Ga0070693_100317987 3300005547 Bacteria 1055
56 Ga0068855_100284632 3300005563 Bacteria 1834
57 Ga0068857_100197264 3300005577 Bacteria 1834
58 Ga0068856_100128890 3300005614 Bacteria 2534
59 Ga0068859_100895434 3300005617 Bacteria 972
60 Ga0068859_101314072 3300005617 Bacteria 797
61 Ga0068864_100387352 3300005618 Bacteria 1326
62 Ga0068851_10234941 3300005834 Bacteria 1035
63 Ga0068863_100461630 3300005841 Bacteria 1247
64 Ga0068860_100693407 3300005843 Bacteria 1028
65 Ga0081455_10045970 3300005937 Bacteria 3794
66 Ga0081538_10016822 3300005981 Bacteria 5584
67 Ga0081540_1031915 3300005983 Bacteria 2885
68 Ga0070717_10007580 3300006028 Bacteria 8064
69 Ga0070717_10240528 3300006028 Bacteria 1596
70 Ga0070717_10684349 3300006028 Bacteria 932
71 Ga0075365_10073755 3300006038 Bacteria 2301
72 Ga0070715_10005640 3300006163 Bacteria 4191
73 Ga0070715_10032299 3300006163 Bacteria 2132
74 Ga0070715_10146921 3300006163 Bacteria 1151
75 Ga0070716_100007109 3300006173 Bacteria 5497
76 Ga0070716_100129969 3300006173 Bacteria 1591
77 Ga0070716_100213325 3300006173 Bacteria 1292
78 Ga0070712_100009861 3300006175 Bacteria 6020
79 Ga0070712_100011604 3300006175 Bacteria 5594
80 Ga0070712_100029016 3300006175 Bacteria 3707
81 Ga0070712_100045150 3300006175 Bacteria 3041
82 Ga0075362_10126447 3300006177 Bacteria 1213
83 Ga0097621_100348127 3300006237 Bacteria 1317
84 Ga0068871_101860183 3300006358 Bacteria 572
85 Ga0075434_100167075 3300006871 Bacteria 2220
86 Ga0075434_102377087 3300006871 Bacteria 532
87 Ga0097620_100895454 3300006931 Bacteria 972
88 Ga0097620_101314351 3300006931 Bacteria 797
89 Ga0099824_1040842 3300006942 Bacteria 1124
90 Ga0099823_1039281 3300006944 Bacteria 3485
91 Ga0099794_10011441 3300007265 Bacteria 3799
92 Ga0099794_10087820 3300007265 Bacteria 1540
93 Ga0099794_10295199 3300007265 Bacteria 839
94 Ga0099794_10381598 3300007265 Bacteria 735
95 Ga0099795_10001608 3300007788 Bacteria 4985
96 Ga0099795_10020420 3300007788 Bacteria 2158
97 Ga0099795_10077609 3300007788 Bacteria 1265
98 Ga0105251_10139745 3300009011 Unclassified 1096
99 Ga0105244_10000468 3300009036 Bacteria 36858
100 Ga0105240_10235073 3300009093 Bacteria 2127
101 Ga0105240_10262904 3300009093 Bacteria 1990
102 Ga0105245_10182853 3300009098 Bacteria 2004
103 Ga0105247_10042412 3300009101 Bacteria 2787
104 Ga0105247_10199140 3300009101 Bacteria 1345
105 Ga0105241_10002269 3300009174 Bacteria 14448
106 Ga0105241_10179321 3300009174 Bacteria 1756
107 Ga0105241_10607438 3300009174 Bacteria 989
108 Ga0105248_10454753 3300009177 Bacteria 1443
109 Ga0105237_10465240 3300009545 Bacteria 1271
110 Ga0105238_10064772 3300009551 Bacteria 3654
111 Ga0105238_10075801 3300009551 Bacteria 3355
112 Ga0105238_10155076 3300009551 Bacteria 2265
113 Ga0099796_10059630 3300010159 Bacteria 1348
114 Ga0099796_10089406 3300010159 Bacteria 1142
115 Ga0099796_10435035 3300010159 Bacteria 581
116 Ga0099796_10481943 3300010159 Bacteria 554
117 Ga0105239_10148581 3300010375 Bacteria 2615
118 Ga0105239_11822689 3300010375 Bacteria 705
119 Ga0105239_11899824 3300010375 Bacteria 690
120 Ga0105246_10113068 3300011119 Bacteria 1998
121 Ga0105246_11487394 3300011119 Bacteria 635
122 Ga0157373_10000815 3300013100 Bacteria 24126
123 Ga0157371_10001033 3300013102 Bacteria 30544
124 Ga0157369_10012954 3300013105 Bacteria 9449
125 Ga0157369_10723585 3300013105 Bacteria 1024
126 Ga0157378_11230366 3300013297 Bacteria 789
127 Ga0163162_11037884 3300013306 Bacteria 928
128 Ga0157375_10287102 3300013308 Bacteria 1808
129 Ga0157375_10962007 3300013308 Bacteria 995
130 Ga0163163_10159653 3300014325 Bacteria 2300
131 Ga0157379_10084707 3300014968 Bacteria 2840
132 Ga0157376_10406748 3300014969 Bacteria 1317
133 Ga0182005_1115805 3300015265 Bacteria 760
134 Ga0214544_1000035 3300021320 Bacteria 146874
135 Ga0214544_1034689 3300021320 Bacteria 1400
136 Ga0214542_1000181 3300021321 Bacteria 97233
137 Ga0214542_1022159 3300021321 Bacteria 4143
138 Ga0214542_1025925 3300021321 Bacteria 2961
139 Ga0214545_1000094 3300021324 Bacteria 98180
140 Ga0214545_1022480 3300021324 Bacteria 4411
141 Ga0214543_1000155 3300021327 Bacteria 97353
142 Ga0214543_1022736 3300021327 Bacteria 4349
143 Ga0213873_10003859 3300021358 Bacteria 2744
144 Ga0213872_10184508 3300021361 Bacteria 900
145 Ga0213876_10002812 3300021384 Bacteria 10133
146 Ga0213876_10429668 3300021384 Bacteria 702
147 Ga0224572_1091922 3300024225 Bacteria 560
148 Ga0228598_1011147 3300024227 Bacteria 1790
149 Ga0228598_1022644 3300024227 Bacteria 1236
150 Ga0209436_112329 3300025208 Bacteria 1457
151 Ga0209674_100029 3300025226 Bacteria 466683
152 Ga0207425_1085315 3300025245 Bacteria 522
153 Ga0209677_100717 3300025253 Bacteria 16887
154 Ga0209148_1045304 3300025254 Bacteria 590
155 Ga0209759_1000002 3300025256 Bacteria 1027596
156 Ga0209759_1000236 3300025256 Bacteria 82430
157 Ga0209759_1000337 3300025256 Bacteria 61867
158 Ga0209130_1000563 3300025284 Bacteria 36702
159 Ga0209025_1000003 3300025294 Bacteria 1366495
160 Ga0209758_1000117 3300025297 Bacteria 198325
161 Ga0207426_1000272 3300025302 Bacteria 107804
162 Ga0207426_1028087 3300025302 Bacteria 1867
163 Ga0209257_1001342 3300025304 Bacteria 29838
164 Ga0207656_10198954 3300025321 Bacteria 967
165 Ga0207655_1000796 3300025728 Bacteria 34424
166 Ga0207692_10015686 3300025898 Bacteria 3340
167 Ga0207692_10036819 3300025898 Bacteria 2389
168 Ga0207647_10003868 3300025904 Bacteria 11202
169 Ga0207685_10018814 3300025905 Bacteria 2263
170 Ga0207685_10148288 3300025905 Bacteria 1059
171 Ga0207699_10084143 3300025906 Bacteria 1981
172 Ga0207699_10290431 3300025906 Bacteria 1139
173 Ga0207699_10447052 3300025906 Bacteria 927
174 Ga0207699_10499636 3300025906 Bacteria 878
175 Ga0207699_10846995 3300025906 Bacteria 673
176 Ga0207705_11286775 3300025909 Bacteria 559
177 Ga0207684_10506332 3300025910 Bacteria 1035
178 Ga0207654_10000362 3300025911 Bacteria 26747
179 Ga0207654_10548332 3300025911 Bacteria 821
180 Ga0207695_10191316 3300025913 Bacteria 1964
181 Ga0207695_10338224 3300025913 Bacteria 1393
182 Ga0207695_10611894 3300025913 Bacteria 970
183 Ga0207671_10079124 3300025914 Bacteria 2463
184 Ga0207693_10011328 3300025915 Bacteria 7221
185 Ga0207693_10081498 3300025915 Bacteria 2533
186 Ga0207693_10168443 3300025915 Bacteria 1725
187 Ga0207693_10209643 3300025915 Bacteria 1532
188 Ga0207693_10417560 3300025915 Bacteria 1049
189 Ga0207663_10047847 3300025916 Bacteria 2643
190 Ga0207663_10060028 3300025916 Bacteria 2408
191 Ga0207663_10074772 3300025916 Bacteria 2197
192 Ga0207663_11151504 3300025916 Bacteria 624
193 Ga0207663_11366480 3300025916 Bacteria 570
194 Ga0207646_10339748 3300025922 Bacteria 1357
195 Ga0207694_10016734 3300025924 Bacteria 5542
196 Ga0207694_10158485 3300025924 Bacteria 1827
197 Ga0207700_10031909 3300025928 Bacteria 3749
198 Ga0207700_10092282 3300025928 Bacteria 2394
199 Ga0207700_11859467 3300025928 Bacteria 528
200 Ga0207664_10116087 3300025929 Bacteria 2233
201 Ga0207664_10792904 3300025929 Bacteria 852
202 Ga0207690_10762665 3300025932 Bacteria 798
203 Ga0207690_11643299 3300025932 Bacteria 537
204 Ga0207706_10030566 3300025933 Bacteria 4804
205 Ga0207706_10330592 3300025933 Bacteria 1326
206 Ga0207670_10263971 3300025936 Bacteria 1336
207 Ga0207704_10758862 3300025938 Bacteria 807
208 Ga0207665_10002793 3300025939 Bacteria 11701
209 Ga0207665_10026888 3300025939 Bacteria 3800
210 Ga0207665_10092455 3300025939 Bacteria 2098
211 Ga0207711_10500235 3300025941 Bacteria 1133
212 Ga0207667_10137208 3300025949 Bacteria 2518
213 Ga0207667_10207562 3300025949 Bacteria 2008
214 Ga0207667_11404102 3300025949 Bacteria 672
215 Ga0207640_11631950 3300025981 Bacteria 581
216 Ga0207658_11060025 3300025986 Bacteria 740
217 Ga0207703_11319029 3300026035 Bacteria 694
218 Ga0207639_10048638 3300026041 Bacteria 3211
219 Ga0207639_11992391 3300026041 Bacteria 542
220 Ga0207678_10451630 3300026067 Bacteria 1117
221 Ga0207702_10002300 3300026078 Bacteria 18295
222 Ga0207702_10744400 3300026078 Bacteria 967
223 Ga0207702_11742964 3300026078 Bacteria 615
224 Ga0207641_10117961 3300026088 Bacteria 2364
225 Ga0207676_10122598 3300026095 Bacteria 2195
226 Ga0207698_10097514 3300026142 Bacteria 2426
227 Ga0207698_10973588 3300026142 Bacteria 858
228 Ga0209389_1000080 3300027296 Bacteria 89649
229 Ga0209489_100027 3300027361 Bacteria 188074
230 Ga0209700_100022 3300027363 Bacteria 229977
231 Ga0209179_1001082 3300027512 Bacteria 3165
232 Ga0209179_1066256 3300027512 Bacteria 787
233 Ga0209588_1013761 3300027671 Bacteria 2471
234 Ga0268265_11734371 3300028380 Bacteria 631
235 Ga0268264_10632259 3300028381 Bacteria 1058
236 Ga0265762_1019593 3300030760 Bacteria 1240
237 Ga0265760_10061805 3300031090 Bacteria 1139
238 Ga0307408_100082059 3300031548 Bacteria 2412
239 Ga0307508_10081192 3300031616 Bacteria 2823
240 Ga0316044_122064 3300031810 Bacteria 649
241 Ga0307412_10231895 3300031911 Bacteria 1422
242 Ga0307409_100413252 3300031995 Bacteria 1292
243 Ga0307416_100230776 3300032002 Bacteria 1784
244 Ga0307416_100859932 3300032002 Bacteria 1005
245 Ga0307411_10059454 3300032005 Bacteria 2534
246 Ga0307411_11300525 3300032005 Bacteria 662
247 Ga0373926_0103170 3300035083 Bacteria 1068
248 Ga0373944_0371364 3300035089 Bacteria 547
249 Ga0373944_0393186 3300035089 Bacteria 533
250 Ga0373923_0004097 3300035111 Bacteria 4793
251 Ga0373923_0038177 3300035111 Bacteria 1967
252 Ga0373936_0005167 3300035113 Bacteria 4912
253 Ga0373953_0089146 3300035117 Bacteria 1289
254 Ga0373953_0498124 3300035117 Bacteria 540
255 Ga0373954_0015700 3300035118 Bacteria 3387
256 Ga0373956_0107507 3300035119 Bacteria 1297
257 Ga0373943_0023802 3300035170 Bacteria 2850
258 Ga0373943_0107071 3300035170 Bacteria 1470
259 Ga0373946_0066043 3300035171 Bacteria 1550
260 Ga0373946_0540953 3300035171 Bacteria 600
261 Ga0373955_0007452 3300035172 Bacteria 5032
262 Ga0373955_0083223 3300035172 Bacteria 1812
263 Ga0373924_0034532 3300035410 Bacteria 2047
264 Ga0373924_0334215 3300035410 Bacteria 674
265 Ga0373935_0008122 3300035692 Bacteria 6291
266 Ga0373927_0009901 3300035695 Bacteria 6391
267 Ga0373927_0105480 3300035695 Bacteria 1835
268 Ga0373927_0195739 3300035695 Bacteria 1326
269 Ga0373933_0050588 3300035724 Bacteria 2481
270 Ga0373933_0529282 3300035724 Bacteria 773
271 Ga0373947_0065286 3300035725 Bacteria 2220
272 Ga0373947_0388183 3300035725 Bacteria 940
273 Ga0373937_0554970 3300036401 Bacteria 1091
274 Ga0372808_013594 3300036459 Bacteria 1160
275 Ga0373925_0019566 3300037068 Bacteria 4926
276 Ga0373925_0203234 3300037068 Bacteria 1576
277 Ga0436364_1368094 3300037853 Bacteria 1572
278 Ga0436365_0160289 3300039437 Bacteria 39593
279 Ga0436365_0747848 3300039437 Bacteria 1339
280 Ga0436365_1912289 3300039437 Bacteria 1132
281 Ga0436360_0369380 3300039438 Bacteria 789
282 Ga0436360_0890401 3300039438 Bacteria 1289
283 Ga0436360_1291016 3300039438 Bacteria 1012
284 Ga0436361_0566172 3300039447 Bacteria 2139
285 Ga0436361_0836406 3300039447 Bacteria 1209
286 Ga0436363_1452198 3300039450 Bacteria 2062
287 Ga0436363_1475395 3300039450 Bacteria 908
288 Ga0436362_0489956 3300039453 Bacteria 2033
289 Ga0436362_0770136 3300039453 Bacteria 3655
290 Ga0451793_0013698 3300041452 Bacteria 963
291 Ga0451800_0501010 3300041459 Bacteria 1127
292 Ga0451804_0796461 3300041463 Bacteria 936
293 Ga0451807_0774867 3300041486 Bacteria 835
294 Ga0451833_1246459 3300041491 Bacteria 4237
295 Ga0451841_0159110 3300041498 Bacteria 893
296 Ga0451841_0877529 3300041498 Bacteria 501
297 Ga0451849_0736014 3300041505 Bacteria 991
298 Ga0451843_1550113 3300041509 Bacteria 9089
299 Ga0451855_1172457 3300041511 Bacteria 6234
300 Ga0451853_3260269 3300041512 Bacteria 3050
301 Ga0466964_0495021 3300044706 Bacteria 656
302 Ga0466957_1004215 3300044842 Bacteria 599
303 Ga0495603_0000056 3300046455 Bacteria 48775
304 Ga0495603_0775891 3300046455 Bacteria 547
305 Ga0495629_0166935 3300046459 Bacteria 1528
306 Ga0495629_0757142 3300046459 Bacteria 642
307 Ga0495641_0074761 3300046461 Bacteria 1519
308 Ga0495651_0085513 3300046462 Bacteria 2375
309 Ga0495651_0301193 3300046462 Bacteria 1075
310 Ga0495653_0000565 3300046463 Bacteria 28368
311 Ga0495650_0235831 3300046471 Bacteria 626
312 Ga0495580_0000168 3300046472 Bacteria 48775
313 Ga0495580_0010032 3300046472 Bacteria 7404
314 Ga0495580_0026124 3300046472 Bacteria 4260
315 Ga0495580_0044002 3300046472 Bacteria 3176
316 Ga0495580_0248547 3300046472 Bacteria 1218
317 Ga0495582_0001687 3300046473 Bacteria 12465
318 Ga0495582_0254837 3300046473 Bacteria 1006
319 Ga0495664_0001243 3300046477 Bacteria 13333
320 Ga0495664_0017641 3300046477 Bacteria 4082
321 Ga0495664_0110249 3300046477 Bacteria 1661
322 Ga0495594_0532022 3300046499 Bacteria 667
323 Ga0495606_0000336 3300046507 Bacteria 80986
324 Ga0495618_0032338 3300046514 Bacteria 3276
325 Ga0495618_0314594 3300046514 Bacteria 971
326 Ga0495618_0582919 3300046514 Bacteria 667
327 Ga0495628_0000751 3300046516 Bacteria 29935
328 Ga0495630_0000363 3300046517 Bacteria 35937
329 Ga0495630_0174892 3300046517 Bacteria 1636
330 Ga0495630_0344247 3300046517 Bacteria 1141
331 Ga0495648_0026396 3300046524 Bacteria 3911
332 Ga0495666_0002570 3300046526 Bacteria 9022
333 Ga0495666_0160713 3300046526 Bacteria 1042
334 Ga0495652_0001008 3300046529 Bacteria 32262
335 Ga0495652_0166641 3300046529 Bacteria 1705
336 Ga0495665_0000136 3300046531 Bacteria 35495
337 Ga0495665_0454245 3300046531 Bacteria 647
338 Ga0495640_0066347 3300046533 Bacteria 2434
339 Ga0495640_0086301 3300046533 Bacteria 2078
340 Ga0495640_0522358 3300046533 Bacteria 721
341 Ga0495586_0000085 3300046535 Bacteria 57466
342 Ga0495586_0165821 3300046535 Bacteria 1247
343 Ga0495587_0166837 3300046536 Bacteria 1251
344 Ga0495587_0454631 3300046536 Bacteria 709
345 Ga0495645_0009496 3300046543 Bacteria 6799
346 Ga0495645_0087702 3300046543 Bacteria 2226
347 Ga0495667_0403876 3300046559 Bacteria 860
348 Ga0495634_0013184 3300046642 Bacteria 5973
349 Ga0495634_0043876 3300046642 Bacteria 3029
350 Ga0495634_0637123 3300046642 Bacteria 616
351 Ga0495635_0023765 3300046663 Bacteria 4271
352 Ga0495635_0278202 3300046663 Bacteria 1124
353 Ga0495661_0019607 3300046665 Bacteria 4429
354 Ga0495588_0092810 3300046674 Bacteria 1582
355 Ga0495599_0243958 3300046678 Bacteria 1095
356 Ga0495623_0087908 3300046679 Bacteria 1914
357 Ga0495623_0527807 3300046679 Bacteria 620
358 Ga0495646_0002579 3300046680 Bacteria 11148
359 Ga0495646_0165559 3300046680 Bacteria 1221
360 Ga0495658_0463004 3300046683 Bacteria 810
361 Ga0495613_0002504 3300046689 Bacteria 13852
362 Ga0495613_0231948 3300046689 Bacteria 1293
363 Ga0495613_1041303 3300046689 Bacteria 524
364 Ga0495624_0000306 3300046690 Bacteria 38630
365 Ga0495624_0079537 3300046690 Bacteria 2033
366 Ga0495589_0071308 3300046794 Bacteria 1698
367 Ga0495600_0044952 3300046809 Bacteria 2881
368 Ga0495581_0000036 3300047315 Bacteria 50156
369 Ga0495581_0071514 3300047315 Bacteria 2007
370 Ga0495581_0463741 3300047315 Bacteria 737
371 Ga0495604_0083044 3300047317 Bacteria 2395
372 Ga0495674_0000195 3300047319 Bacteria 48775
373 Ga0495674_0064031 3300047319 Bacteria 3197
374 Ga0495676_0001536 3300047321 Bacteria 19992
375 Ga0495676_0556585 3300047321 Bacteria 749
376 Ga0495680_0001470 3300047322 Bacteria 25428
377 Ga0495680_0080895 3300047322 Bacteria 2454
378 Ga0495675_0533212 3300047444 Bacteria 671
379 Ga0495675_0651765 3300047444 Bacteria 593
380 Ga0495679_000238 3300047446 Bacteria 45827
381 Ga0495673_0028253 3300047469 Bacteria 2658
382 Ga0495684_0005368 3300047471 Bacteria 9981
383 Ga0495686_0000099 3300047472 Bacteria 180546
384 Ga0495686_0285813 3300047472 Bacteria 915
385 Ga0495593_0022654 3300047673 Bacteria 3497
386 Ga0495593_0045278 3300047673 Bacteria 2349
387 Ga0495593_0047254 3300047673 Bacteria 2290
388 Ga0495602_0004569 3300048088 Bacteria 14444
389 Ga0495614_0000233 3300048089 Bacteria 21616
390 Ga0496100_0053103 3300048903 Bacteria 2638
391 Ga0496100_0281747 3300048903 Bacteria 1239
392 Ga0496100_1187024 3300048903 Bacteria 602
393 Ga0496101_0048177 3300048904 Bacteria 3062
394 Ga0496101_0348860 3300048904 Bacteria 1163
395 Ga0496102_0625834 3300048905 Bacteria 999
396 Ga0496103_0659791 3300048906 Bacteria 664
397 Ga0496104_0009152 3300048907 Bacteria 8806
398 Ga0496105_0010297 3300048908 Bacteria 7350
399 Ga0496105_0940372 3300048908 Bacteria 649
400 Ga0496106_0024365 3300048909 Bacteria 4499
401 Ga0496106_0876112 3300048909 Bacteria 710
402 Ga0496107_0030034 3300048910 Bacteria 3872
403 Ga0496108_0051828 3300048911 Bacteria 3438
404 Ga0496109_0081697 3300048912 Bacteria 2978
405 Ga0496110_0014579 3300048913 Bacteria 6530
406 Ga0496110_0311200 3300048913 Bacteria 1434
407 Ga0496111_0185947 3300048914 Bacteria 1544
408 Ga0496112_0006351 3300048915 Bacteria 10372
409 Ga0496113_0019439 3300048916 Bacteria 4752
410 Ga0496114_0151896 3300048917 Bacteria 2009
411 Ga0496115_0129958 3300048918 Bacteria 2076
412 Ga0496115_0134215 3300048918 Bacteria 2041
413 Ga0496116_0113849 3300048919 Bacteria 1582
414 Ga0496117_0419418 3300048920 Bacteria 670
415 Ga0496118_0023001 3300048921 Bacteria 5428
416 Ga0496118_0539311 3300048921 Bacteria 571
417 Ga0496119_0055679 3300048922 Bacteria 2401
418 Ga0496120_0438914 3300048923 Bacteria 570
419 Ga0496121_0033391 3300048924 Bacteria 4656
420 Ga0496121_0092371 3300048924 Bacteria 2359
421 Ga0496121_0099508 3300048924 Bacteria 2247
422 Ga0496121_0192717 3300048924 Bacteria 1460
423 Ga0496121_0370110 3300048924 Bacteria 948
424 Ga0496121_0432539 3300048924 Bacteria 853
425 Ga0496123_0196366 3300048926 Bacteria 1039
426 Ga0496124_0126827 3300048927 Bacteria 2032
427 Ga0496125_0012354 3300048928 Bacteria 8484
428 Ga0496125_0259627 3300048928 Bacteria 1089
429 Ga0496126_0000511 3300048929 Bacteria 75804
430 Ga0496126_0028256 3300048929 Bacteria 5346
431 Ga0496126_0272720 3300048929 Bacteria 1404
432 Ga0496126_0319356 3300048929 Bacteria 1277
433 Ga0496126_0381088 3300048929 Bacteria 1148
434 Ga0496126_0461012 3300048929 Bacteria 1021
435 Ga0495682_0009173 3300049460 Bacteria 3872
436 Ga0501031_0385074 3300049568 Bacteria 907
437 Ga0501031_0648924 3300049568 Bacteria 678
438 Ga0501032_0805170 3300049569 Bacteria 593
439 Ga0501041_0565859 3300049577 Bacteria 725
440 Ga0501042_0322086 3300049578 Bacteria 1117
441 Ga0501048_0254341 3300049582 Bacteria 1248
442 Ga0501068_1123513 3300049584 Bacteria 520
443 Ga0501068_1203868 3300049584 Bacteria 502
444 Ga0501081_0976393 3300049743 Bacteria 640
445 nmdc:mga03683_246546_c1 3300050489 Bacteria 829
446 nmdc:mga0yw44_65385_c1 3300050492 Bacteria 2241
447 Ga0495601_0232591 3300053077 Bacteria 1204
448 Ga0495612_0540813 3300053078 Bacteria 536
449 Ga0500572_000939 3300053111 Bacteria 8887
450 Ga0500618_000433 3300053125 Bacteria 27738
451 Ga0500559_0000186 3300053136 Bacteria 49470
452 Ga0500638_252753 3300053162 Bacteria 708
453 Ga0500639_005324 3300053163 Bacteria 6573
454 Ga0500636_0541021 3300053177 Bacteria 506
455 Ga0500596_004944 3300053735 Bacteria 2395
456 Ga0500601_012568 3300053737 Bacteria 956
457 Ga0500601_017460 3300053737 Bacteria 823
458 Ga0587066_219825 3300059490 Bacteria 509
459 Ga0587070_104663 3300059491 Bacteria 656
460 Ga0587125_066793 3300059607 Bacteria 536
461 Ga0587101_053278 3300059623 Bacteria 703
462 Ga0501082_0298173 3300060353 Bacteria 1404

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0013698 Ga0451793_0013698_420_824 71
2 3300041463 Ga0451804_0796461 Ga0451804_0796461_174_578 71
3 3300041486 Ga0451807_0774867 Ga0451807_0774867_129_533 71
4 3300041498 Ga0451841_0159110 Ga0451841_0159110_398_802 71
5 3300015265 Ga0182005_1115805 Ga0182005_11158052 72
6 3300009101 Ga0105247_10199140 Ga0105247_101991402 76
7 3300009174 Ga0105241_10179321 Ga0105241_101793212 76
8 3300009551 Ga0105238_10155076 Ga0105238_101550762 76
9 3300011119 Ga0105246_10113068 Ga0105246_101130682 76
10 3300013308 Ga0157375_10962007 Ga0157375_109620072 76
11 3300014325 Ga0163163_10159653 Ga0163163_101596532 76
12 3300039437 Ga0436365_0747848 Ga0436365_0747848_105_503 76
13 3300048927 Ga0496124_0126827 Ga0496124_0126827_203_556 76
14 3300025906 Ga0207699_10447052 Ga0207699_104470522 83
15 3300048903 Ga0496100_0053103 Ga0496100_0053103_356_610 84
16 3300048904 Ga0496101_0348860 Ga0496101_0348860_710_964 84
17 3300048908 Ga0496105_0940372 Ga0496105_0940372_88_342 84
18 3300048913 Ga0496110_0311200 Ga0496110_0311200_842_1096 84
19 3300048917 Ga0496114_0151896 Ga0496114_0151896_1733_1987 84
20 3300048918 Ga0496115_0129958 Ga0496115_0129958_1310_1564 84
21 3300005937 Ga0081455_10045970 Ga0081455_100459704 86
22 3300049743 Ga0501081_0976393 Ga0501081_0976393_165_491 91
23 3300006177 Ga0075362_10126447 Ga0075362_101264472 93
24 3300025905 Ga0207685_10018814 Ga0207685_100188142 93
25 3300050489 nmdc:mga03683_246546_c1 nmdc:mga03683_246546_c1_142_447 93
26 3300005262 Ga0065165_1003357 Ga0065165_10033577 94
27 3300005983 Ga0081540_1031915 Ga0081540_10319152 94
28 3300025302 Ga0207426_1028087 Ga0207426_10280872 94
29 3300053111 Ga0500572_000939 Ga0500572_000939_2558_2869 94
30 3300053136 Ga0500559_0000186 Ga0500559_0000186_22884_23195 94
31 3300053163 Ga0500639_005324 Ga0500639_005324_4740_5051 94
32 3300053735 Ga0500596_004944 Ga0500596_004944_1522_1833 94
33 3300053737 Ga0500601_017460 Ga0500601_017460_176_529 94
34 3300059607 Ga0587125_066793 Ga0587125_066793_149_448 94
35 3300005617 Ga0068859_100895434 Ga0068859_1008954342 95
36 3300006931 Ga0097620_100895454 Ga0097620_1008954542 95
37 3300009174 Ga0105241_10002269 Ga0105241_1000226915 95
38 3300021320 Ga0214544_1000035 Ga0214544_100003566 95
39 3300021321 Ga0214542_1000181 Ga0214542_100018170 95
40 3300021321 Ga0214542_1022159 Ga0214542_10221592 95
41 3300021324 Ga0214545_1000094 Ga0214545_100009428 95
42 3300021324 Ga0214545_1022480 Ga0214545_10224805 95
43 3300021327 Ga0214543_1000155 Ga0214543_100015528 95
44 3300021327 Ga0214543_1022736 Ga0214543_10227365 95
45 3300025932 Ga0207690_11643299 Ga0207690_116432991 95
46 3300031548 Ga0307408_100082059 Ga0307408_1000820593 95
47 3300031911 Ga0307412_10231895 Ga0307412_102318951 95
48 3300031995 Ga0307409_100413252 Ga0307409_1004132522 95
49 3300032002 Ga0307416_100230776 Ga0307416_1002307761 95
50 3300032005 Ga0307411_11300525 Ga0307411_113005251 95
51 3300041459 Ga0451800_0501010 Ga0451800_0501010_828_1115 95
52 3300049568 Ga0501031_0648924 Ga0501031_0648924_280_585 95
53 3300049569 Ga0501032_0805170 Ga0501032_0805170_243_548 95
54 3300049577 Ga0501041_0565859 Ga0501041_0565859_261_566 95
55 3300049578 Ga0501042_0322086 Ga0501042_0322086_382_687 95
56 3300049582 Ga0501048_0254341 Ga0501048_0254341_670_975 95
57 3300049584 Ga0501068_1123513 Ga0501068_1123513_23_328 95
58 3300053162 Ga0500638_252753 Ga0500638_252753_387_698 95
59 3300060353 Ga0501082_0298173 Ga0501082_0298173_399_704 95
60 iso_pu_bacteria 2513237096 2513658614 95
61 iso_pu_bacteria 2513237145 2513920822 95
62 iso_pu_bacteria 2667528175 2671118972 95
63 iso_pu_bacteria 2879099564 2879102531 95
64 iso_pu_bacteria 2904690495 2904690954 95
65 iso_pu_bacteria 2908756301 2908757010 95
66 iso_pu_bacteria 8016522445 8016525308 95
67 iso_pu_bacteria 8016530956 8016538890 95
68 iso_pu_bacteria 8016539877 8016543176 95
69 iso_pu_bacteria 8016548790 8016550118 95
70 iso_pu_bacteria 8016566248 8016568586 95
71 iso_pu_bacteria 8016575299 8016581232 95
72 iso_pu_bacteria 8016595262 8016596510 95
73 iso_pu_bacteria 8019530166 8019538558 95
74 3300009093 Ga0105240_10262904 Ga0105240_102629042 96
75 3300010375 Ga0105239_10148581 Ga0105239_101485812 96
76 3300039438 Ga0436360_0369380 Ga0436360_0369380_76_381 96
77 3300048929 Ga0496126_0461012 Ga0496126_0461012_467_778 96
78 iso_pu_bacteria 2510917030 2511196010 96
79 iso_pu_bacteria 2513237088 2513595985 96
80 iso_pu_bacteria 2523231067 2523469757 96
81 iso_pu_bacteria 2582581298 2585222590 96
82 iso_pu_bacteria 2585427529 2585545173 96
83 iso_pu_bacteria 2643221558 2643813926 96
84 iso_pu_bacteria 2738543031 2739348925 96
85 iso_pu_bacteria 2852387548 2852394293 96
86 iso_pu_bacteria 2919100787 2919106476 96
87 iso_pu_bacteria 3005409236 3005416124 96
88 iso_pu_bacteria 8046767195 8046771178 96
89 3300025949 Ga0207667_11404102 Ga0207667_114041022 97
90 iso_pu_bacteria 2507262055 2507506824 97
91 iso_pu_bacteria 2508501009 2508540841 97
92 iso_pu_bacteria 2508501042 2508696794 97
93 iso_pu_bacteria 2508501128 2509152256 97
94 iso_pu_bacteria 2511231028 2511400082 97
95 iso_pu_bacteria 2513237092 2513622165 97
96 iso_pu_bacteria 2513237094 2513641459 97
97 iso_pu_bacteria 2513237102 2513704726 97
98 iso_pu_bacteria 2513237104 2513721737 97
99 iso_pu_bacteria 2513237161 2514013056 97
100 iso_pu_bacteria 2513237351 2514588435 97
101 iso_pu_bacteria 2515154114 2515645652 97
102 iso_pu_bacteria 2515154116 2515661440 97
103 iso_pu_bacteria 2517093001 2517107646 97
104 iso_pu_bacteria 2517287029 2517405356 97
105 iso_pu_bacteria 2524023205 2524439338 97
106 iso_pu_bacteria 2582581308 2585281849 97
107 iso_pu_bacteria 2582581315 2585328770 97
108 iso_pu_bacteria 2582581316 2585332963 97
109 iso_pu_bacteria 2585427527 2585535265 97
110 iso_pu_bacteria 2600255067 2600811032 97
111 iso_pu_bacteria 2615840626 2616312226 97
112 iso_pu_bacteria 2617270735 2617348243 97
113 iso_pu_bacteria 2667528174 2671116115 97
114 iso_pu_bacteria 2775506904 2776280196 97
115 iso_pu_bacteria 2808606384 2808973530 97
116 iso_pu_bacteria 2808606390 2809008379 97
117 iso_pu_bacteria 2808606391 2809015283 97
118 iso_pu_bacteria 2824617872 2824626004 97
119 iso_pu_bacteria 2824626560 2824628771 97
120 iso_pu_bacteria 2824635225 2824642638 97
121 iso_pu_bacteria 2824644064 2824650413 97
122 iso_pu_bacteria 2824671348 2824675156 97
123 iso_pu_bacteria 2824679649 2824685719 97
124 iso_pu_bacteria 2824687955 2824689632 97
125 iso_pu_bacteria 2824714736 2824720322 97
126 iso_pu_bacteria 2824723954 2824730592 97
127 iso_pu_bacteria 2824773399 2824773797 97
128 iso_pu_bacteria 2838122688 2838126791 97
129 iso_pu_bacteria 2841941048 2841947609 97
130 iso_pu_bacteria 2841949485 2841956555 97
131 iso_pu_bacteria 2841966195 2841971644 97
132 iso_pu_bacteria 2841974524 2841982613 97
133 iso_pu_bacteria 2841983080 2841986817 97
134 iso_pu_bacteria 2842045827 2842053033 97
135 iso_pu_bacteria 2842324504 2842329438 97
136 iso_pu_bacteria 2842324504 2842329455 97
137 iso_pu_bacteria 2842348783 2842354446 97
138 iso_pu_bacteria 2842348783 2842354463 97
139 iso_pu_bacteria 2842454564 2842456332 97
140 iso_pu_bacteria 2842454564 2842456349 97
141 iso_pu_bacteria 2844315083 2844318707 97
142 iso_pu_bacteria 2847930680 2847938326 97
143 iso_pu_bacteria 2855730933 2855733928 97
144 iso_pu_bacteria 2855767633 2855769518 97
145 iso_pu_bacteria 2874612657 2874618826 97
146 iso_pu_bacteria 2874620515 2874626044 97
147 iso_pu_bacteria 2876761206 2876761994 97
148 iso_pu_bacteria 2879083081 2879086088 97
149 iso_pu_bacteria 2881364244 2881364313 97
150 iso_pu_bacteria 2885366525 2885368039 97
151 iso_pu_bacteria 2903727486 2903728838 97
152 iso_pu_bacteria 2904666416 2904667518 97
153 iso_pu_bacteria 2906602504 2906604464 97
154 iso_pu_bacteria 2906626472 2906632132 97
155 iso_pu_bacteria 2906643746 2906648851 97
156 iso_pu_bacteria 2922393267 2922394613 97
157 iso_pu_bacteria 2929615660 2929621460 97
158 iso_pu_bacteria 2929624759 2929631725 97
159 iso_pu_bacteria 2932794094 2932798711 97
160 iso_pu_bacteria 2932801729 2932806612 97
161 iso_pu_bacteria 2933577622 2933583515 97
162 iso_pu_bacteria 2935608549 2935615892 97
163 iso_pu_bacteria 2935630451 2935634871 97
164 iso_pu_bacteria 2935648319 2935653933 97
165 iso_pu_bacteria 2935656913 2935662682 97
166 iso_pu_bacteria 2935675223 2935680081 97
167 iso_pu_bacteria 2935675223 2935680147 97
168 iso_pu_bacteria 2935684952 2935693838 97
169 iso_pu_bacteria 2935694250 2935700721 97
170 iso_pu_bacteria 2935713505 2935721960 97
171 iso_pu_bacteria 2935722832 2935731395 97
172 iso_pu_bacteria 2935732158 2935741095 97
173 iso_pu_bacteria 2935741537 2935750471 97
174 iso_pu_bacteria 2935750917 2935759726 97
175 iso_pu_bacteria 2935760218 2935768669 97
176 iso_pu_bacteria 2935819856 2935826839 97
177 iso_pu_bacteria 2935847175 2935854019 97
178 iso_pu_bacteria 2935883170 2935889423 97
179 iso_pu_bacteria 2935908558 2935914889 97
180 iso_pu_bacteria 2935916978 2935923220 97
181 iso_pu_bacteria 2935926038 2935932432 97
182 iso_pu_bacteria 2935934488 2935941030 97
183 iso_pu_bacteria 2935942939 2935949077 97
184 iso_pu_bacteria 2935951376 2935957772 97
185 iso_pu_bacteria 2935959822 2935964744 97
186 iso_pu_bacteria 2935967501 2935974107 97
187 iso_pu_bacteria 2935984226 2935990239 97
188 iso_pu_bacteria 2936011229 2936015317 97
189 iso_pu_bacteria 2936019824 2936023951 97
190 iso_pu_bacteria 2936028420 2936032966 97
191 iso_pu_bacteria 2936046547 2936051059 97
192 iso_pu_bacteria 2936055302 2936058459 97
193 iso_pu_bacteria 2937843397 2937848353 97
194 iso_pu_bacteria 2940556831 2940565631 97
195 iso_pu_bacteria 2941507105 2941511798 97
196 iso_pu_bacteria 2941515067 2941519500 97
197 iso_pu_bacteria 2941523033 2941527807 97
198 iso_pu_bacteria 3005416602 3005423433 97
199 iso_pu_bacteria 3005483717 3005484271 97
200 iso_pu_bacteria 3005506211 3005507725 97
201 iso_pu_bacteria 3005587118 3005593927 97
202 iso_pu_bacteria 3005594810 3005601121 97
203 iso_pu_bacteria 3005710791 3005716573 97
204 iso_pu_bacteria 3005718088 3005720209 97
205 iso_pu_bacteria 642555113 642616217 97
206 iso_pu_bacteria 642555113 642616235 97
207 iso_pu_bacteria 8005314921 8005320950 97
208 iso_pu_bacteria 8005484373 8005486275 97
209 iso_pu_bacteria 8006926726 8006931089 97
210 iso_pu_bacteria 8016583857 8016583989 97
211 iso_pu_bacteria 8016630954 8016634034 97
212 iso_pu_bacteria 8019648815 8019655188 97
213 iso_pu_bacteria 8019687851 8019692480 97
214 iso_pu_bacteria 8046767195 8046772088 97
215 iso_pu_bacteria 8055742211 8055744337 97
216 iso_pu_bacteria 8056967851 8056973117 97
217 3300002987 JGI25159J45721_1012046 JGI25159J45721_10120462 99
218 3300003354 JGI25160J50197_1000298 JGI25160J50197_100029815 99
219 3300003374 JGI25161J50226_1000221 JGI25161J50226_100022115 99
220 3300003752 Ga0055539_1021441 Ga0055539_10214411 99
221 3300003790 Ga0055528_1013537 Ga0055528_10135372 99
222 3300004625 Ga0055543_1000722 Ga0055543_100072215 99
223 3300005262 Ga0065165_1000983 Ga0065165_100098315 99
224 3300005434 Ga0070709_11081111 Ga0070709_110811111 99
225 3300005435 Ga0070714_100988288 Ga0070714_1009882882 99
226 3300021384 Ga0213876_10429668 Ga0213876_104296682 99
227 3300025208 Ga0209436_112329 Ga0209436_1123292 99
228 3300025253 Ga0209677_100717 Ga0209677_1007173 99
229 3300025254 Ga0209148_1045304 Ga0209148_10453041 99
230 3300025284 Ga0209130_1000563 Ga0209130_100056315 99
231 3300025302 Ga0207426_1000272 Ga0207426_100027231 99
232 3300035695 Ga0373927_0105480 Ga0373927_0105480_376_675 99
233 3300037853 Ga0436364_1368094 Ga0436364_1368094_822_1121 99
234 3300039437 Ga0436365_1912289 Ga0436365_1912289_340_639 99
235 3300044706 Ga0466964_0495021 Ga0466964_0495021_340_639 99
236 3300044842 Ga0466957_1004215 Ga0466957_1004215_232_531 99
237 3300048919 Ga0496116_0113849 Ga0496116_0113849_983_1282 99
238 3300048921 Ga0496118_0023001 Ga0496118_0023001_2622_2921 99
239 3300048922 Ga0496119_0055679 Ga0496119_0055679_613_912 99
240 3300048924 Ga0496121_0092371 Ga0496121_0092371_1394_1693 99
241 3300048928 Ga0496125_0259627 Ga0496125_0259627_589_888 99
242 3300059491 Ga0587070_104663 Ga0587070_104663_57_362 99
243 3300059623 Ga0587101_053278 Ga0587101_053278_139_438 99
244 3300002705 JGI25156J39149_1000017 JGI25156J39149_100001788 100
245 3300007265 Ga0099794_10011441 Ga0099794_100114412 100
246 3300007265 Ga0099794_10087820 Ga0099794_100878202 100
247 3300007788 Ga0099795_10001608 Ga0099795_100016085 100
248 3300007788 Ga0099795_10020420 Ga0099795_100204201 100
249 3300007788 Ga0099795_10077609 Ga0099795_100776092 100
250 3300010159 Ga0099796_10089406 Ga0099796_100894062 100
251 3300025256 Ga0209759_1000002 Ga0209759_1000002678 100
252 3300027512 Ga0209179_1001082 Ga0209179_10010822 100
253 3300027512 Ga0209179_1066256 Ga0209179_10662561 100
254 3300027671 Ga0209588_1013761 Ga0209588_10137612 100
255 3300046472 Ga0495580_0010032 Ga0495580_0010032_5436_5744 100
256 3300046526 Ga0495666_0160713 Ga0495666_0160713_719_1021 100
257 3300048929 Ga0496126_0381088 Ga0496126_0381088_152_460 100
258 3300053125 Ga0500618_000433 Ga0500618_000433_10392_10748 100
259 3300001979 JGI24740J21852_10001817 JGI24740J21852_100018172 101
260 3300001989 JGI24739J22299_10013493 JGI24739J22299_100134932 101
261 3300001990 JGI24737J22298_10003902 JGI24737J22298_100039025 101
262 3300002067 JGI24735J21928_10021151 JGI24735J21928_100211512 101
263 3300002705 JGI25156J39149_1001663 JGI25156J39149_100166310 101
264 3300002705 JGI25156J39149_1001871 JGI25156J39149_10018716 101
265 3300003187 JGI25151J46595_10000550 JGI25151J46595_100005505 101
266 3300003322 rootL2_10164238 rootL2_101642383 101
267 3300003323 rootH1_10008730 rootH1_100087308 101
268 3300003323 rootH1_10139894 rootH1_101398943 101
269 3300003756 Ga0055533_1000350 Ga0055533_100035021 101
270 3300003794 Ga0055531_10002582 Ga0055531_1000258214 101
271 3300005327 Ga0070658_10952087 Ga0070658_109520872 101
272 3300005339 Ga0070660_101394939 Ga0070660_1013949392 101
273 3300005340 Ga0070689_100114738 Ga0070689_1001147383 101
274 3300005354 Ga0070675_100471348 Ga0070675_1004713481 101
275 3300005366 Ga0070659_100888519 Ga0070659_1008885191 101
276 3300005366 Ga0070659_101358312 Ga0070659_1013583122 101
277 3300005434 Ga0070709_10000309 Ga0070709_1000030923 101
278 3300005434 Ga0070709_10020857 Ga0070709_100208573 101
279 3300005434 Ga0070709_10559400 Ga0070709_105594001 101
280 3300005435 Ga0070714_100217104 Ga0070714_1002171042 101
281 3300005435 Ga0070714_100222257 Ga0070714_1002222573 101
282 3300005436 Ga0070713_100037011 Ga0070713_1000370114 101
283 3300005436 Ga0070713_100292969 Ga0070713_1002929692 101
284 3300005436 Ga0070713_100647085 Ga0070713_1006470852 101
285 3300005437 Ga0070710_10001167 Ga0070710_100011672 101
286 3300005437 Ga0070710_10004223 Ga0070710_1000422310 101
287 3300005437 Ga0070710_10013557 Ga0070710_100135572 101
288 3300005437 Ga0070710_10410989 Ga0070710_104109891 101
289 3300005439 Ga0070711_100010653 Ga0070711_1000106534 101
290 3300005439 Ga0070711_100021544 Ga0070711_1000215445 101
291 3300005439 Ga0070711_100081423 Ga0070711_1000814232 101
292 3300005439 Ga0070711_100124048 Ga0070711_1001240483 101
293 3300005439 Ga0070711_101692991 Ga0070711_1016929912 101
294 3300005441 Ga0070700_100337869 Ga0070700_1003378691 101
295 3300005455 Ga0070663_100425954 Ga0070663_1004259542 101
296 3300005455 Ga0070663_100614496 Ga0070663_1006144962 101
297 3300005457 Ga0070662_100858204 Ga0070662_1008582042 101
298 3300005467 Ga0070706_100814260 Ga0070706_1008142602 101
299 3300005535 Ga0070684_100638999 Ga0070684_1006389992 101
300 3300005545 Ga0070695_101891625 Ga0070695_1018916251 101
301 3300005547 Ga0070693_100317987 Ga0070693_1003179872 101
302 3300005563 Ga0068855_100284632 Ga0068855_1002846321 101
303 3300005577 Ga0068857_100197264 Ga0068857_1001972643 101
304 3300005614 Ga0068856_100128890 Ga0068856_1001288904 101
305 3300005617 Ga0068859_101314072 Ga0068859_1013140722 101
306 3300005618 Ga0068864_100387352 Ga0068864_1003873522 101
307 3300005834 Ga0068851_10234941 Ga0068851_102349412 101
308 3300005841 Ga0068863_100461630 Ga0068863_1004616301 101
309 3300005843 Ga0068860_100693407 Ga0068860_1006934072 101
310 3300005981 Ga0081538_10016822 Ga0081538_100168224 101
311 3300006028 Ga0070717_10007580 Ga0070717_100075807 101
312 3300006028 Ga0070717_10240528 Ga0070717_102405281 101
313 3300006028 Ga0070717_10684349 Ga0070717_106843491 101
314 3300006038 Ga0075365_10073755 Ga0075365_100737553 101
315 3300006163 Ga0070715_10005640 Ga0070715_100056404 101
316 3300006163 Ga0070715_10032299 Ga0070715_100322992 101
317 3300006163 Ga0070715_10146921 Ga0070715_101469212 101
318 3300006173 Ga0070716_100007109 Ga0070716_1000071096 101
319 3300006173 Ga0070716_100129969 Ga0070716_1001299692 101
320 3300006173 Ga0070716_100213325 Ga0070716_1002133252 101
321 3300006175 Ga0070712_100009861 Ga0070712_1000098616 101
322 3300006175 Ga0070712_100011604 Ga0070712_1000116044 101
323 3300006175 Ga0070712_100029016 Ga0070712_1000290161 101
324 3300006175 Ga0070712_100045150 Ga0070712_1000451502 101
325 3300006237 Ga0097621_100348127 Ga0097621_1003481272 101
326 3300006358 Ga0068871_101860183 Ga0068871_1018601832 101
327 3300006871 Ga0075434_100167075 Ga0075434_1001670753 101
328 3300006871 Ga0075434_102377087 Ga0075434_1023770871 101
329 3300006931 Ga0097620_101314351 Ga0097620_1013143512 101
330 3300006942 Ga0099824_1040842 Ga0099824_10408422 101
331 3300006944 Ga0099823_1039281 Ga0099823_10392813 101
332 3300007265 Ga0099794_10295199 Ga0099794_102951992 101
333 3300007265 Ga0099794_10381598 Ga0099794_103815981 101
334 3300009011 Ga0105251_10139745 Ga0105251_101397452 101
335 3300009036 Ga0105244_10000468 Ga0105244_1000046820 101
336 3300009093 Ga0105240_10235073 Ga0105240_102350732 101
337 3300009098 Ga0105245_10182853 Ga0105245_101828533 101
338 3300009101 Ga0105247_10042412 Ga0105247_100424124 101
339 3300009174 Ga0105241_10607438 Ga0105241_106074382 101
340 3300009177 Ga0105248_10454753 Ga0105248_104547532 101
341 3300009545 Ga0105237_10465240 Ga0105237_104652402 101
342 3300009551 Ga0105238_10064772 Ga0105238_100647722 101
343 3300009551 Ga0105238_10075801 Ga0105238_100758011 101
344 3300010159 Ga0099796_10059630 Ga0099796_100596301 101
345 3300010159 Ga0099796_10435035 Ga0099796_104350352 101
346 3300010159 Ga0099796_10481943 Ga0099796_104819431 101
347 3300010375 Ga0105239_11822689 Ga0105239_118226891 101
348 3300010375 Ga0105239_11899824 Ga0105239_118998241 101
349 3300011119 Ga0105246_11487394 Ga0105246_114873941 101
350 3300013100 Ga0157373_10000815 Ga0157373_1000081518 101
351 3300013102 Ga0157371_10001033 Ga0157371_1000103319 101
352 3300013105 Ga0157369_10012954 Ga0157369_100129549 101
353 3300013105 Ga0157369_10723585 Ga0157369_107235852 101
354 3300013297 Ga0157378_11230366 Ga0157378_112303661 101
355 3300013306 Ga0163162_11037884 Ga0163162_110378842 101
356 3300013308 Ga0157375_10287102 Ga0157375_102871022 101
357 3300014968 Ga0157379_10084707 Ga0157379_100847074 101
358 3300014969 Ga0157376_10406748 Ga0157376_104067482 101
359 3300021320 Ga0214544_1034689 Ga0214544_10346892 101
360 3300021321 Ga0214542_1025925 Ga0214542_10259252 101
361 3300021358 Ga0213873_10003859 Ga0213873_100038592 101
362 3300021361 Ga0213872_10184508 Ga0213872_101845081 101
363 3300021384 Ga0213876_10002812 Ga0213876_100028122 101
364 3300024225 Ga0224572_1091922 Ga0224572_10919221 101
365 3300024227 Ga0228598_1011147 Ga0228598_10111472 101
366 3300024227 Ga0228598_1022644 Ga0228598_10226442 101
367 3300025226 Ga0209674_100029 Ga0209674_100029409 101
368 3300025245 Ga0207425_1085315 Ga0207425_10853152 101
369 3300025256 Ga0209759_1000002 Ga0209759_1000002807 101
370 3300025256 Ga0209759_1000236 Ga0209759_100023652 101
371 3300025256 Ga0209759_1000337 Ga0209759_100033757 101
372 3300025294 Ga0209025_1000003 Ga0209025_10000031015 101
373 3300025297 Ga0209758_1000117 Ga0209758_1000117129 101
374 3300025304 Ga0209257_1001342 Ga0209257_100134224 101
375 3300025321 Ga0207656_10198954 Ga0207656_101989541 101
376 3300025728 Ga0207655_1000796 Ga0207655_100079614 101
377 3300025898 Ga0207692_10015686 Ga0207692_100156862 101
378 3300025898 Ga0207692_10036819 Ga0207692_100368193 101
379 3300025904 Ga0207647_10003868 Ga0207647_100038682 101
380 3300025905 Ga0207685_10148288 Ga0207685_101482881 101
381 3300025906 Ga0207699_10084143 Ga0207699_100841433 101
382 3300025906 Ga0207699_10290431 Ga0207699_102904312 101
383 3300025906 Ga0207699_10499636 Ga0207699_104996362 101
384 3300025906 Ga0207699_10846995 Ga0207699_108469951 101
385 3300025909 Ga0207705_11286775 Ga0207705_112867752 101
386 3300025910 Ga0207684_10506332 Ga0207684_105063322 101
387 3300025911 Ga0207654_10000362 Ga0207654_1000036214 101
388 3300025911 Ga0207654_10548332 Ga0207654_105483322 101
389 3300025913 Ga0207695_10191316 Ga0207695_101913162 101
390 3300025913 Ga0207695_10338224 Ga0207695_103382242 101
391 3300025913 Ga0207695_10611894 Ga0207695_106118942 101
392 3300025914 Ga0207671_10079124 Ga0207671_100791242 101
393 3300025915 Ga0207693_10011328 Ga0207693_100113284 101
394 3300025915 Ga0207693_10081498 Ga0207693_100814982 101
395 3300025915 Ga0207693_10168443 Ga0207693_101684432 101
396 3300025915 Ga0207693_10209643 Ga0207693_102096432 101
397 3300025915 Ga0207693_10417560 Ga0207693_104175601 101
398 3300025916 Ga0207663_10047847 Ga0207663_100478474 101
399 3300025916 Ga0207663_10060028 Ga0207663_100600282 101
400 3300025916 Ga0207663_10074772 Ga0207663_100747723 101
401 3300025916 Ga0207663_11151504 Ga0207663_111515042 101
402 3300025916 Ga0207663_11366480 Ga0207663_113664801 101
403 3300025922 Ga0207646_10339748 Ga0207646_103397482 101
404 3300025924 Ga0207694_10016734 Ga0207694_100167342 101
405 3300025924 Ga0207694_10158485 Ga0207694_101584851 101
406 3300025928 Ga0207700_10031909 Ga0207700_100319092 101
407 3300025928 Ga0207700_10092282 Ga0207700_100922822 101
408 3300025928 Ga0207700_11859467 Ga0207700_118594672 101
409 3300025929 Ga0207664_10116087 Ga0207664_101160872 101
410 3300025929 Ga0207664_10792904 Ga0207664_107929041 101
411 3300025932 Ga0207690_10762665 Ga0207690_107626652 101
412 3300025933 Ga0207706_10030566 Ga0207706_100305662 101
413 3300025933 Ga0207706_10330592 Ga0207706_103305922 101
414 3300025936 Ga0207670_10263971 Ga0207670_102639711 101
415 3300025938 Ga0207704_10758862 Ga0207704_107588622 101
416 3300025939 Ga0207665_10002793 Ga0207665_100027937 101
417 3300025939 Ga0207665_10026888 Ga0207665_100268885 101
418 3300025939 Ga0207665_10092455 Ga0207665_100924553 101
419 3300025941 Ga0207711_10500235 Ga0207711_105002352 101
420 3300025949 Ga0207667_10137208 Ga0207667_101372081 101
421 3300025949 Ga0207667_10207562 Ga0207667_102075623 101
422 3300025981 Ga0207640_11631950 Ga0207640_116319501 101
423 3300025986 Ga0207658_11060025 Ga0207658_110600251 101
424 3300026035 Ga0207703_11319029 Ga0207703_113190291 101
425 3300026041 Ga0207639_10048638 Ga0207639_100486381 101
426 3300026041 Ga0207639_11992391 Ga0207639_119923911 101
427 3300026067 Ga0207678_10451630 Ga0207678_104516302 101
428 3300026078 Ga0207702_10002300 Ga0207702_1000230014 101
429 3300026078 Ga0207702_10744400 Ga0207702_107444001 101
430 3300026078 Ga0207702_11742964 Ga0207702_117429642 101
431 3300026088 Ga0207641_10117961 Ga0207641_101179612 101
432 3300026095 Ga0207676_10122598 Ga0207676_101225982 101
433 3300026142 Ga0207698_10097514 Ga0207698_100975142 101
434 3300026142 Ga0207698_10973588 Ga0207698_109735882 101
435 3300027296 Ga0209389_1000080 Ga0209389_100008032 101
436 3300027361 Ga0209489_100027 Ga0209489_100027139 101
437 3300027363 Ga0209700_100022 Ga0209700_100022172 101
438 3300028380 Ga0268265_11734371 Ga0268265_117343711 101
439 3300028381 Ga0268264_10632259 Ga0268264_106322591 101
440 3300030760 Ga0265762_1019593 Ga0265762_10195931 101
441 3300031090 Ga0265760_10061805 Ga0265760_100618051 101
442 3300031616 Ga0307508_10081192 Ga0307508_100811924 101
443 3300031810 Ga0316044_122064 Ga0316044_1220642 101
444 3300032002 Ga0307416_100859932 Ga0307416_1008599321 101
445 3300032005 Ga0307411_10059454 Ga0307411_100594542 101
446 3300035083 Ga0373926_0103170 Ga0373926_0103170_295_600 101
447 3300035089 Ga0373944_0371364 Ga0373944_0371364_23_343 101
448 3300035089 Ga0373944_0393186 Ga0373944_0393186_148_453 101
449 3300035111 Ga0373923_0004097 Ga0373923_0004097_3737_4042 101
450 3300035111 Ga0373923_0038177 Ga0373923_0038177_596_916 101
451 3300035113 Ga0373936_0005167 Ga0373936_0005167_2668_2973 101
452 3300035117 Ga0373953_0089146 Ga0373953_0089146_105_425 101
453 3300035117 Ga0373953_0498124 Ga0373953_0498124_31_336 101
454 3300035118 Ga0373954_0015700 Ga0373954_0015700_2346_2651 101
455 3300035119 Ga0373956_0107507 Ga0373956_0107507_542_862 101
456 3300035170 Ga0373943_0023802 Ga0373943_0023802_438_743 101
457 3300035170 Ga0373943_0107071 Ga0373943_0107071_524_844 101
458 3300035171 Ga0373946_0066043 Ga0373946_0066043_316_621 101
459 3300035171 Ga0373946_0540953 Ga0373946_0540953_218_538 101
460 3300035172 Ga0373955_0007452 Ga0373955_0007452_3456_3761 101
461 3300035172 Ga0373955_0083223 Ga0373955_0083223_794_1114 101
462 3300035410 Ga0373924_0034532 Ga0373924_0034532_955_1275 101
463 3300035410 Ga0373924_0334215 Ga0373924_0334215_111_416 101
464 3300035692 Ga0373935_0008122 Ga0373935_0008122_5745_6050 101
465 3300035695 Ga0373927_0009901 Ga0373927_0009901_5258_5563 101
466 3300035695 Ga0373927_0195739 Ga0373927_0195739_824_1144 101
467 3300035724 Ga0373933_0050588 Ga0373933_0050588_2064_2384 101
468 3300035724 Ga0373933_0529282 Ga0373933_0529282_443_748 101
469 3300035725 Ga0373947_0065286 Ga0373947_0065286_1825_2145 101
470 3300035725 Ga0373947_0388183 Ga0373947_0388183_228_533 101
471 3300036401 Ga0373937_0554970 Ga0373937_0554970_724_1044 101
472 3300036459 Ga0372808_013594 Ga0372808_013594_751_1056 101
473 3300037068 Ga0373925_0019566 Ga0373925_0019566_3955_4260 101
474 3300037068 Ga0373925_0203234 Ga0373925_0203234_394_714 101
475 3300039437 Ga0436365_0160289 Ga0436365_0160289_31998_32345 101
476 3300039438 Ga0436360_0890401 Ga0436360_0890401_672_977 101
477 3300039438 Ga0436360_1291016 Ga0436360_1291016_456_761 101
478 3300039447 Ga0436361_0566172 Ga0436361_0566172_765_1070 101
479 3300039447 Ga0436361_0836406 Ga0436361_0836406_442_747 101
480 3300039450 Ga0436363_1452198 Ga0436363_1452198_939_1268 101
481 3300039450 Ga0436363_1475395 Ga0436363_1475395_17_364 101
482 3300039453 Ga0436362_0489956 Ga0436362_0489956_793_1098 101
483 3300039453 Ga0436362_0770136 Ga0436362_0770136_3198_3545 101
484 3300041491 Ga0451833_1246459 Ga0451833_1246459_2532_2849 101
485 3300041498 Ga0451841_0877529 Ga0451841_0877529_159_476 101
486 3300041505 Ga0451849_0736014 Ga0451849_0736014_273_590 101
487 3300041509 Ga0451843_1550113 Ga0451843_1550113_7259_7576 101
488 3300041511 Ga0451855_1172457 Ga0451855_1172457_1699_2016 101
489 3300041512 Ga0451853_3260269 Ga0451853_3260269_572_889 101
490 3300046455 Ga0495603_0000056 Ga0495603_0000056_38070_38381 101
491 3300046455 Ga0495603_0775891 Ga0495603_0775891_203_508 101
492 3300046459 Ga0495629_0166935 Ga0495629_0166935_197_508 101
493 3300046459 Ga0495629_0757142 Ga0495629_0757142_215_535 101
494 3300046461 Ga0495641_0074761 Ga0495641_0074761_848_1159 101
495 3300046462 Ga0495651_0085513 Ga0495651_0085513_652_1005 101
496 3300046462 Ga0495651_0301193 Ga0495651_0301193_674_985 101
497 3300046463 Ga0495653_0000565 Ga0495653_0000565_19314_19625 101
498 3300046471 Ga0495650_0235831 Ga0495650_0235831_166_477 101
499 3300046472 Ga0495580_0000168 Ga0495580_0000168_38070_38381 101
500 3300046472 Ga0495580_0026124 Ga0495580_0026124_3110_3415 101
501 3300046472 Ga0495580_0044002 Ga0495580_0044002_2260_2565 101
502 3300046472 Ga0495580_0248547 Ga0495580_0248547_811_1131 101
503 3300046473 Ga0495582_0001687 Ga0495582_0001687_11119_11430 101
504 3300046473 Ga0495582_0254837 Ga0495582_0254837_111_431 101
505 3300046477 Ga0495664_0001243 Ga0495664_0001243_8364_8669 101
506 3300046477 Ga0495664_0017641 Ga0495664_0017641_2078_2389 101
507 3300046477 Ga0495664_0110249 Ga0495664_0110249_887_1240 101
508 3300046499 Ga0495594_0532022 Ga0495594_0532022_334_639 101
509 3300046507 Ga0495606_0000336 Ga0495606_0000336_25119_25463 101
510 3300046514 Ga0495618_0032338 Ga0495618_0032338_2065_2370 101
511 3300046514 Ga0495618_0314594 Ga0495618_0314594_173_484 101
512 3300046514 Ga0495618_0582919 Ga0495618_0582919_270_590 101
513 3300046516 Ga0495628_0000751 Ga0495628_0000751_19230_19541 101
514 3300046517 Ga0495630_0000363 Ga0495630_0000363_16537_16848 101
515 3300046517 Ga0495630_0174892 Ga0495630_0174892_947_1252 101
516 3300046517 Ga0495630_0344247 Ga0495630_0344247_569_889 101
517 3300046524 Ga0495648_0026396 Ga0495648_0026396_1053_1364 101
518 3300046526 Ga0495666_0002570 Ga0495666_0002570_5967_6278 101
519 3300046529 Ga0495652_0001008 Ga0495652_0001008_20360_20671 101
520 3300046529 Ga0495652_0166641 Ga0495652_0166641_428_733 101
521 3300046531 Ga0495665_0000136 Ga0495665_0000136_19090_19401 101
522 3300046531 Ga0495665_0454245 Ga0495665_0454245_158_478 101
523 3300046533 Ga0495640_0066347 Ga0495640_0066347_248_553 101
524 3300046533 Ga0495640_0086301 Ga0495640_0086301_1551_1862 101
525 3300046533 Ga0495640_0522358 Ga0495640_0522358_67_387 101
526 3300046535 Ga0495586_0000085 Ga0495586_0000085_38066_38377 101
527 3300046535 Ga0495586_0165821 Ga0495586_0165821_377_697 101
528 3300046536 Ga0495587_0166837 Ga0495587_0166837_587_898 101
529 3300046536 Ga0495587_0454631 Ga0495587_0454631_74_427 101
530 3300046543 Ga0495645_0009496 Ga0495645_0009496_2153_2464 101
531 3300046543 Ga0495645_0087702 Ga0495645_0087702_1886_2191 101
532 3300046559 Ga0495667_0403876 Ga0495667_0403876_482_787 101
533 3300046642 Ga0495634_0013184 Ga0495634_0013184_5448_5759 101
534 3300046642 Ga0495634_0043876 Ga0495634_0043876_522_827 101
535 3300046642 Ga0495634_0637123 Ga0495634_0637123_219_539 101
536 3300046663 Ga0495635_0023765 Ga0495635_0023765_1020_1331 101
537 3300046663 Ga0495635_0278202 Ga0495635_0278202_229_534 101
538 3300046665 Ga0495661_0019607 Ga0495661_0019607_1019_1330 101
539 3300046674 Ga0495588_0092810 Ga0495588_0092810_1023_1334 101
540 3300046678 Ga0495599_0243958 Ga0495599_0243958_753_1058 101
541 3300046679 Ga0495623_0087908 Ga0495623_0087908_984_1337 101
542 3300046679 Ga0495623_0527807 Ga0495623_0527807_264_584 101
543 3300046680 Ga0495646_0002579 Ga0495646_0002579_2470_2781 101
544 3300046680 Ga0495646_0165559 Ga0495646_0165559_830_1135 101
545 3300046683 Ga0495658_0463004 Ga0495658_0463004_463_768 101
546 3300046689 Ga0495613_0002504 Ga0495613_0002504_4800_5111 101
547 3300046689 Ga0495613_0231948 Ga0495613_0231948_408_713 101
548 3300046689 Ga0495613_1041303 Ga0495613_1041303_120_473 101
549 3300046690 Ga0495624_0000306 Ga0495624_0000306_19090_19401 101
550 3300046690 Ga0495624_0079537 Ga0495624_0079537_1541_1846 101
551 3300046794 Ga0495589_0071308 Ga0495589_0071308_36_347 101
552 3300046809 Ga0495600_0044952 Ga0495600_0044952_2337_2690 101
553 3300047315 Ga0495581_0000036 Ga0495581_0000036_11789_12100 101
554 3300047315 Ga0495581_0071514 Ga0495581_0071514_156_476 101
555 3300047315 Ga0495581_0463741 Ga0495581_0463741_20_325 101
556 3300047317 Ga0495604_0083044 Ga0495604_0083044_148_459 101
557 3300047319 Ga0495674_0000195 Ga0495674_0000195_38070_38381 101
558 3300047319 Ga0495674_0064031 Ga0495674_0064031_304_609 101
559 3300047321 Ga0495676_0001536 Ga0495676_0001536_10394_10705 101
560 3300047321 Ga0495676_0556585 Ga0495676_0556585_417_722 101
561 3300047322 Ga0495680_0001470 Ga0495680_0001470_4886_5197 101
562 3300047322 Ga0495680_0080895 Ga0495680_0080895_1568_1921 101
563 3300047444 Ga0495675_0533212 Ga0495675_0533212_318_623 101
564 3300047444 Ga0495675_0651765 Ga0495675_0651765_206_511 101
565 3300047446 Ga0495679_000238 Ga0495679_000238_10367_10678 101
566 3300047469 Ga0495673_0028253 Ga0495673_0028253_939_1250 101
567 3300047471 Ga0495684_0005368 Ga0495684_0005368_6841_7146 101
568 3300047472 Ga0495686_0000099 Ga0495686_0000099_21601_21912 101
569 3300047472 Ga0495686_0285813 Ga0495686_0285813_318_662 101
570 3300047673 Ga0495593_0022654 Ga0495593_0022654_378_683 101
571 3300047673 Ga0495593_0045278 Ga0495593_0045278_611_922 101
572 3300047673 Ga0495593_0047254 Ga0495593_0047254_584_904 101
573 3300048088 Ga0495602_0004569 Ga0495602_0004569_11528_11839 101
574 3300048089 Ga0495614_0000233 Ga0495614_0000233_20405_20716 101
575 3300048903 Ga0496100_0281747 Ga0496100_0281747_138_443 101
576 3300048903 Ga0496100_1187024 Ga0496100_1187024_87_431 101
577 3300048904 Ga0496101_0048177 Ga0496101_0048177_1063_1368 101
578 3300048905 Ga0496102_0625834 Ga0496102_0625834_427_732 101
579 3300048906 Ga0496103_0659791 Ga0496103_0659791_337_642 101
580 3300048907 Ga0496104_0009152 Ga0496104_0009152_497_802 101
581 3300048908 Ga0496105_0010297 Ga0496105_0010297_2018_2323 101
582 3300048909 Ga0496106_0024365 Ga0496106_0024365_3763_4068 101
583 3300048909 Ga0496106_0876112 Ga0496106_0876112_115_420 101
584 3300048910 Ga0496107_0030034 Ga0496107_0030034_1490_1795 101
585 3300048911 Ga0496108_0051828 Ga0496108_0051828_1796_2101 101
586 3300048912 Ga0496109_0081697 Ga0496109_0081697_822_1127 101
587 3300048913 Ga0496110_0014579 Ga0496110_0014579_5980_6285 101
588 3300048914 Ga0496111_0185947 Ga0496111_0185947_729_1034 101
589 3300048915 Ga0496112_0006351 Ga0496112_0006351_6116_6421 101
590 3300048916 Ga0496113_0019439 Ga0496113_0019439_1540_1845 101
591 3300048918 Ga0496115_0134215 Ga0496115_0134215_1392_1697 101
592 3300048920 Ga0496117_0419418 Ga0496117_0419418_177_488 101
593 3300048921 Ga0496118_0539311 Ga0496118_0539311_256_561 101
594 3300048923 Ga0496120_0438914 Ga0496120_0438914_180_491 101
595 3300048924 Ga0496121_0033391 Ga0496121_0033391_2759_3103 101
596 3300048924 Ga0496121_0099508 Ga0496121_0099508_1419_1730 101
597 3300048924 Ga0496121_0192717 Ga0496121_0192717_391_702 101
598 3300048924 Ga0496121_0370110 Ga0496121_0370110_133_444 101
599 3300048924 Ga0496121_0432539 Ga0496121_0432539_24_329 101
600 3300048926 Ga0496123_0196366 Ga0496123_0196366_20_325 101
601 3300048928 Ga0496125_0012354 Ga0496125_0012354_7753_8058 101
602 3300048929 Ga0496126_0000511 Ga0496126_0000511_48462_48773 101
603 3300048929 Ga0496126_0000511 Ga0496126_0000511_59794_60105 101
604 3300048929 Ga0496126_0028256 Ga0496126_0028256_2700_3011 101
605 3300048929 Ga0496126_0272720 Ga0496126_0272720_95_400 101
606 3300048929 Ga0496126_0319356 Ga0496126_0319356_557_868 101
607 3300049460 Ga0495682_0009173 Ga0495682_0009173_340_651 101
608 3300049568 Ga0501031_0385074 Ga0501031_0385074_490_816 101
609 3300049584 Ga0501068_1203868 Ga0501068_1203868_97_423 101
610 3300050492 nmdc:mga0yw44_65385_c1 nmdc:mga0yw44_65385_c1_1084_1437 101
611 3300053077 Ga0495601_0232591 Ga0495601_0232591_677_982 101
612 3300053078 Ga0495612_0540813 Ga0495612_0540813_98_403 101
613 3300053177 Ga0500636_0541021 Ga0500636_0541021_82_390 101
614 3300053737 Ga0500601_012568 Ga0500601_012568_96_401 101
615 3300059490 Ga0587066_219825 Ga0587066_219825_142_447 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10048

DUF2282

Predicted integral membrane protein (DUF2282)

57

113

0.92

Feature Viewer

pLDDT pTM Quality
62.37 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map