F469493
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 615 | 431 | 462 | 101 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_000433|Ga0500618_000433_10392_10748 |
| Length | 118 |
| Sequence | LCIRLGCLETNLPEITMSAKTTVTSALLATALVSVFATAAHAAPMMKEEGAAKPAAKEKCYGVALKGQNDCAAGPGTSCQGTSTMDYQGNSWKFVPTGTCSSMKVPTGAHGSLMPIKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 8 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 9 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 14 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 15 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 16 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 17 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 20 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 23 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 24 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 25 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 26 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 27 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 28 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 29 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 30 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 31 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 32 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 33 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 34 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 35 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 36 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 37 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 38 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 39 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 40 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 41 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 42 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 43 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 44 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 45 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 46 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 47 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 48 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 49 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 50 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 51 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 52 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 53 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 54 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 55 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 56 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 57 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 58 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 59 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 60 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 61 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 62 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 63 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 64 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 65 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 66 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 67 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 68 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 69 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 70 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 71 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 72 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 73 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 74 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 75 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 76 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 77 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 78 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 79 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 80 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 81 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 82 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 83 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 84 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 85 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 86 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 87 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 88 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 89 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 90 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 91 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 92 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 93 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 94 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 95 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 96 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 97 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 98 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 99 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 100 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 101 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 102 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 103 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 104 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 105 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 106 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 107 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 108 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 109 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 110 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 111 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 112 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 113 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 114 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 115 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 116 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 117 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 118 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 119 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 120 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 121 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 122 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 123 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 124 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 125 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 126 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 127 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 128 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 129 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 130 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 131 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 132 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 133 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 134 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 135 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 136 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 137 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 138 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 139 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 140 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 141 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 142 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 143 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 144 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 145 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 148 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 153 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 154 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 156 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 160 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 163 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 164 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 165 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 166 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 167 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 168 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 169 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 170 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 171 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 172 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 173 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 175 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 176 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 177 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 178 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 179 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 181 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 182 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 184 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 185 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 186 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 187 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 197 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 209 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 210 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 211 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 212 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 213 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 214 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 215 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 216 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 217 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 218 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 224 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 264 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 265 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 272 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 273 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 274 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 275 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 276 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 277 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 278 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 279 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 284 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 297 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 298 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 299 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 300 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 301 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 302 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 307 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 308 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 309 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 310 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 311 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 312 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 313 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 368 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 379 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 380 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 381 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 382 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 383 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 384 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 403 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 404 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 405 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 408 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 414 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 415 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 416 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 417 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 418 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 419 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 420 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 421 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 422 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 423 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 424 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 425 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 426 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 427 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 428 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 429 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 430 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 431 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.98 |
| Metatranscriptomes | 1.3 |
| Isolates | 24.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.69 |
| Nodule | 18.21 |
| Rhizoplane | 4.72 |
| Rhizosphere | 57.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001817 | 3300001979 | Bacteria | 9779 |
| 2 | JGI24739J22299_10013493 | 3300001989 | Bacteria | 2983 |
| 3 | JGI24737J22298_10003902 | 3300001990 | Bacteria | 5233 |
| 4 | JGI24735J21928_10021151 | 3300002067 | Bacteria | 1988 |
| 5 | JGI25156J39149_1000017 | 3300002705 | Bacteria | 171827 |
| 6 | JGI25156J39149_1001663 | 3300002705 | Bacteria | 8991 |
| 7 | JGI25156J39149_1001871 | 3300002705 | Bacteria | 8221 |
| 8 | JGI25159J45721_1012046 | 3300002987 | Bacteria | 2084 |
| 9 | JGI25151J46595_10000550 | 3300003187 | Bacteria | 34188 |
| 10 | rootL2_10164238 | 3300003322 | Bacteria | 2321 |
| 11 | rootH1_10008730 | 3300003316 | Bacteria | 5409 |
| 12 | rootH1_10008730 | 3300003323 | Bacteria | 8891 |
| 13 | rootH1_10139894 | 3300003323 | Bacteria | 3140 |
| 14 | JGI25160J50197_1000298 | 3300003354 | Bacteria | 35290 |
| 15 | JGI25161J50226_1000221 | 3300003374 | Bacteria | 35290 |
| 16 | Ga0055539_1021441 | 3300003752 | Bacteria | 767 |
| 17 | Ga0055533_1000350 | 3300003756 | Bacteria | 19996 |
| 18 | Ga0055528_1013537 | 3300003790 | Bacteria | 3083 |
| 19 | Ga0055531_10002582 | 3300003794 | Bacteria | 11991 |
| 20 | Ga0055543_1000722 | 3300004625 | Bacteria | 16763 |
| 21 | Ga0065165_1000983 | 3300005262 | Bacteria | 35328 |
| 22 | Ga0065165_1003357 | 3300005262 | Bacteria | 11370 |
| 23 | Ga0070658_10952087 | 3300005327 | Bacteria | 747 |
| 24 | Ga0070660_101394939 | 3300005339 | Bacteria | 595 |
| 25 | Ga0070689_100114738 | 3300005340 | Bacteria | 2146 |
| 26 | Ga0070675_100471348 | 3300005354 | Bacteria | 1128 |
| 27 | Ga0070659_100888519 | 3300005366 | Bacteria | 778 |
| 28 | Ga0070659_101358312 | 3300005366 | Bacteria | 631 |
| 29 | Ga0070709_10000309 | 3300005434 | Bacteria | 30970 |
| 30 | Ga0070709_10020857 | 3300005434 | Bacteria | 3811 |
| 31 | Ga0070709_10559400 | 3300005434 | Bacteria | 876 |
| 32 | Ga0070709_11081111 | 3300005434 | Bacteria | 641 |
| 33 | Ga0070714_100217104 | 3300005435 | Bacteria | 1756 |
| 34 | Ga0070714_100222257 | 3300005435 | Bacteria | 1736 |
| 35 | Ga0070714_100988288 | 3300005435 | Bacteria | 819 |
| 36 | Ga0070713_100037011 | 3300005436 | Bacteria | 3943 |
| 37 | Ga0070713_100292969 | 3300005436 | Bacteria | 1496 |
| 38 | Ga0070713_100647085 | 3300005436 | Bacteria | 1006 |
| 39 | Ga0070710_10001167 | 3300005437 | Bacteria | 12427 |
| 40 | Ga0070710_10004223 | 3300005437 | Bacteria | 6808 |
| 41 | Ga0070710_10013557 | 3300005437 | Bacteria | 4085 |
| 42 | Ga0070710_10410989 | 3300005437 | Bacteria | 909 |
| 43 | Ga0070711_100010653 | 3300005439 | Bacteria | 5696 |
| 44 | Ga0070711_100021544 | 3300005439 | Bacteria | 4169 |
| 45 | Ga0070711_100081423 | 3300005439 | Bacteria | 2307 |
| 46 | Ga0070711_100124048 | 3300005439 | Bacteria | 1915 |
| 47 | Ga0070711_101692991 | 3300005439 | Bacteria | 554 |
| 48 | Ga0070700_100337869 | 3300005441 | Bacteria | 1112 |
| 49 | Ga0070663_100425954 | 3300005455 | Bacteria | 1089 |
| 50 | Ga0070663_100614496 | 3300005455 | Bacteria | 916 |
| 51 | Ga0070662_100858204 | 3300005457 | Bacteria | 773 |
| 52 | Ga0070706_100814260 | 3300005467 | Bacteria | 864 |
| 53 | Ga0070684_100638999 | 3300005535 | Bacteria | 990 |
| 54 | Ga0070695_101891625 | 3300005545 | Bacteria | 501 |
| 55 | Ga0070693_100317987 | 3300005547 | Bacteria | 1055 |
| 56 | Ga0068855_100284632 | 3300005563 | Bacteria | 1834 |
| 57 | Ga0068857_100197264 | 3300005577 | Bacteria | 1834 |
| 58 | Ga0068856_100128890 | 3300005614 | Bacteria | 2534 |
| 59 | Ga0068859_100895434 | 3300005617 | Bacteria | 972 |
| 60 | Ga0068859_101314072 | 3300005617 | Bacteria | 797 |
| 61 | Ga0068864_100387352 | 3300005618 | Bacteria | 1326 |
| 62 | Ga0068851_10234941 | 3300005834 | Bacteria | 1035 |
| 63 | Ga0068863_100461630 | 3300005841 | Bacteria | 1247 |
| 64 | Ga0068860_100693407 | 3300005843 | Bacteria | 1028 |
| 65 | Ga0081455_10045970 | 3300005937 | Bacteria | 3794 |
| 66 | Ga0081538_10016822 | 3300005981 | Bacteria | 5584 |
| 67 | Ga0081540_1031915 | 3300005983 | Bacteria | 2885 |
| 68 | Ga0070717_10007580 | 3300006028 | Bacteria | 8064 |
| 69 | Ga0070717_10240528 | 3300006028 | Bacteria | 1596 |
| 70 | Ga0070717_10684349 | 3300006028 | Bacteria | 932 |
| 71 | Ga0075365_10073755 | 3300006038 | Bacteria | 2301 |
| 72 | Ga0070715_10005640 | 3300006163 | Bacteria | 4191 |
| 73 | Ga0070715_10032299 | 3300006163 | Bacteria | 2132 |
| 74 | Ga0070715_10146921 | 3300006163 | Bacteria | 1151 |
| 75 | Ga0070716_100007109 | 3300006173 | Bacteria | 5497 |
| 76 | Ga0070716_100129969 | 3300006173 | Bacteria | 1591 |
| 77 | Ga0070716_100213325 | 3300006173 | Bacteria | 1292 |
| 78 | Ga0070712_100009861 | 3300006175 | Bacteria | 6020 |
| 79 | Ga0070712_100011604 | 3300006175 | Bacteria | 5594 |
| 80 | Ga0070712_100029016 | 3300006175 | Bacteria | 3707 |
| 81 | Ga0070712_100045150 | 3300006175 | Bacteria | 3041 |
| 82 | Ga0075362_10126447 | 3300006177 | Bacteria | 1213 |
| 83 | Ga0097621_100348127 | 3300006237 | Bacteria | 1317 |
| 84 | Ga0068871_101860183 | 3300006358 | Bacteria | 572 |
| 85 | Ga0075434_100167075 | 3300006871 | Bacteria | 2220 |
| 86 | Ga0075434_102377087 | 3300006871 | Bacteria | 532 |
| 87 | Ga0097620_100895454 | 3300006931 | Bacteria | 972 |
| 88 | Ga0097620_101314351 | 3300006931 | Bacteria | 797 |
| 89 | Ga0099824_1040842 | 3300006942 | Bacteria | 1124 |
| 90 | Ga0099823_1039281 | 3300006944 | Bacteria | 3485 |
| 91 | Ga0099794_10011441 | 3300007265 | Bacteria | 3799 |
| 92 | Ga0099794_10087820 | 3300007265 | Bacteria | 1540 |
| 93 | Ga0099794_10295199 | 3300007265 | Bacteria | 839 |
| 94 | Ga0099794_10381598 | 3300007265 | Bacteria | 735 |
| 95 | Ga0099795_10001608 | 3300007788 | Bacteria | 4985 |
| 96 | Ga0099795_10020420 | 3300007788 | Bacteria | 2158 |
| 97 | Ga0099795_10077609 | 3300007788 | Bacteria | 1265 |
| 98 | Ga0105251_10139745 | 3300009011 | Unclassified | 1096 |
| 99 | Ga0105244_10000468 | 3300009036 | Bacteria | 36858 |
| 100 | Ga0105240_10235073 | 3300009093 | Bacteria | 2127 |
| 101 | Ga0105240_10262904 | 3300009093 | Bacteria | 1990 |
| 102 | Ga0105245_10182853 | 3300009098 | Bacteria | 2004 |
| 103 | Ga0105247_10042412 | 3300009101 | Bacteria | 2787 |
| 104 | Ga0105247_10199140 | 3300009101 | Bacteria | 1345 |
| 105 | Ga0105241_10002269 | 3300009174 | Bacteria | 14448 |
| 106 | Ga0105241_10179321 | 3300009174 | Bacteria | 1756 |
| 107 | Ga0105241_10607438 | 3300009174 | Bacteria | 989 |
| 108 | Ga0105248_10454753 | 3300009177 | Bacteria | 1443 |
| 109 | Ga0105237_10465240 | 3300009545 | Bacteria | 1271 |
| 110 | Ga0105238_10064772 | 3300009551 | Bacteria | 3654 |
| 111 | Ga0105238_10075801 | 3300009551 | Bacteria | 3355 |
| 112 | Ga0105238_10155076 | 3300009551 | Bacteria | 2265 |
| 113 | Ga0099796_10059630 | 3300010159 | Bacteria | 1348 |
| 114 | Ga0099796_10089406 | 3300010159 | Bacteria | 1142 |
| 115 | Ga0099796_10435035 | 3300010159 | Bacteria | 581 |
| 116 | Ga0099796_10481943 | 3300010159 | Bacteria | 554 |
| 117 | Ga0105239_10148581 | 3300010375 | Bacteria | 2615 |
| 118 | Ga0105239_11822689 | 3300010375 | Bacteria | 705 |
| 119 | Ga0105239_11899824 | 3300010375 | Bacteria | 690 |
| 120 | Ga0105246_10113068 | 3300011119 | Bacteria | 1998 |
| 121 | Ga0105246_11487394 | 3300011119 | Bacteria | 635 |
| 122 | Ga0157373_10000815 | 3300013100 | Bacteria | 24126 |
| 123 | Ga0157371_10001033 | 3300013102 | Bacteria | 30544 |
| 124 | Ga0157369_10012954 | 3300013105 | Bacteria | 9449 |
| 125 | Ga0157369_10723585 | 3300013105 | Bacteria | 1024 |
| 126 | Ga0157378_11230366 | 3300013297 | Bacteria | 789 |
| 127 | Ga0163162_11037884 | 3300013306 | Bacteria | 928 |
| 128 | Ga0157375_10287102 | 3300013308 | Bacteria | 1808 |
| 129 | Ga0157375_10962007 | 3300013308 | Bacteria | 995 |
| 130 | Ga0163163_10159653 | 3300014325 | Bacteria | 2300 |
| 131 | Ga0157379_10084707 | 3300014968 | Bacteria | 2840 |
| 132 | Ga0157376_10406748 | 3300014969 | Bacteria | 1317 |
| 133 | Ga0182005_1115805 | 3300015265 | Bacteria | 760 |
| 134 | Ga0214544_1000035 | 3300021320 | Bacteria | 146874 |
| 135 | Ga0214544_1034689 | 3300021320 | Bacteria | 1400 |
| 136 | Ga0214542_1000181 | 3300021321 | Bacteria | 97233 |
| 137 | Ga0214542_1022159 | 3300021321 | Bacteria | 4143 |
| 138 | Ga0214542_1025925 | 3300021321 | Bacteria | 2961 |
| 139 | Ga0214545_1000094 | 3300021324 | Bacteria | 98180 |
| 140 | Ga0214545_1022480 | 3300021324 | Bacteria | 4411 |
| 141 | Ga0214543_1000155 | 3300021327 | Bacteria | 97353 |
| 142 | Ga0214543_1022736 | 3300021327 | Bacteria | 4349 |
| 143 | Ga0213873_10003859 | 3300021358 | Bacteria | 2744 |
| 144 | Ga0213872_10184508 | 3300021361 | Bacteria | 900 |
| 145 | Ga0213876_10002812 | 3300021384 | Bacteria | 10133 |
| 146 | Ga0213876_10429668 | 3300021384 | Bacteria | 702 |
| 147 | Ga0224572_1091922 | 3300024225 | Bacteria | 560 |
| 148 | Ga0228598_1011147 | 3300024227 | Bacteria | 1790 |
| 149 | Ga0228598_1022644 | 3300024227 | Bacteria | 1236 |
| 150 | Ga0209436_112329 | 3300025208 | Bacteria | 1457 |
| 151 | Ga0209674_100029 | 3300025226 | Bacteria | 466683 |
| 152 | Ga0207425_1085315 | 3300025245 | Bacteria | 522 |
| 153 | Ga0209677_100717 | 3300025253 | Bacteria | 16887 |
| 154 | Ga0209148_1045304 | 3300025254 | Bacteria | 590 |
| 155 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 156 | Ga0209759_1000236 | 3300025256 | Bacteria | 82430 |
| 157 | Ga0209759_1000337 | 3300025256 | Bacteria | 61867 |
| 158 | Ga0209130_1000563 | 3300025284 | Bacteria | 36702 |
| 159 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 160 | Ga0209758_1000117 | 3300025297 | Bacteria | 198325 |
| 161 | Ga0207426_1000272 | 3300025302 | Bacteria | 107804 |
| 162 | Ga0207426_1028087 | 3300025302 | Bacteria | 1867 |
| 163 | Ga0209257_1001342 | 3300025304 | Bacteria | 29838 |
| 164 | Ga0207656_10198954 | 3300025321 | Bacteria | 967 |
| 165 | Ga0207655_1000796 | 3300025728 | Bacteria | 34424 |
| 166 | Ga0207692_10015686 | 3300025898 | Bacteria | 3340 |
| 167 | Ga0207692_10036819 | 3300025898 | Bacteria | 2389 |
| 168 | Ga0207647_10003868 | 3300025904 | Bacteria | 11202 |
| 169 | Ga0207685_10018814 | 3300025905 | Bacteria | 2263 |
| 170 | Ga0207685_10148288 | 3300025905 | Bacteria | 1059 |
| 171 | Ga0207699_10084143 | 3300025906 | Bacteria | 1981 |
| 172 | Ga0207699_10290431 | 3300025906 | Bacteria | 1139 |
| 173 | Ga0207699_10447052 | 3300025906 | Bacteria | 927 |
| 174 | Ga0207699_10499636 | 3300025906 | Bacteria | 878 |
| 175 | Ga0207699_10846995 | 3300025906 | Bacteria | 673 |
| 176 | Ga0207705_11286775 | 3300025909 | Bacteria | 559 |
| 177 | Ga0207684_10506332 | 3300025910 | Bacteria | 1035 |
| 178 | Ga0207654_10000362 | 3300025911 | Bacteria | 26747 |
| 179 | Ga0207654_10548332 | 3300025911 | Bacteria | 821 |
| 180 | Ga0207695_10191316 | 3300025913 | Bacteria | 1964 |
| 181 | Ga0207695_10338224 | 3300025913 | Bacteria | 1393 |
| 182 | Ga0207695_10611894 | 3300025913 | Bacteria | 970 |
| 183 | Ga0207671_10079124 | 3300025914 | Bacteria | 2463 |
| 184 | Ga0207693_10011328 | 3300025915 | Bacteria | 7221 |
| 185 | Ga0207693_10081498 | 3300025915 | Bacteria | 2533 |
| 186 | Ga0207693_10168443 | 3300025915 | Bacteria | 1725 |
| 187 | Ga0207693_10209643 | 3300025915 | Bacteria | 1532 |
| 188 | Ga0207693_10417560 | 3300025915 | Bacteria | 1049 |
| 189 | Ga0207663_10047847 | 3300025916 | Bacteria | 2643 |
| 190 | Ga0207663_10060028 | 3300025916 | Bacteria | 2408 |
| 191 | Ga0207663_10074772 | 3300025916 | Bacteria | 2197 |
| 192 | Ga0207663_11151504 | 3300025916 | Bacteria | 624 |
| 193 | Ga0207663_11366480 | 3300025916 | Bacteria | 570 |
| 194 | Ga0207646_10339748 | 3300025922 | Bacteria | 1357 |
| 195 | Ga0207694_10016734 | 3300025924 | Bacteria | 5542 |
| 196 | Ga0207694_10158485 | 3300025924 | Bacteria | 1827 |
| 197 | Ga0207700_10031909 | 3300025928 | Bacteria | 3749 |
| 198 | Ga0207700_10092282 | 3300025928 | Bacteria | 2394 |
| 199 | Ga0207700_11859467 | 3300025928 | Bacteria | 528 |
| 200 | Ga0207664_10116087 | 3300025929 | Bacteria | 2233 |
| 201 | Ga0207664_10792904 | 3300025929 | Bacteria | 852 |
| 202 | Ga0207690_10762665 | 3300025932 | Bacteria | 798 |
| 203 | Ga0207690_11643299 | 3300025932 | Bacteria | 537 |
| 204 | Ga0207706_10030566 | 3300025933 | Bacteria | 4804 |
| 205 | Ga0207706_10330592 | 3300025933 | Bacteria | 1326 |
| 206 | Ga0207670_10263971 | 3300025936 | Bacteria | 1336 |
| 207 | Ga0207704_10758862 | 3300025938 | Bacteria | 807 |
| 208 | Ga0207665_10002793 | 3300025939 | Bacteria | 11701 |
| 209 | Ga0207665_10026888 | 3300025939 | Bacteria | 3800 |
| 210 | Ga0207665_10092455 | 3300025939 | Bacteria | 2098 |
| 211 | Ga0207711_10500235 | 3300025941 | Bacteria | 1133 |
| 212 | Ga0207667_10137208 | 3300025949 | Bacteria | 2518 |
| 213 | Ga0207667_10207562 | 3300025949 | Bacteria | 2008 |
| 214 | Ga0207667_11404102 | 3300025949 | Bacteria | 672 |
| 215 | Ga0207640_11631950 | 3300025981 | Bacteria | 581 |
| 216 | Ga0207658_11060025 | 3300025986 | Bacteria | 740 |
| 217 | Ga0207703_11319029 | 3300026035 | Bacteria | 694 |
| 218 | Ga0207639_10048638 | 3300026041 | Bacteria | 3211 |
| 219 | Ga0207639_11992391 | 3300026041 | Bacteria | 542 |
| 220 | Ga0207678_10451630 | 3300026067 | Bacteria | 1117 |
| 221 | Ga0207702_10002300 | 3300026078 | Bacteria | 18295 |
| 222 | Ga0207702_10744400 | 3300026078 | Bacteria | 967 |
| 223 | Ga0207702_11742964 | 3300026078 | Bacteria | 615 |
| 224 | Ga0207641_10117961 | 3300026088 | Bacteria | 2364 |
| 225 | Ga0207676_10122598 | 3300026095 | Bacteria | 2195 |
| 226 | Ga0207698_10097514 | 3300026142 | Bacteria | 2426 |
| 227 | Ga0207698_10973588 | 3300026142 | Bacteria | 858 |
| 228 | Ga0209389_1000080 | 3300027296 | Bacteria | 89649 |
| 229 | Ga0209489_100027 | 3300027361 | Bacteria | 188074 |
| 230 | Ga0209700_100022 | 3300027363 | Bacteria | 229977 |
| 231 | Ga0209179_1001082 | 3300027512 | Bacteria | 3165 |
| 232 | Ga0209179_1066256 | 3300027512 | Bacteria | 787 |
| 233 | Ga0209588_1013761 | 3300027671 | Bacteria | 2471 |
| 234 | Ga0268265_11734371 | 3300028380 | Bacteria | 631 |
| 235 | Ga0268264_10632259 | 3300028381 | Bacteria | 1058 |
| 236 | Ga0265762_1019593 | 3300030760 | Bacteria | 1240 |
| 237 | Ga0265760_10061805 | 3300031090 | Bacteria | 1139 |
| 238 | Ga0307408_100082059 | 3300031548 | Bacteria | 2412 |
| 239 | Ga0307508_10081192 | 3300031616 | Bacteria | 2823 |
| 240 | Ga0316044_122064 | 3300031810 | Bacteria | 649 |
| 241 | Ga0307412_10231895 | 3300031911 | Bacteria | 1422 |
| 242 | Ga0307409_100413252 | 3300031995 | Bacteria | 1292 |
| 243 | Ga0307416_100230776 | 3300032002 | Bacteria | 1784 |
| 244 | Ga0307416_100859932 | 3300032002 | Bacteria | 1005 |
| 245 | Ga0307411_10059454 | 3300032005 | Bacteria | 2534 |
| 246 | Ga0307411_11300525 | 3300032005 | Bacteria | 662 |
| 247 | Ga0373926_0103170 | 3300035083 | Bacteria | 1068 |
| 248 | Ga0373944_0371364 | 3300035089 | Bacteria | 547 |
| 249 | Ga0373944_0393186 | 3300035089 | Bacteria | 533 |
| 250 | Ga0373923_0004097 | 3300035111 | Bacteria | 4793 |
| 251 | Ga0373923_0038177 | 3300035111 | Bacteria | 1967 |
| 252 | Ga0373936_0005167 | 3300035113 | Bacteria | 4912 |
| 253 | Ga0373953_0089146 | 3300035117 | Bacteria | 1289 |
| 254 | Ga0373953_0498124 | 3300035117 | Bacteria | 540 |
| 255 | Ga0373954_0015700 | 3300035118 | Bacteria | 3387 |
| 256 | Ga0373956_0107507 | 3300035119 | Bacteria | 1297 |
| 257 | Ga0373943_0023802 | 3300035170 | Bacteria | 2850 |
| 258 | Ga0373943_0107071 | 3300035170 | Bacteria | 1470 |
| 259 | Ga0373946_0066043 | 3300035171 | Bacteria | 1550 |
| 260 | Ga0373946_0540953 | 3300035171 | Bacteria | 600 |
| 261 | Ga0373955_0007452 | 3300035172 | Bacteria | 5032 |
| 262 | Ga0373955_0083223 | 3300035172 | Bacteria | 1812 |
| 263 | Ga0373924_0034532 | 3300035410 | Bacteria | 2047 |
| 264 | Ga0373924_0334215 | 3300035410 | Bacteria | 674 |
| 265 | Ga0373935_0008122 | 3300035692 | Bacteria | 6291 |
| 266 | Ga0373927_0009901 | 3300035695 | Bacteria | 6391 |
| 267 | Ga0373927_0105480 | 3300035695 | Bacteria | 1835 |
| 268 | Ga0373927_0195739 | 3300035695 | Bacteria | 1326 |
| 269 | Ga0373933_0050588 | 3300035724 | Bacteria | 2481 |
| 270 | Ga0373933_0529282 | 3300035724 | Bacteria | 773 |
| 271 | Ga0373947_0065286 | 3300035725 | Bacteria | 2220 |
| 272 | Ga0373947_0388183 | 3300035725 | Bacteria | 940 |
| 273 | Ga0373937_0554970 | 3300036401 | Bacteria | 1091 |
| 274 | Ga0372808_013594 | 3300036459 | Bacteria | 1160 |
| 275 | Ga0373925_0019566 | 3300037068 | Bacteria | 4926 |
| 276 | Ga0373925_0203234 | 3300037068 | Bacteria | 1576 |
| 277 | Ga0436364_1368094 | 3300037853 | Bacteria | 1572 |
| 278 | Ga0436365_0160289 | 3300039437 | Bacteria | 39593 |
| 279 | Ga0436365_0747848 | 3300039437 | Bacteria | 1339 |
| 280 | Ga0436365_1912289 | 3300039437 | Bacteria | 1132 |
| 281 | Ga0436360_0369380 | 3300039438 | Bacteria | 789 |
| 282 | Ga0436360_0890401 | 3300039438 | Bacteria | 1289 |
| 283 | Ga0436360_1291016 | 3300039438 | Bacteria | 1012 |
| 284 | Ga0436361_0566172 | 3300039447 | Bacteria | 2139 |
| 285 | Ga0436361_0836406 | 3300039447 | Bacteria | 1209 |
| 286 | Ga0436363_1452198 | 3300039450 | Bacteria | 2062 |
| 287 | Ga0436363_1475395 | 3300039450 | Bacteria | 908 |
| 288 | Ga0436362_0489956 | 3300039453 | Bacteria | 2033 |
| 289 | Ga0436362_0770136 | 3300039453 | Bacteria | 3655 |
| 290 | Ga0451793_0013698 | 3300041452 | Bacteria | 963 |
| 291 | Ga0451800_0501010 | 3300041459 | Bacteria | 1127 |
| 292 | Ga0451804_0796461 | 3300041463 | Bacteria | 936 |
| 293 | Ga0451807_0774867 | 3300041486 | Bacteria | 835 |
| 294 | Ga0451833_1246459 | 3300041491 | Bacteria | 4237 |
| 295 | Ga0451841_0159110 | 3300041498 | Bacteria | 893 |
| 296 | Ga0451841_0877529 | 3300041498 | Bacteria | 501 |
| 297 | Ga0451849_0736014 | 3300041505 | Bacteria | 991 |
| 298 | Ga0451843_1550113 | 3300041509 | Bacteria | 9089 |
| 299 | Ga0451855_1172457 | 3300041511 | Bacteria | 6234 |
| 300 | Ga0451853_3260269 | 3300041512 | Bacteria | 3050 |
| 301 | Ga0466964_0495021 | 3300044706 | Bacteria | 656 |
| 302 | Ga0466957_1004215 | 3300044842 | Bacteria | 599 |
| 303 | Ga0495603_0000056 | 3300046455 | Bacteria | 48775 |
| 304 | Ga0495603_0775891 | 3300046455 | Bacteria | 547 |
| 305 | Ga0495629_0166935 | 3300046459 | Bacteria | 1528 |
| 306 | Ga0495629_0757142 | 3300046459 | Bacteria | 642 |
| 307 | Ga0495641_0074761 | 3300046461 | Bacteria | 1519 |
| 308 | Ga0495651_0085513 | 3300046462 | Bacteria | 2375 |
| 309 | Ga0495651_0301193 | 3300046462 | Bacteria | 1075 |
| 310 | Ga0495653_0000565 | 3300046463 | Bacteria | 28368 |
| 311 | Ga0495650_0235831 | 3300046471 | Bacteria | 626 |
| 312 | Ga0495580_0000168 | 3300046472 | Bacteria | 48775 |
| 313 | Ga0495580_0010032 | 3300046472 | Bacteria | 7404 |
| 314 | Ga0495580_0026124 | 3300046472 | Bacteria | 4260 |
| 315 | Ga0495580_0044002 | 3300046472 | Bacteria | 3176 |
| 316 | Ga0495580_0248547 | 3300046472 | Bacteria | 1218 |
| 317 | Ga0495582_0001687 | 3300046473 | Bacteria | 12465 |
| 318 | Ga0495582_0254837 | 3300046473 | Bacteria | 1006 |
| 319 | Ga0495664_0001243 | 3300046477 | Bacteria | 13333 |
| 320 | Ga0495664_0017641 | 3300046477 | Bacteria | 4082 |
| 321 | Ga0495664_0110249 | 3300046477 | Bacteria | 1661 |
| 322 | Ga0495594_0532022 | 3300046499 | Bacteria | 667 |
| 323 | Ga0495606_0000336 | 3300046507 | Bacteria | 80986 |
| 324 | Ga0495618_0032338 | 3300046514 | Bacteria | 3276 |
| 325 | Ga0495618_0314594 | 3300046514 | Bacteria | 971 |
| 326 | Ga0495618_0582919 | 3300046514 | Bacteria | 667 |
| 327 | Ga0495628_0000751 | 3300046516 | Bacteria | 29935 |
| 328 | Ga0495630_0000363 | 3300046517 | Bacteria | 35937 |
| 329 | Ga0495630_0174892 | 3300046517 | Bacteria | 1636 |
| 330 | Ga0495630_0344247 | 3300046517 | Bacteria | 1141 |
| 331 | Ga0495648_0026396 | 3300046524 | Bacteria | 3911 |
| 332 | Ga0495666_0002570 | 3300046526 | Bacteria | 9022 |
| 333 | Ga0495666_0160713 | 3300046526 | Bacteria | 1042 |
| 334 | Ga0495652_0001008 | 3300046529 | Bacteria | 32262 |
| 335 | Ga0495652_0166641 | 3300046529 | Bacteria | 1705 |
| 336 | Ga0495665_0000136 | 3300046531 | Bacteria | 35495 |
| 337 | Ga0495665_0454245 | 3300046531 | Bacteria | 647 |
| 338 | Ga0495640_0066347 | 3300046533 | Bacteria | 2434 |
| 339 | Ga0495640_0086301 | 3300046533 | Bacteria | 2078 |
| 340 | Ga0495640_0522358 | 3300046533 | Bacteria | 721 |
| 341 | Ga0495586_0000085 | 3300046535 | Bacteria | 57466 |
| 342 | Ga0495586_0165821 | 3300046535 | Bacteria | 1247 |
| 343 | Ga0495587_0166837 | 3300046536 | Bacteria | 1251 |
| 344 | Ga0495587_0454631 | 3300046536 | Bacteria | 709 |
| 345 | Ga0495645_0009496 | 3300046543 | Bacteria | 6799 |
| 346 | Ga0495645_0087702 | 3300046543 | Bacteria | 2226 |
| 347 | Ga0495667_0403876 | 3300046559 | Bacteria | 860 |
| 348 | Ga0495634_0013184 | 3300046642 | Bacteria | 5973 |
| 349 | Ga0495634_0043876 | 3300046642 | Bacteria | 3029 |
| 350 | Ga0495634_0637123 | 3300046642 | Bacteria | 616 |
| 351 | Ga0495635_0023765 | 3300046663 | Bacteria | 4271 |
| 352 | Ga0495635_0278202 | 3300046663 | Bacteria | 1124 |
| 353 | Ga0495661_0019607 | 3300046665 | Bacteria | 4429 |
| 354 | Ga0495588_0092810 | 3300046674 | Bacteria | 1582 |
| 355 | Ga0495599_0243958 | 3300046678 | Bacteria | 1095 |
| 356 | Ga0495623_0087908 | 3300046679 | Bacteria | 1914 |
| 357 | Ga0495623_0527807 | 3300046679 | Bacteria | 620 |
| 358 | Ga0495646_0002579 | 3300046680 | Bacteria | 11148 |
| 359 | Ga0495646_0165559 | 3300046680 | Bacteria | 1221 |
| 360 | Ga0495658_0463004 | 3300046683 | Bacteria | 810 |
| 361 | Ga0495613_0002504 | 3300046689 | Bacteria | 13852 |
| 362 | Ga0495613_0231948 | 3300046689 | Bacteria | 1293 |
| 363 | Ga0495613_1041303 | 3300046689 | Bacteria | 524 |
| 364 | Ga0495624_0000306 | 3300046690 | Bacteria | 38630 |
| 365 | Ga0495624_0079537 | 3300046690 | Bacteria | 2033 |
| 366 | Ga0495589_0071308 | 3300046794 | Bacteria | 1698 |
| 367 | Ga0495600_0044952 | 3300046809 | Bacteria | 2881 |
| 368 | Ga0495581_0000036 | 3300047315 | Bacteria | 50156 |
| 369 | Ga0495581_0071514 | 3300047315 | Bacteria | 2007 |
| 370 | Ga0495581_0463741 | 3300047315 | Bacteria | 737 |
| 371 | Ga0495604_0083044 | 3300047317 | Bacteria | 2395 |
| 372 | Ga0495674_0000195 | 3300047319 | Bacteria | 48775 |
| 373 | Ga0495674_0064031 | 3300047319 | Bacteria | 3197 |
| 374 | Ga0495676_0001536 | 3300047321 | Bacteria | 19992 |
| 375 | Ga0495676_0556585 | 3300047321 | Bacteria | 749 |
| 376 | Ga0495680_0001470 | 3300047322 | Bacteria | 25428 |
| 377 | Ga0495680_0080895 | 3300047322 | Bacteria | 2454 |
| 378 | Ga0495675_0533212 | 3300047444 | Bacteria | 671 |
| 379 | Ga0495675_0651765 | 3300047444 | Bacteria | 593 |
| 380 | Ga0495679_000238 | 3300047446 | Bacteria | 45827 |
| 381 | Ga0495673_0028253 | 3300047469 | Bacteria | 2658 |
| 382 | Ga0495684_0005368 | 3300047471 | Bacteria | 9981 |
| 383 | Ga0495686_0000099 | 3300047472 | Bacteria | 180546 |
| 384 | Ga0495686_0285813 | 3300047472 | Bacteria | 915 |
| 385 | Ga0495593_0022654 | 3300047673 | Bacteria | 3497 |
| 386 | Ga0495593_0045278 | 3300047673 | Bacteria | 2349 |
| 387 | Ga0495593_0047254 | 3300047673 | Bacteria | 2290 |
| 388 | Ga0495602_0004569 | 3300048088 | Bacteria | 14444 |
| 389 | Ga0495614_0000233 | 3300048089 | Bacteria | 21616 |
| 390 | Ga0496100_0053103 | 3300048903 | Bacteria | 2638 |
| 391 | Ga0496100_0281747 | 3300048903 | Bacteria | 1239 |
| 392 | Ga0496100_1187024 | 3300048903 | Bacteria | 602 |
| 393 | Ga0496101_0048177 | 3300048904 | Bacteria | 3062 |
| 394 | Ga0496101_0348860 | 3300048904 | Bacteria | 1163 |
| 395 | Ga0496102_0625834 | 3300048905 | Bacteria | 999 |
| 396 | Ga0496103_0659791 | 3300048906 | Bacteria | 664 |
| 397 | Ga0496104_0009152 | 3300048907 | Bacteria | 8806 |
| 398 | Ga0496105_0010297 | 3300048908 | Bacteria | 7350 |
| 399 | Ga0496105_0940372 | 3300048908 | Bacteria | 649 |
| 400 | Ga0496106_0024365 | 3300048909 | Bacteria | 4499 |
| 401 | Ga0496106_0876112 | 3300048909 | Bacteria | 710 |
| 402 | Ga0496107_0030034 | 3300048910 | Bacteria | 3872 |
| 403 | Ga0496108_0051828 | 3300048911 | Bacteria | 3438 |
| 404 | Ga0496109_0081697 | 3300048912 | Bacteria | 2978 |
| 405 | Ga0496110_0014579 | 3300048913 | Bacteria | 6530 |
| 406 | Ga0496110_0311200 | 3300048913 | Bacteria | 1434 |
| 407 | Ga0496111_0185947 | 3300048914 | Bacteria | 1544 |
| 408 | Ga0496112_0006351 | 3300048915 | Bacteria | 10372 |
| 409 | Ga0496113_0019439 | 3300048916 | Bacteria | 4752 |
| 410 | Ga0496114_0151896 | 3300048917 | Bacteria | 2009 |
| 411 | Ga0496115_0129958 | 3300048918 | Bacteria | 2076 |
| 412 | Ga0496115_0134215 | 3300048918 | Bacteria | 2041 |
| 413 | Ga0496116_0113849 | 3300048919 | Bacteria | 1582 |
| 414 | Ga0496117_0419418 | 3300048920 | Bacteria | 670 |
| 415 | Ga0496118_0023001 | 3300048921 | Bacteria | 5428 |
| 416 | Ga0496118_0539311 | 3300048921 | Bacteria | 571 |
| 417 | Ga0496119_0055679 | 3300048922 | Bacteria | 2401 |
| 418 | Ga0496120_0438914 | 3300048923 | Bacteria | 570 |
| 419 | Ga0496121_0033391 | 3300048924 | Bacteria | 4656 |
| 420 | Ga0496121_0092371 | 3300048924 | Bacteria | 2359 |
| 421 | Ga0496121_0099508 | 3300048924 | Bacteria | 2247 |
| 422 | Ga0496121_0192717 | 3300048924 | Bacteria | 1460 |
| 423 | Ga0496121_0370110 | 3300048924 | Bacteria | 948 |
| 424 | Ga0496121_0432539 | 3300048924 | Bacteria | 853 |
| 425 | Ga0496123_0196366 | 3300048926 | Bacteria | 1039 |
| 426 | Ga0496124_0126827 | 3300048927 | Bacteria | 2032 |
| 427 | Ga0496125_0012354 | 3300048928 | Bacteria | 8484 |
| 428 | Ga0496125_0259627 | 3300048928 | Bacteria | 1089 |
| 429 | Ga0496126_0000511 | 3300048929 | Bacteria | 75804 |
| 430 | Ga0496126_0028256 | 3300048929 | Bacteria | 5346 |
| 431 | Ga0496126_0272720 | 3300048929 | Bacteria | 1404 |
| 432 | Ga0496126_0319356 | 3300048929 | Bacteria | 1277 |
| 433 | Ga0496126_0381088 | 3300048929 | Bacteria | 1148 |
| 434 | Ga0496126_0461012 | 3300048929 | Bacteria | 1021 |
| 435 | Ga0495682_0009173 | 3300049460 | Bacteria | 3872 |
| 436 | Ga0501031_0385074 | 3300049568 | Bacteria | 907 |
| 437 | Ga0501031_0648924 | 3300049568 | Bacteria | 678 |
| 438 | Ga0501032_0805170 | 3300049569 | Bacteria | 593 |
| 439 | Ga0501041_0565859 | 3300049577 | Bacteria | 725 |
| 440 | Ga0501042_0322086 | 3300049578 | Bacteria | 1117 |
| 441 | Ga0501048_0254341 | 3300049582 | Bacteria | 1248 |
| 442 | Ga0501068_1123513 | 3300049584 | Bacteria | 520 |
| 443 | Ga0501068_1203868 | 3300049584 | Bacteria | 502 |
| 444 | Ga0501081_0976393 | 3300049743 | Bacteria | 640 |
| 445 | nmdc:mga03683_246546_c1 | 3300050489 | Bacteria | 829 |
| 446 | nmdc:mga0yw44_65385_c1 | 3300050492 | Bacteria | 2241 |
| 447 | Ga0495601_0232591 | 3300053077 | Bacteria | 1204 |
| 448 | Ga0495612_0540813 | 3300053078 | Bacteria | 536 |
| 449 | Ga0500572_000939 | 3300053111 | Bacteria | 8887 |
| 450 | Ga0500618_000433 | 3300053125 | Bacteria | 27738 |
| 451 | Ga0500559_0000186 | 3300053136 | Bacteria | 49470 |
| 452 | Ga0500638_252753 | 3300053162 | Bacteria | 708 |
| 453 | Ga0500639_005324 | 3300053163 | Bacteria | 6573 |
| 454 | Ga0500636_0541021 | 3300053177 | Bacteria | 506 |
| 455 | Ga0500596_004944 | 3300053735 | Bacteria | 2395 |
| 456 | Ga0500601_012568 | 3300053737 | Bacteria | 956 |
| 457 | Ga0500601_017460 | 3300053737 | Bacteria | 823 |
| 458 | Ga0587066_219825 | 3300059490 | Bacteria | 509 |
| 459 | Ga0587070_104663 | 3300059491 | Bacteria | 656 |
| 460 | Ga0587125_066793 | 3300059607 | Bacteria | 536 |
| 461 | Ga0587101_053278 | 3300059623 | Bacteria | 703 |
| 462 | Ga0501082_0298173 | 3300060353 | Bacteria | 1404 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041452 | Ga0451793_0013698 | Ga0451793_0013698_420_824 | 71 |
| 2 | 3300041463 | Ga0451804_0796461 | Ga0451804_0796461_174_578 | 71 |
| 3 | 3300041486 | Ga0451807_0774867 | Ga0451807_0774867_129_533 | 71 |
| 4 | 3300041498 | Ga0451841_0159110 | Ga0451841_0159110_398_802 | 71 |
| 5 | 3300015265 | Ga0182005_1115805 | Ga0182005_11158052 | 72 |
| 6 | 3300009101 | Ga0105247_10199140 | Ga0105247_101991402 | 76 |
| 7 | 3300009174 | Ga0105241_10179321 | Ga0105241_101793212 | 76 |
| 8 | 3300009551 | Ga0105238_10155076 | Ga0105238_101550762 | 76 |
| 9 | 3300011119 | Ga0105246_10113068 | Ga0105246_101130682 | 76 |
| 10 | 3300013308 | Ga0157375_10962007 | Ga0157375_109620072 | 76 |
| 11 | 3300014325 | Ga0163163_10159653 | Ga0163163_101596532 | 76 |
| 12 | 3300039437 | Ga0436365_0747848 | Ga0436365_0747848_105_503 | 76 |
| 13 | 3300048927 | Ga0496124_0126827 | Ga0496124_0126827_203_556 | 76 |
| 14 | 3300025906 | Ga0207699_10447052 | Ga0207699_104470522 | 83 |
| 15 | 3300048903 | Ga0496100_0053103 | Ga0496100_0053103_356_610 | 84 |
| 16 | 3300048904 | Ga0496101_0348860 | Ga0496101_0348860_710_964 | 84 |
| 17 | 3300048908 | Ga0496105_0940372 | Ga0496105_0940372_88_342 | 84 |
| 18 | 3300048913 | Ga0496110_0311200 | Ga0496110_0311200_842_1096 | 84 |
| 19 | 3300048917 | Ga0496114_0151896 | Ga0496114_0151896_1733_1987 | 84 |
| 20 | 3300048918 | Ga0496115_0129958 | Ga0496115_0129958_1310_1564 | 84 |
| 21 | 3300005937 | Ga0081455_10045970 | Ga0081455_100459704 | 86 |
| 22 | 3300049743 | Ga0501081_0976393 | Ga0501081_0976393_165_491 | 91 |
| 23 | 3300006177 | Ga0075362_10126447 | Ga0075362_101264472 | 93 |
| 24 | 3300025905 | Ga0207685_10018814 | Ga0207685_100188142 | 93 |
| 25 | 3300050489 | nmdc:mga03683_246546_c1 | nmdc:mga03683_246546_c1_142_447 | 93 |
| 26 | 3300005262 | Ga0065165_1003357 | Ga0065165_10033577 | 94 |
| 27 | 3300005983 | Ga0081540_1031915 | Ga0081540_10319152 | 94 |
| 28 | 3300025302 | Ga0207426_1028087 | Ga0207426_10280872 | 94 |
| 29 | 3300053111 | Ga0500572_000939 | Ga0500572_000939_2558_2869 | 94 |
| 30 | 3300053136 | Ga0500559_0000186 | Ga0500559_0000186_22884_23195 | 94 |
| 31 | 3300053163 | Ga0500639_005324 | Ga0500639_005324_4740_5051 | 94 |
| 32 | 3300053735 | Ga0500596_004944 | Ga0500596_004944_1522_1833 | 94 |
| 33 | 3300053737 | Ga0500601_017460 | Ga0500601_017460_176_529 | 94 |
| 34 | 3300059607 | Ga0587125_066793 | Ga0587125_066793_149_448 | 94 |
| 35 | 3300005617 | Ga0068859_100895434 | Ga0068859_1008954342 | 95 |
| 36 | 3300006931 | Ga0097620_100895454 | Ga0097620_1008954542 | 95 |
| 37 | 3300009174 | Ga0105241_10002269 | Ga0105241_1000226915 | 95 |
| 38 | 3300021320 | Ga0214544_1000035 | Ga0214544_100003566 | 95 |
| 39 | 3300021321 | Ga0214542_1000181 | Ga0214542_100018170 | 95 |
| 40 | 3300021321 | Ga0214542_1022159 | Ga0214542_10221592 | 95 |
| 41 | 3300021324 | Ga0214545_1000094 | Ga0214545_100009428 | 95 |
| 42 | 3300021324 | Ga0214545_1022480 | Ga0214545_10224805 | 95 |
| 43 | 3300021327 | Ga0214543_1000155 | Ga0214543_100015528 | 95 |
| 44 | 3300021327 | Ga0214543_1022736 | Ga0214543_10227365 | 95 |
| 45 | 3300025932 | Ga0207690_11643299 | Ga0207690_116432991 | 95 |
| 46 | 3300031548 | Ga0307408_100082059 | Ga0307408_1000820593 | 95 |
| 47 | 3300031911 | Ga0307412_10231895 | Ga0307412_102318951 | 95 |
| 48 | 3300031995 | Ga0307409_100413252 | Ga0307409_1004132522 | 95 |
| 49 | 3300032002 | Ga0307416_100230776 | Ga0307416_1002307761 | 95 |
| 50 | 3300032005 | Ga0307411_11300525 | Ga0307411_113005251 | 95 |
| 51 | 3300041459 | Ga0451800_0501010 | Ga0451800_0501010_828_1115 | 95 |
| 52 | 3300049568 | Ga0501031_0648924 | Ga0501031_0648924_280_585 | 95 |
| 53 | 3300049569 | Ga0501032_0805170 | Ga0501032_0805170_243_548 | 95 |
| 54 | 3300049577 | Ga0501041_0565859 | Ga0501041_0565859_261_566 | 95 |
| 55 | 3300049578 | Ga0501042_0322086 | Ga0501042_0322086_382_687 | 95 |
| 56 | 3300049582 | Ga0501048_0254341 | Ga0501048_0254341_670_975 | 95 |
| 57 | 3300049584 | Ga0501068_1123513 | Ga0501068_1123513_23_328 | 95 |
| 58 | 3300053162 | Ga0500638_252753 | Ga0500638_252753_387_698 | 95 |
| 59 | 3300060353 | Ga0501082_0298173 | Ga0501082_0298173_399_704 | 95 |
| 60 | iso_pu_bacteria | 2513237096 | 2513658614 | 95 |
| 61 | iso_pu_bacteria | 2513237145 | 2513920822 | 95 |
| 62 | iso_pu_bacteria | 2667528175 | 2671118972 | 95 |
| 63 | iso_pu_bacteria | 2879099564 | 2879102531 | 95 |
| 64 | iso_pu_bacteria | 2904690495 | 2904690954 | 95 |
| 65 | iso_pu_bacteria | 2908756301 | 2908757010 | 95 |
| 66 | iso_pu_bacteria | 8016522445 | 8016525308 | 95 |
| 67 | iso_pu_bacteria | 8016530956 | 8016538890 | 95 |
| 68 | iso_pu_bacteria | 8016539877 | 8016543176 | 95 |
| 69 | iso_pu_bacteria | 8016548790 | 8016550118 | 95 |
| 70 | iso_pu_bacteria | 8016566248 | 8016568586 | 95 |
| 71 | iso_pu_bacteria | 8016575299 | 8016581232 | 95 |
| 72 | iso_pu_bacteria | 8016595262 | 8016596510 | 95 |
| 73 | iso_pu_bacteria | 8019530166 | 8019538558 | 95 |
| 74 | 3300009093 | Ga0105240_10262904 | Ga0105240_102629042 | 96 |
| 75 | 3300010375 | Ga0105239_10148581 | Ga0105239_101485812 | 96 |
| 76 | 3300039438 | Ga0436360_0369380 | Ga0436360_0369380_76_381 | 96 |
| 77 | 3300048929 | Ga0496126_0461012 | Ga0496126_0461012_467_778 | 96 |
| 78 | iso_pu_bacteria | 2510917030 | 2511196010 | 96 |
| 79 | iso_pu_bacteria | 2513237088 | 2513595985 | 96 |
| 80 | iso_pu_bacteria | 2523231067 | 2523469757 | 96 |
| 81 | iso_pu_bacteria | 2582581298 | 2585222590 | 96 |
| 82 | iso_pu_bacteria | 2585427529 | 2585545173 | 96 |
| 83 | iso_pu_bacteria | 2643221558 | 2643813926 | 96 |
| 84 | iso_pu_bacteria | 2738543031 | 2739348925 | 96 |
| 85 | iso_pu_bacteria | 2852387548 | 2852394293 | 96 |
| 86 | iso_pu_bacteria | 2919100787 | 2919106476 | 96 |
| 87 | iso_pu_bacteria | 3005409236 | 3005416124 | 96 |
| 88 | iso_pu_bacteria | 8046767195 | 8046771178 | 96 |
| 89 | 3300025949 | Ga0207667_11404102 | Ga0207667_114041022 | 97 |
| 90 | iso_pu_bacteria | 2507262055 | 2507506824 | 97 |
| 91 | iso_pu_bacteria | 2508501009 | 2508540841 | 97 |
| 92 | iso_pu_bacteria | 2508501042 | 2508696794 | 97 |
| 93 | iso_pu_bacteria | 2508501128 | 2509152256 | 97 |
| 94 | iso_pu_bacteria | 2511231028 | 2511400082 | 97 |
| 95 | iso_pu_bacteria | 2513237092 | 2513622165 | 97 |
| 96 | iso_pu_bacteria | 2513237094 | 2513641459 | 97 |
| 97 | iso_pu_bacteria | 2513237102 | 2513704726 | 97 |
| 98 | iso_pu_bacteria | 2513237104 | 2513721737 | 97 |
| 99 | iso_pu_bacteria | 2513237161 | 2514013056 | 97 |
| 100 | iso_pu_bacteria | 2513237351 | 2514588435 | 97 |
| 101 | iso_pu_bacteria | 2515154114 | 2515645652 | 97 |
| 102 | iso_pu_bacteria | 2515154116 | 2515661440 | 97 |
| 103 | iso_pu_bacteria | 2517093001 | 2517107646 | 97 |
| 104 | iso_pu_bacteria | 2517287029 | 2517405356 | 97 |
| 105 | iso_pu_bacteria | 2524023205 | 2524439338 | 97 |
| 106 | iso_pu_bacteria | 2582581308 | 2585281849 | 97 |
| 107 | iso_pu_bacteria | 2582581315 | 2585328770 | 97 |
| 108 | iso_pu_bacteria | 2582581316 | 2585332963 | 97 |
| 109 | iso_pu_bacteria | 2585427527 | 2585535265 | 97 |
| 110 | iso_pu_bacteria | 2600255067 | 2600811032 | 97 |
| 111 | iso_pu_bacteria | 2615840626 | 2616312226 | 97 |
| 112 | iso_pu_bacteria | 2617270735 | 2617348243 | 97 |
| 113 | iso_pu_bacteria | 2667528174 | 2671116115 | 97 |
| 114 | iso_pu_bacteria | 2775506904 | 2776280196 | 97 |
| 115 | iso_pu_bacteria | 2808606384 | 2808973530 | 97 |
| 116 | iso_pu_bacteria | 2808606390 | 2809008379 | 97 |
| 117 | iso_pu_bacteria | 2808606391 | 2809015283 | 97 |
| 118 | iso_pu_bacteria | 2824617872 | 2824626004 | 97 |
| 119 | iso_pu_bacteria | 2824626560 | 2824628771 | 97 |
| 120 | iso_pu_bacteria | 2824635225 | 2824642638 | 97 |
| 121 | iso_pu_bacteria | 2824644064 | 2824650413 | 97 |
| 122 | iso_pu_bacteria | 2824671348 | 2824675156 | 97 |
| 123 | iso_pu_bacteria | 2824679649 | 2824685719 | 97 |
| 124 | iso_pu_bacteria | 2824687955 | 2824689632 | 97 |
| 125 | iso_pu_bacteria | 2824714736 | 2824720322 | 97 |
| 126 | iso_pu_bacteria | 2824723954 | 2824730592 | 97 |
| 127 | iso_pu_bacteria | 2824773399 | 2824773797 | 97 |
| 128 | iso_pu_bacteria | 2838122688 | 2838126791 | 97 |
| 129 | iso_pu_bacteria | 2841941048 | 2841947609 | 97 |
| 130 | iso_pu_bacteria | 2841949485 | 2841956555 | 97 |
| 131 | iso_pu_bacteria | 2841966195 | 2841971644 | 97 |
| 132 | iso_pu_bacteria | 2841974524 | 2841982613 | 97 |
| 133 | iso_pu_bacteria | 2841983080 | 2841986817 | 97 |
| 134 | iso_pu_bacteria | 2842045827 | 2842053033 | 97 |
| 135 | iso_pu_bacteria | 2842324504 | 2842329438 | 97 |
| 136 | iso_pu_bacteria | 2842324504 | 2842329455 | 97 |
| 137 | iso_pu_bacteria | 2842348783 | 2842354446 | 97 |
| 138 | iso_pu_bacteria | 2842348783 | 2842354463 | 97 |
| 139 | iso_pu_bacteria | 2842454564 | 2842456332 | 97 |
| 140 | iso_pu_bacteria | 2842454564 | 2842456349 | 97 |
| 141 | iso_pu_bacteria | 2844315083 | 2844318707 | 97 |
| 142 | iso_pu_bacteria | 2847930680 | 2847938326 | 97 |
| 143 | iso_pu_bacteria | 2855730933 | 2855733928 | 97 |
| 144 | iso_pu_bacteria | 2855767633 | 2855769518 | 97 |
| 145 | iso_pu_bacteria | 2874612657 | 2874618826 | 97 |
| 146 | iso_pu_bacteria | 2874620515 | 2874626044 | 97 |
| 147 | iso_pu_bacteria | 2876761206 | 2876761994 | 97 |
| 148 | iso_pu_bacteria | 2879083081 | 2879086088 | 97 |
| 149 | iso_pu_bacteria | 2881364244 | 2881364313 | 97 |
| 150 | iso_pu_bacteria | 2885366525 | 2885368039 | 97 |
| 151 | iso_pu_bacteria | 2903727486 | 2903728838 | 97 |
| 152 | iso_pu_bacteria | 2904666416 | 2904667518 | 97 |
| 153 | iso_pu_bacteria | 2906602504 | 2906604464 | 97 |
| 154 | iso_pu_bacteria | 2906626472 | 2906632132 | 97 |
| 155 | iso_pu_bacteria | 2906643746 | 2906648851 | 97 |
| 156 | iso_pu_bacteria | 2922393267 | 2922394613 | 97 |
| 157 | iso_pu_bacteria | 2929615660 | 2929621460 | 97 |
| 158 | iso_pu_bacteria | 2929624759 | 2929631725 | 97 |
| 159 | iso_pu_bacteria | 2932794094 | 2932798711 | 97 |
| 160 | iso_pu_bacteria | 2932801729 | 2932806612 | 97 |
| 161 | iso_pu_bacteria | 2933577622 | 2933583515 | 97 |
| 162 | iso_pu_bacteria | 2935608549 | 2935615892 | 97 |
| 163 | iso_pu_bacteria | 2935630451 | 2935634871 | 97 |
| 164 | iso_pu_bacteria | 2935648319 | 2935653933 | 97 |
| 165 | iso_pu_bacteria | 2935656913 | 2935662682 | 97 |
| 166 | iso_pu_bacteria | 2935675223 | 2935680081 | 97 |
| 167 | iso_pu_bacteria | 2935675223 | 2935680147 | 97 |
| 168 | iso_pu_bacteria | 2935684952 | 2935693838 | 97 |
| 169 | iso_pu_bacteria | 2935694250 | 2935700721 | 97 |
| 170 | iso_pu_bacteria | 2935713505 | 2935721960 | 97 |
| 171 | iso_pu_bacteria | 2935722832 | 2935731395 | 97 |
| 172 | iso_pu_bacteria | 2935732158 | 2935741095 | 97 |
| 173 | iso_pu_bacteria | 2935741537 | 2935750471 | 97 |
| 174 | iso_pu_bacteria | 2935750917 | 2935759726 | 97 |
| 175 | iso_pu_bacteria | 2935760218 | 2935768669 | 97 |
| 176 | iso_pu_bacteria | 2935819856 | 2935826839 | 97 |
| 177 | iso_pu_bacteria | 2935847175 | 2935854019 | 97 |
| 178 | iso_pu_bacteria | 2935883170 | 2935889423 | 97 |
| 179 | iso_pu_bacteria | 2935908558 | 2935914889 | 97 |
| 180 | iso_pu_bacteria | 2935916978 | 2935923220 | 97 |
| 181 | iso_pu_bacteria | 2935926038 | 2935932432 | 97 |
| 182 | iso_pu_bacteria | 2935934488 | 2935941030 | 97 |
| 183 | iso_pu_bacteria | 2935942939 | 2935949077 | 97 |
| 184 | iso_pu_bacteria | 2935951376 | 2935957772 | 97 |
| 185 | iso_pu_bacteria | 2935959822 | 2935964744 | 97 |
| 186 | iso_pu_bacteria | 2935967501 | 2935974107 | 97 |
| 187 | iso_pu_bacteria | 2935984226 | 2935990239 | 97 |
| 188 | iso_pu_bacteria | 2936011229 | 2936015317 | 97 |
| 189 | iso_pu_bacteria | 2936019824 | 2936023951 | 97 |
| 190 | iso_pu_bacteria | 2936028420 | 2936032966 | 97 |
| 191 | iso_pu_bacteria | 2936046547 | 2936051059 | 97 |
| 192 | iso_pu_bacteria | 2936055302 | 2936058459 | 97 |
| 193 | iso_pu_bacteria | 2937843397 | 2937848353 | 97 |
| 194 | iso_pu_bacteria | 2940556831 | 2940565631 | 97 |
| 195 | iso_pu_bacteria | 2941507105 | 2941511798 | 97 |
| 196 | iso_pu_bacteria | 2941515067 | 2941519500 | 97 |
| 197 | iso_pu_bacteria | 2941523033 | 2941527807 | 97 |
| 198 | iso_pu_bacteria | 3005416602 | 3005423433 | 97 |
| 199 | iso_pu_bacteria | 3005483717 | 3005484271 | 97 |
| 200 | iso_pu_bacteria | 3005506211 | 3005507725 | 97 |
| 201 | iso_pu_bacteria | 3005587118 | 3005593927 | 97 |
| 202 | iso_pu_bacteria | 3005594810 | 3005601121 | 97 |
| 203 | iso_pu_bacteria | 3005710791 | 3005716573 | 97 |
| 204 | iso_pu_bacteria | 3005718088 | 3005720209 | 97 |
| 205 | iso_pu_bacteria | 642555113 | 642616217 | 97 |
| 206 | iso_pu_bacteria | 642555113 | 642616235 | 97 |
| 207 | iso_pu_bacteria | 8005314921 | 8005320950 | 97 |
| 208 | iso_pu_bacteria | 8005484373 | 8005486275 | 97 |
| 209 | iso_pu_bacteria | 8006926726 | 8006931089 | 97 |
| 210 | iso_pu_bacteria | 8016583857 | 8016583989 | 97 |
| 211 | iso_pu_bacteria | 8016630954 | 8016634034 | 97 |
| 212 | iso_pu_bacteria | 8019648815 | 8019655188 | 97 |
| 213 | iso_pu_bacteria | 8019687851 | 8019692480 | 97 |
| 214 | iso_pu_bacteria | 8046767195 | 8046772088 | 97 |
| 215 | iso_pu_bacteria | 8055742211 | 8055744337 | 97 |
| 216 | iso_pu_bacteria | 8056967851 | 8056973117 | 97 |
| 217 | 3300002987 | JGI25159J45721_1012046 | JGI25159J45721_10120462 | 99 |
| 218 | 3300003354 | JGI25160J50197_1000298 | JGI25160J50197_100029815 | 99 |
| 219 | 3300003374 | JGI25161J50226_1000221 | JGI25161J50226_100022115 | 99 |
| 220 | 3300003752 | Ga0055539_1021441 | Ga0055539_10214411 | 99 |
| 221 | 3300003790 | Ga0055528_1013537 | Ga0055528_10135372 | 99 |
| 222 | 3300004625 | Ga0055543_1000722 | Ga0055543_100072215 | 99 |
| 223 | 3300005262 | Ga0065165_1000983 | Ga0065165_100098315 | 99 |
| 224 | 3300005434 | Ga0070709_11081111 | Ga0070709_110811111 | 99 |
| 225 | 3300005435 | Ga0070714_100988288 | Ga0070714_1009882882 | 99 |
| 226 | 3300021384 | Ga0213876_10429668 | Ga0213876_104296682 | 99 |
| 227 | 3300025208 | Ga0209436_112329 | Ga0209436_1123292 | 99 |
| 228 | 3300025253 | Ga0209677_100717 | Ga0209677_1007173 | 99 |
| 229 | 3300025254 | Ga0209148_1045304 | Ga0209148_10453041 | 99 |
| 230 | 3300025284 | Ga0209130_1000563 | Ga0209130_100056315 | 99 |
| 231 | 3300025302 | Ga0207426_1000272 | Ga0207426_100027231 | 99 |
| 232 | 3300035695 | Ga0373927_0105480 | Ga0373927_0105480_376_675 | 99 |
| 233 | 3300037853 | Ga0436364_1368094 | Ga0436364_1368094_822_1121 | 99 |
| 234 | 3300039437 | Ga0436365_1912289 | Ga0436365_1912289_340_639 | 99 |
| 235 | 3300044706 | Ga0466964_0495021 | Ga0466964_0495021_340_639 | 99 |
| 236 | 3300044842 | Ga0466957_1004215 | Ga0466957_1004215_232_531 | 99 |
| 237 | 3300048919 | Ga0496116_0113849 | Ga0496116_0113849_983_1282 | 99 |
| 238 | 3300048921 | Ga0496118_0023001 | Ga0496118_0023001_2622_2921 | 99 |
| 239 | 3300048922 | Ga0496119_0055679 | Ga0496119_0055679_613_912 | 99 |
| 240 | 3300048924 | Ga0496121_0092371 | Ga0496121_0092371_1394_1693 | 99 |
| 241 | 3300048928 | Ga0496125_0259627 | Ga0496125_0259627_589_888 | 99 |
| 242 | 3300059491 | Ga0587070_104663 | Ga0587070_104663_57_362 | 99 |
| 243 | 3300059623 | Ga0587101_053278 | Ga0587101_053278_139_438 | 99 |
| 244 | 3300002705 | JGI25156J39149_1000017 | JGI25156J39149_100001788 | 100 |
| 245 | 3300007265 | Ga0099794_10011441 | Ga0099794_100114412 | 100 |
| 246 | 3300007265 | Ga0099794_10087820 | Ga0099794_100878202 | 100 |
| 247 | 3300007788 | Ga0099795_10001608 | Ga0099795_100016085 | 100 |
| 248 | 3300007788 | Ga0099795_10020420 | Ga0099795_100204201 | 100 |
| 249 | 3300007788 | Ga0099795_10077609 | Ga0099795_100776092 | 100 |
| 250 | 3300010159 | Ga0099796_10089406 | Ga0099796_100894062 | 100 |
| 251 | 3300025256 | Ga0209759_1000002 | Ga0209759_1000002678 | 100 |
| 252 | 3300027512 | Ga0209179_1001082 | Ga0209179_10010822 | 100 |
| 253 | 3300027512 | Ga0209179_1066256 | Ga0209179_10662561 | 100 |
| 254 | 3300027671 | Ga0209588_1013761 | Ga0209588_10137612 | 100 |
| 255 | 3300046472 | Ga0495580_0010032 | Ga0495580_0010032_5436_5744 | 100 |
| 256 | 3300046526 | Ga0495666_0160713 | Ga0495666_0160713_719_1021 | 100 |
| 257 | 3300048929 | Ga0496126_0381088 | Ga0496126_0381088_152_460 | 100 |
| 258 | 3300053125 | Ga0500618_000433 | Ga0500618_000433_10392_10748 | 100 |
| 259 | 3300001979 | JGI24740J21852_10001817 | JGI24740J21852_100018172 | 101 |
| 260 | 3300001989 | JGI24739J22299_10013493 | JGI24739J22299_100134932 | 101 |
| 261 | 3300001990 | JGI24737J22298_10003902 | JGI24737J22298_100039025 | 101 |
| 262 | 3300002067 | JGI24735J21928_10021151 | JGI24735J21928_100211512 | 101 |
| 263 | 3300002705 | JGI25156J39149_1001663 | JGI25156J39149_100166310 | 101 |
| 264 | 3300002705 | JGI25156J39149_1001871 | JGI25156J39149_10018716 | 101 |
| 265 | 3300003187 | JGI25151J46595_10000550 | JGI25151J46595_100005505 | 101 |
| 266 | 3300003322 | rootL2_10164238 | rootL2_101642383 | 101 |
| 267 | 3300003323 | rootH1_10008730 | rootH1_100087308 | 101 |
| 268 | 3300003323 | rootH1_10139894 | rootH1_101398943 | 101 |
| 269 | 3300003756 | Ga0055533_1000350 | Ga0055533_100035021 | 101 |
| 270 | 3300003794 | Ga0055531_10002582 | Ga0055531_1000258214 | 101 |
| 271 | 3300005327 | Ga0070658_10952087 | Ga0070658_109520872 | 101 |
| 272 | 3300005339 | Ga0070660_101394939 | Ga0070660_1013949392 | 101 |
| 273 | 3300005340 | Ga0070689_100114738 | Ga0070689_1001147383 | 101 |
| 274 | 3300005354 | Ga0070675_100471348 | Ga0070675_1004713481 | 101 |
| 275 | 3300005366 | Ga0070659_100888519 | Ga0070659_1008885191 | 101 |
| 276 | 3300005366 | Ga0070659_101358312 | Ga0070659_1013583122 | 101 |
| 277 | 3300005434 | Ga0070709_10000309 | Ga0070709_1000030923 | 101 |
| 278 | 3300005434 | Ga0070709_10020857 | Ga0070709_100208573 | 101 |
| 279 | 3300005434 | Ga0070709_10559400 | Ga0070709_105594001 | 101 |
| 280 | 3300005435 | Ga0070714_100217104 | Ga0070714_1002171042 | 101 |
| 281 | 3300005435 | Ga0070714_100222257 | Ga0070714_1002222573 | 101 |
| 282 | 3300005436 | Ga0070713_100037011 | Ga0070713_1000370114 | 101 |
| 283 | 3300005436 | Ga0070713_100292969 | Ga0070713_1002929692 | 101 |
| 284 | 3300005436 | Ga0070713_100647085 | Ga0070713_1006470852 | 101 |
| 285 | 3300005437 | Ga0070710_10001167 | Ga0070710_100011672 | 101 |
| 286 | 3300005437 | Ga0070710_10004223 | Ga0070710_1000422310 | 101 |
| 287 | 3300005437 | Ga0070710_10013557 | Ga0070710_100135572 | 101 |
| 288 | 3300005437 | Ga0070710_10410989 | Ga0070710_104109891 | 101 |
| 289 | 3300005439 | Ga0070711_100010653 | Ga0070711_1000106534 | 101 |
| 290 | 3300005439 | Ga0070711_100021544 | Ga0070711_1000215445 | 101 |
| 291 | 3300005439 | Ga0070711_100081423 | Ga0070711_1000814232 | 101 |
| 292 | 3300005439 | Ga0070711_100124048 | Ga0070711_1001240483 | 101 |
| 293 | 3300005439 | Ga0070711_101692991 | Ga0070711_1016929912 | 101 |
| 294 | 3300005441 | Ga0070700_100337869 | Ga0070700_1003378691 | 101 |
| 295 | 3300005455 | Ga0070663_100425954 | Ga0070663_1004259542 | 101 |
| 296 | 3300005455 | Ga0070663_100614496 | Ga0070663_1006144962 | 101 |
| 297 | 3300005457 | Ga0070662_100858204 | Ga0070662_1008582042 | 101 |
| 298 | 3300005467 | Ga0070706_100814260 | Ga0070706_1008142602 | 101 |
| 299 | 3300005535 | Ga0070684_100638999 | Ga0070684_1006389992 | 101 |
| 300 | 3300005545 | Ga0070695_101891625 | Ga0070695_1018916251 | 101 |
| 301 | 3300005547 | Ga0070693_100317987 | Ga0070693_1003179872 | 101 |
| 302 | 3300005563 | Ga0068855_100284632 | Ga0068855_1002846321 | 101 |
| 303 | 3300005577 | Ga0068857_100197264 | Ga0068857_1001972643 | 101 |
| 304 | 3300005614 | Ga0068856_100128890 | Ga0068856_1001288904 | 101 |
| 305 | 3300005617 | Ga0068859_101314072 | Ga0068859_1013140722 | 101 |
| 306 | 3300005618 | Ga0068864_100387352 | Ga0068864_1003873522 | 101 |
| 307 | 3300005834 | Ga0068851_10234941 | Ga0068851_102349412 | 101 |
| 308 | 3300005841 | Ga0068863_100461630 | Ga0068863_1004616301 | 101 |
| 309 | 3300005843 | Ga0068860_100693407 | Ga0068860_1006934072 | 101 |
| 310 | 3300005981 | Ga0081538_10016822 | Ga0081538_100168224 | 101 |
| 311 | 3300006028 | Ga0070717_10007580 | Ga0070717_100075807 | 101 |
| 312 | 3300006028 | Ga0070717_10240528 | Ga0070717_102405281 | 101 |
| 313 | 3300006028 | Ga0070717_10684349 | Ga0070717_106843491 | 101 |
| 314 | 3300006038 | Ga0075365_10073755 | Ga0075365_100737553 | 101 |
| 315 | 3300006163 | Ga0070715_10005640 | Ga0070715_100056404 | 101 |
| 316 | 3300006163 | Ga0070715_10032299 | Ga0070715_100322992 | 101 |
| 317 | 3300006163 | Ga0070715_10146921 | Ga0070715_101469212 | 101 |
| 318 | 3300006173 | Ga0070716_100007109 | Ga0070716_1000071096 | 101 |
| 319 | 3300006173 | Ga0070716_100129969 | Ga0070716_1001299692 | 101 |
| 320 | 3300006173 | Ga0070716_100213325 | Ga0070716_1002133252 | 101 |
| 321 | 3300006175 | Ga0070712_100009861 | Ga0070712_1000098616 | 101 |
| 322 | 3300006175 | Ga0070712_100011604 | Ga0070712_1000116044 | 101 |
| 323 | 3300006175 | Ga0070712_100029016 | Ga0070712_1000290161 | 101 |
| 324 | 3300006175 | Ga0070712_100045150 | Ga0070712_1000451502 | 101 |
| 325 | 3300006237 | Ga0097621_100348127 | Ga0097621_1003481272 | 101 |
| 326 | 3300006358 | Ga0068871_101860183 | Ga0068871_1018601832 | 101 |
| 327 | 3300006871 | Ga0075434_100167075 | Ga0075434_1001670753 | 101 |
| 328 | 3300006871 | Ga0075434_102377087 | Ga0075434_1023770871 | 101 |
| 329 | 3300006931 | Ga0097620_101314351 | Ga0097620_1013143512 | 101 |
| 330 | 3300006942 | Ga0099824_1040842 | Ga0099824_10408422 | 101 |
| 331 | 3300006944 | Ga0099823_1039281 | Ga0099823_10392813 | 101 |
| 332 | 3300007265 | Ga0099794_10295199 | Ga0099794_102951992 | 101 |
| 333 | 3300007265 | Ga0099794_10381598 | Ga0099794_103815981 | 101 |
| 334 | 3300009011 | Ga0105251_10139745 | Ga0105251_101397452 | 101 |
| 335 | 3300009036 | Ga0105244_10000468 | Ga0105244_1000046820 | 101 |
| 336 | 3300009093 | Ga0105240_10235073 | Ga0105240_102350732 | 101 |
| 337 | 3300009098 | Ga0105245_10182853 | Ga0105245_101828533 | 101 |
| 338 | 3300009101 | Ga0105247_10042412 | Ga0105247_100424124 | 101 |
| 339 | 3300009174 | Ga0105241_10607438 | Ga0105241_106074382 | 101 |
| 340 | 3300009177 | Ga0105248_10454753 | Ga0105248_104547532 | 101 |
| 341 | 3300009545 | Ga0105237_10465240 | Ga0105237_104652402 | 101 |
| 342 | 3300009551 | Ga0105238_10064772 | Ga0105238_100647722 | 101 |
| 343 | 3300009551 | Ga0105238_10075801 | Ga0105238_100758011 | 101 |
| 344 | 3300010159 | Ga0099796_10059630 | Ga0099796_100596301 | 101 |
| 345 | 3300010159 | Ga0099796_10435035 | Ga0099796_104350352 | 101 |
| 346 | 3300010159 | Ga0099796_10481943 | Ga0099796_104819431 | 101 |
| 347 | 3300010375 | Ga0105239_11822689 | Ga0105239_118226891 | 101 |
| 348 | 3300010375 | Ga0105239_11899824 | Ga0105239_118998241 | 101 |
| 349 | 3300011119 | Ga0105246_11487394 | Ga0105246_114873941 | 101 |
| 350 | 3300013100 | Ga0157373_10000815 | Ga0157373_1000081518 | 101 |
| 351 | 3300013102 | Ga0157371_10001033 | Ga0157371_1000103319 | 101 |
| 352 | 3300013105 | Ga0157369_10012954 | Ga0157369_100129549 | 101 |
| 353 | 3300013105 | Ga0157369_10723585 | Ga0157369_107235852 | 101 |
| 354 | 3300013297 | Ga0157378_11230366 | Ga0157378_112303661 | 101 |
| 355 | 3300013306 | Ga0163162_11037884 | Ga0163162_110378842 | 101 |
| 356 | 3300013308 | Ga0157375_10287102 | Ga0157375_102871022 | 101 |
| 357 | 3300014968 | Ga0157379_10084707 | Ga0157379_100847074 | 101 |
| 358 | 3300014969 | Ga0157376_10406748 | Ga0157376_104067482 | 101 |
| 359 | 3300021320 | Ga0214544_1034689 | Ga0214544_10346892 | 101 |
| 360 | 3300021321 | Ga0214542_1025925 | Ga0214542_10259252 | 101 |
| 361 | 3300021358 | Ga0213873_10003859 | Ga0213873_100038592 | 101 |
| 362 | 3300021361 | Ga0213872_10184508 | Ga0213872_101845081 | 101 |
| 363 | 3300021384 | Ga0213876_10002812 | Ga0213876_100028122 | 101 |
| 364 | 3300024225 | Ga0224572_1091922 | Ga0224572_10919221 | 101 |
| 365 | 3300024227 | Ga0228598_1011147 | Ga0228598_10111472 | 101 |
| 366 | 3300024227 | Ga0228598_1022644 | Ga0228598_10226442 | 101 |
| 367 | 3300025226 | Ga0209674_100029 | Ga0209674_100029409 | 101 |
| 368 | 3300025245 | Ga0207425_1085315 | Ga0207425_10853152 | 101 |
| 369 | 3300025256 | Ga0209759_1000002 | Ga0209759_1000002807 | 101 |
| 370 | 3300025256 | Ga0209759_1000236 | Ga0209759_100023652 | 101 |
| 371 | 3300025256 | Ga0209759_1000337 | Ga0209759_100033757 | 101 |
| 372 | 3300025294 | Ga0209025_1000003 | Ga0209025_10000031015 | 101 |
| 373 | 3300025297 | Ga0209758_1000117 | Ga0209758_1000117129 | 101 |
| 374 | 3300025304 | Ga0209257_1001342 | Ga0209257_100134224 | 101 |
| 375 | 3300025321 | Ga0207656_10198954 | Ga0207656_101989541 | 101 |
| 376 | 3300025728 | Ga0207655_1000796 | Ga0207655_100079614 | 101 |
| 377 | 3300025898 | Ga0207692_10015686 | Ga0207692_100156862 | 101 |
| 378 | 3300025898 | Ga0207692_10036819 | Ga0207692_100368193 | 101 |
| 379 | 3300025904 | Ga0207647_10003868 | Ga0207647_100038682 | 101 |
| 380 | 3300025905 | Ga0207685_10148288 | Ga0207685_101482881 | 101 |
| 381 | 3300025906 | Ga0207699_10084143 | Ga0207699_100841433 | 101 |
| 382 | 3300025906 | Ga0207699_10290431 | Ga0207699_102904312 | 101 |
| 383 | 3300025906 | Ga0207699_10499636 | Ga0207699_104996362 | 101 |
| 384 | 3300025906 | Ga0207699_10846995 | Ga0207699_108469951 | 101 |
| 385 | 3300025909 | Ga0207705_11286775 | Ga0207705_112867752 | 101 |
| 386 | 3300025910 | Ga0207684_10506332 | Ga0207684_105063322 | 101 |
| 387 | 3300025911 | Ga0207654_10000362 | Ga0207654_1000036214 | 101 |
| 388 | 3300025911 | Ga0207654_10548332 | Ga0207654_105483322 | 101 |
| 389 | 3300025913 | Ga0207695_10191316 | Ga0207695_101913162 | 101 |
| 390 | 3300025913 | Ga0207695_10338224 | Ga0207695_103382242 | 101 |
| 391 | 3300025913 | Ga0207695_10611894 | Ga0207695_106118942 | 101 |
| 392 | 3300025914 | Ga0207671_10079124 | Ga0207671_100791242 | 101 |
| 393 | 3300025915 | Ga0207693_10011328 | Ga0207693_100113284 | 101 |
| 394 | 3300025915 | Ga0207693_10081498 | Ga0207693_100814982 | 101 |
| 395 | 3300025915 | Ga0207693_10168443 | Ga0207693_101684432 | 101 |
| 396 | 3300025915 | Ga0207693_10209643 | Ga0207693_102096432 | 101 |
| 397 | 3300025915 | Ga0207693_10417560 | Ga0207693_104175601 | 101 |
| 398 | 3300025916 | Ga0207663_10047847 | Ga0207663_100478474 | 101 |
| 399 | 3300025916 | Ga0207663_10060028 | Ga0207663_100600282 | 101 |
| 400 | 3300025916 | Ga0207663_10074772 | Ga0207663_100747723 | 101 |
| 401 | 3300025916 | Ga0207663_11151504 | Ga0207663_111515042 | 101 |
| 402 | 3300025916 | Ga0207663_11366480 | Ga0207663_113664801 | 101 |
| 403 | 3300025922 | Ga0207646_10339748 | Ga0207646_103397482 | 101 |
| 404 | 3300025924 | Ga0207694_10016734 | Ga0207694_100167342 | 101 |
| 405 | 3300025924 | Ga0207694_10158485 | Ga0207694_101584851 | 101 |
| 406 | 3300025928 | Ga0207700_10031909 | Ga0207700_100319092 | 101 |
| 407 | 3300025928 | Ga0207700_10092282 | Ga0207700_100922822 | 101 |
| 408 | 3300025928 | Ga0207700_11859467 | Ga0207700_118594672 | 101 |
| 409 | 3300025929 | Ga0207664_10116087 | Ga0207664_101160872 | 101 |
| 410 | 3300025929 | Ga0207664_10792904 | Ga0207664_107929041 | 101 |
| 411 | 3300025932 | Ga0207690_10762665 | Ga0207690_107626652 | 101 |
| 412 | 3300025933 | Ga0207706_10030566 | Ga0207706_100305662 | 101 |
| 413 | 3300025933 | Ga0207706_10330592 | Ga0207706_103305922 | 101 |
| 414 | 3300025936 | Ga0207670_10263971 | Ga0207670_102639711 | 101 |
| 415 | 3300025938 | Ga0207704_10758862 | Ga0207704_107588622 | 101 |
| 416 | 3300025939 | Ga0207665_10002793 | Ga0207665_100027937 | 101 |
| 417 | 3300025939 | Ga0207665_10026888 | Ga0207665_100268885 | 101 |
| 418 | 3300025939 | Ga0207665_10092455 | Ga0207665_100924553 | 101 |
| 419 | 3300025941 | Ga0207711_10500235 | Ga0207711_105002352 | 101 |
| 420 | 3300025949 | Ga0207667_10137208 | Ga0207667_101372081 | 101 |
| 421 | 3300025949 | Ga0207667_10207562 | Ga0207667_102075623 | 101 |
| 422 | 3300025981 | Ga0207640_11631950 | Ga0207640_116319501 | 101 |
| 423 | 3300025986 | Ga0207658_11060025 | Ga0207658_110600251 | 101 |
| 424 | 3300026035 | Ga0207703_11319029 | Ga0207703_113190291 | 101 |
| 425 | 3300026041 | Ga0207639_10048638 | Ga0207639_100486381 | 101 |
| 426 | 3300026041 | Ga0207639_11992391 | Ga0207639_119923911 | 101 |
| 427 | 3300026067 | Ga0207678_10451630 | Ga0207678_104516302 | 101 |
| 428 | 3300026078 | Ga0207702_10002300 | Ga0207702_1000230014 | 101 |
| 429 | 3300026078 | Ga0207702_10744400 | Ga0207702_107444001 | 101 |
| 430 | 3300026078 | Ga0207702_11742964 | Ga0207702_117429642 | 101 |
| 431 | 3300026088 | Ga0207641_10117961 | Ga0207641_101179612 | 101 |
| 432 | 3300026095 | Ga0207676_10122598 | Ga0207676_101225982 | 101 |
| 433 | 3300026142 | Ga0207698_10097514 | Ga0207698_100975142 | 101 |
| 434 | 3300026142 | Ga0207698_10973588 | Ga0207698_109735882 | 101 |
| 435 | 3300027296 | Ga0209389_1000080 | Ga0209389_100008032 | 101 |
| 436 | 3300027361 | Ga0209489_100027 | Ga0209489_100027139 | 101 |
| 437 | 3300027363 | Ga0209700_100022 | Ga0209700_100022172 | 101 |
| 438 | 3300028380 | Ga0268265_11734371 | Ga0268265_117343711 | 101 |
| 439 | 3300028381 | Ga0268264_10632259 | Ga0268264_106322591 | 101 |
| 440 | 3300030760 | Ga0265762_1019593 | Ga0265762_10195931 | 101 |
| 441 | 3300031090 | Ga0265760_10061805 | Ga0265760_100618051 | 101 |
| 442 | 3300031616 | Ga0307508_10081192 | Ga0307508_100811924 | 101 |
| 443 | 3300031810 | Ga0316044_122064 | Ga0316044_1220642 | 101 |
| 444 | 3300032002 | Ga0307416_100859932 | Ga0307416_1008599321 | 101 |
| 445 | 3300032005 | Ga0307411_10059454 | Ga0307411_100594542 | 101 |
| 446 | 3300035083 | Ga0373926_0103170 | Ga0373926_0103170_295_600 | 101 |
| 447 | 3300035089 | Ga0373944_0371364 | Ga0373944_0371364_23_343 | 101 |
| 448 | 3300035089 | Ga0373944_0393186 | Ga0373944_0393186_148_453 | 101 |
| 449 | 3300035111 | Ga0373923_0004097 | Ga0373923_0004097_3737_4042 | 101 |
| 450 | 3300035111 | Ga0373923_0038177 | Ga0373923_0038177_596_916 | 101 |
| 451 | 3300035113 | Ga0373936_0005167 | Ga0373936_0005167_2668_2973 | 101 |
| 452 | 3300035117 | Ga0373953_0089146 | Ga0373953_0089146_105_425 | 101 |
| 453 | 3300035117 | Ga0373953_0498124 | Ga0373953_0498124_31_336 | 101 |
| 454 | 3300035118 | Ga0373954_0015700 | Ga0373954_0015700_2346_2651 | 101 |
| 455 | 3300035119 | Ga0373956_0107507 | Ga0373956_0107507_542_862 | 101 |
| 456 | 3300035170 | Ga0373943_0023802 | Ga0373943_0023802_438_743 | 101 |
| 457 | 3300035170 | Ga0373943_0107071 | Ga0373943_0107071_524_844 | 101 |
| 458 | 3300035171 | Ga0373946_0066043 | Ga0373946_0066043_316_621 | 101 |
| 459 | 3300035171 | Ga0373946_0540953 | Ga0373946_0540953_218_538 | 101 |
| 460 | 3300035172 | Ga0373955_0007452 | Ga0373955_0007452_3456_3761 | 101 |
| 461 | 3300035172 | Ga0373955_0083223 | Ga0373955_0083223_794_1114 | 101 |
| 462 | 3300035410 | Ga0373924_0034532 | Ga0373924_0034532_955_1275 | 101 |
| 463 | 3300035410 | Ga0373924_0334215 | Ga0373924_0334215_111_416 | 101 |
| 464 | 3300035692 | Ga0373935_0008122 | Ga0373935_0008122_5745_6050 | 101 |
| 465 | 3300035695 | Ga0373927_0009901 | Ga0373927_0009901_5258_5563 | 101 |
| 466 | 3300035695 | Ga0373927_0195739 | Ga0373927_0195739_824_1144 | 101 |
| 467 | 3300035724 | Ga0373933_0050588 | Ga0373933_0050588_2064_2384 | 101 |
| 468 | 3300035724 | Ga0373933_0529282 | Ga0373933_0529282_443_748 | 101 |
| 469 | 3300035725 | Ga0373947_0065286 | Ga0373947_0065286_1825_2145 | 101 |
| 470 | 3300035725 | Ga0373947_0388183 | Ga0373947_0388183_228_533 | 101 |
| 471 | 3300036401 | Ga0373937_0554970 | Ga0373937_0554970_724_1044 | 101 |
| 472 | 3300036459 | Ga0372808_013594 | Ga0372808_013594_751_1056 | 101 |
| 473 | 3300037068 | Ga0373925_0019566 | Ga0373925_0019566_3955_4260 | 101 |
| 474 | 3300037068 | Ga0373925_0203234 | Ga0373925_0203234_394_714 | 101 |
| 475 | 3300039437 | Ga0436365_0160289 | Ga0436365_0160289_31998_32345 | 101 |
| 476 | 3300039438 | Ga0436360_0890401 | Ga0436360_0890401_672_977 | 101 |
| 477 | 3300039438 | Ga0436360_1291016 | Ga0436360_1291016_456_761 | 101 |
| 478 | 3300039447 | Ga0436361_0566172 | Ga0436361_0566172_765_1070 | 101 |
| 479 | 3300039447 | Ga0436361_0836406 | Ga0436361_0836406_442_747 | 101 |
| 480 | 3300039450 | Ga0436363_1452198 | Ga0436363_1452198_939_1268 | 101 |
| 481 | 3300039450 | Ga0436363_1475395 | Ga0436363_1475395_17_364 | 101 |
| 482 | 3300039453 | Ga0436362_0489956 | Ga0436362_0489956_793_1098 | 101 |
| 483 | 3300039453 | Ga0436362_0770136 | Ga0436362_0770136_3198_3545 | 101 |
| 484 | 3300041491 | Ga0451833_1246459 | Ga0451833_1246459_2532_2849 | 101 |
| 485 | 3300041498 | Ga0451841_0877529 | Ga0451841_0877529_159_476 | 101 |
| 486 | 3300041505 | Ga0451849_0736014 | Ga0451849_0736014_273_590 | 101 |
| 487 | 3300041509 | Ga0451843_1550113 | Ga0451843_1550113_7259_7576 | 101 |
| 488 | 3300041511 | Ga0451855_1172457 | Ga0451855_1172457_1699_2016 | 101 |
| 489 | 3300041512 | Ga0451853_3260269 | Ga0451853_3260269_572_889 | 101 |
| 490 | 3300046455 | Ga0495603_0000056 | Ga0495603_0000056_38070_38381 | 101 |
| 491 | 3300046455 | Ga0495603_0775891 | Ga0495603_0775891_203_508 | 101 |
| 492 | 3300046459 | Ga0495629_0166935 | Ga0495629_0166935_197_508 | 101 |
| 493 | 3300046459 | Ga0495629_0757142 | Ga0495629_0757142_215_535 | 101 |
| 494 | 3300046461 | Ga0495641_0074761 | Ga0495641_0074761_848_1159 | 101 |
| 495 | 3300046462 | Ga0495651_0085513 | Ga0495651_0085513_652_1005 | 101 |
| 496 | 3300046462 | Ga0495651_0301193 | Ga0495651_0301193_674_985 | 101 |
| 497 | 3300046463 | Ga0495653_0000565 | Ga0495653_0000565_19314_19625 | 101 |
| 498 | 3300046471 | Ga0495650_0235831 | Ga0495650_0235831_166_477 | 101 |
| 499 | 3300046472 | Ga0495580_0000168 | Ga0495580_0000168_38070_38381 | 101 |
| 500 | 3300046472 | Ga0495580_0026124 | Ga0495580_0026124_3110_3415 | 101 |
| 501 | 3300046472 | Ga0495580_0044002 | Ga0495580_0044002_2260_2565 | 101 |
| 502 | 3300046472 | Ga0495580_0248547 | Ga0495580_0248547_811_1131 | 101 |
| 503 | 3300046473 | Ga0495582_0001687 | Ga0495582_0001687_11119_11430 | 101 |
| 504 | 3300046473 | Ga0495582_0254837 | Ga0495582_0254837_111_431 | 101 |
| 505 | 3300046477 | Ga0495664_0001243 | Ga0495664_0001243_8364_8669 | 101 |
| 506 | 3300046477 | Ga0495664_0017641 | Ga0495664_0017641_2078_2389 | 101 |
| 507 | 3300046477 | Ga0495664_0110249 | Ga0495664_0110249_887_1240 | 101 |
| 508 | 3300046499 | Ga0495594_0532022 | Ga0495594_0532022_334_639 | 101 |
| 509 | 3300046507 | Ga0495606_0000336 | Ga0495606_0000336_25119_25463 | 101 |
| 510 | 3300046514 | Ga0495618_0032338 | Ga0495618_0032338_2065_2370 | 101 |
| 511 | 3300046514 | Ga0495618_0314594 | Ga0495618_0314594_173_484 | 101 |
| 512 | 3300046514 | Ga0495618_0582919 | Ga0495618_0582919_270_590 | 101 |
| 513 | 3300046516 | Ga0495628_0000751 | Ga0495628_0000751_19230_19541 | 101 |
| 514 | 3300046517 | Ga0495630_0000363 | Ga0495630_0000363_16537_16848 | 101 |
| 515 | 3300046517 | Ga0495630_0174892 | Ga0495630_0174892_947_1252 | 101 |
| 516 | 3300046517 | Ga0495630_0344247 | Ga0495630_0344247_569_889 | 101 |
| 517 | 3300046524 | Ga0495648_0026396 | Ga0495648_0026396_1053_1364 | 101 |
| 518 | 3300046526 | Ga0495666_0002570 | Ga0495666_0002570_5967_6278 | 101 |
| 519 | 3300046529 | Ga0495652_0001008 | Ga0495652_0001008_20360_20671 | 101 |
| 520 | 3300046529 | Ga0495652_0166641 | Ga0495652_0166641_428_733 | 101 |
| 521 | 3300046531 | Ga0495665_0000136 | Ga0495665_0000136_19090_19401 | 101 |
| 522 | 3300046531 | Ga0495665_0454245 | Ga0495665_0454245_158_478 | 101 |
| 523 | 3300046533 | Ga0495640_0066347 | Ga0495640_0066347_248_553 | 101 |
| 524 | 3300046533 | Ga0495640_0086301 | Ga0495640_0086301_1551_1862 | 101 |
| 525 | 3300046533 | Ga0495640_0522358 | Ga0495640_0522358_67_387 | 101 |
| 526 | 3300046535 | Ga0495586_0000085 | Ga0495586_0000085_38066_38377 | 101 |
| 527 | 3300046535 | Ga0495586_0165821 | Ga0495586_0165821_377_697 | 101 |
| 528 | 3300046536 | Ga0495587_0166837 | Ga0495587_0166837_587_898 | 101 |
| 529 | 3300046536 | Ga0495587_0454631 | Ga0495587_0454631_74_427 | 101 |
| 530 | 3300046543 | Ga0495645_0009496 | Ga0495645_0009496_2153_2464 | 101 |
| 531 | 3300046543 | Ga0495645_0087702 | Ga0495645_0087702_1886_2191 | 101 |
| 532 | 3300046559 | Ga0495667_0403876 | Ga0495667_0403876_482_787 | 101 |
| 533 | 3300046642 | Ga0495634_0013184 | Ga0495634_0013184_5448_5759 | 101 |
| 534 | 3300046642 | Ga0495634_0043876 | Ga0495634_0043876_522_827 | 101 |
| 535 | 3300046642 | Ga0495634_0637123 | Ga0495634_0637123_219_539 | 101 |
| 536 | 3300046663 | Ga0495635_0023765 | Ga0495635_0023765_1020_1331 | 101 |
| 537 | 3300046663 | Ga0495635_0278202 | Ga0495635_0278202_229_534 | 101 |
| 538 | 3300046665 | Ga0495661_0019607 | Ga0495661_0019607_1019_1330 | 101 |
| 539 | 3300046674 | Ga0495588_0092810 | Ga0495588_0092810_1023_1334 | 101 |
| 540 | 3300046678 | Ga0495599_0243958 | Ga0495599_0243958_753_1058 | 101 |
| 541 | 3300046679 | Ga0495623_0087908 | Ga0495623_0087908_984_1337 | 101 |
| 542 | 3300046679 | Ga0495623_0527807 | Ga0495623_0527807_264_584 | 101 |
| 543 | 3300046680 | Ga0495646_0002579 | Ga0495646_0002579_2470_2781 | 101 |
| 544 | 3300046680 | Ga0495646_0165559 | Ga0495646_0165559_830_1135 | 101 |
| 545 | 3300046683 | Ga0495658_0463004 | Ga0495658_0463004_463_768 | 101 |
| 546 | 3300046689 | Ga0495613_0002504 | Ga0495613_0002504_4800_5111 | 101 |
| 547 | 3300046689 | Ga0495613_0231948 | Ga0495613_0231948_408_713 | 101 |
| 548 | 3300046689 | Ga0495613_1041303 | Ga0495613_1041303_120_473 | 101 |
| 549 | 3300046690 | Ga0495624_0000306 | Ga0495624_0000306_19090_19401 | 101 |
| 550 | 3300046690 | Ga0495624_0079537 | Ga0495624_0079537_1541_1846 | 101 |
| 551 | 3300046794 | Ga0495589_0071308 | Ga0495589_0071308_36_347 | 101 |
| 552 | 3300046809 | Ga0495600_0044952 | Ga0495600_0044952_2337_2690 | 101 |
| 553 | 3300047315 | Ga0495581_0000036 | Ga0495581_0000036_11789_12100 | 101 |
| 554 | 3300047315 | Ga0495581_0071514 | Ga0495581_0071514_156_476 | 101 |
| 555 | 3300047315 | Ga0495581_0463741 | Ga0495581_0463741_20_325 | 101 |
| 556 | 3300047317 | Ga0495604_0083044 | Ga0495604_0083044_148_459 | 101 |
| 557 | 3300047319 | Ga0495674_0000195 | Ga0495674_0000195_38070_38381 | 101 |
| 558 | 3300047319 | Ga0495674_0064031 | Ga0495674_0064031_304_609 | 101 |
| 559 | 3300047321 | Ga0495676_0001536 | Ga0495676_0001536_10394_10705 | 101 |
| 560 | 3300047321 | Ga0495676_0556585 | Ga0495676_0556585_417_722 | 101 |
| 561 | 3300047322 | Ga0495680_0001470 | Ga0495680_0001470_4886_5197 | 101 |
| 562 | 3300047322 | Ga0495680_0080895 | Ga0495680_0080895_1568_1921 | 101 |
| 563 | 3300047444 | Ga0495675_0533212 | Ga0495675_0533212_318_623 | 101 |
| 564 | 3300047444 | Ga0495675_0651765 | Ga0495675_0651765_206_511 | 101 |
| 565 | 3300047446 | Ga0495679_000238 | Ga0495679_000238_10367_10678 | 101 |
| 566 | 3300047469 | Ga0495673_0028253 | Ga0495673_0028253_939_1250 | 101 |
| 567 | 3300047471 | Ga0495684_0005368 | Ga0495684_0005368_6841_7146 | 101 |
| 568 | 3300047472 | Ga0495686_0000099 | Ga0495686_0000099_21601_21912 | 101 |
| 569 | 3300047472 | Ga0495686_0285813 | Ga0495686_0285813_318_662 | 101 |
| 570 | 3300047673 | Ga0495593_0022654 | Ga0495593_0022654_378_683 | 101 |
| 571 | 3300047673 | Ga0495593_0045278 | Ga0495593_0045278_611_922 | 101 |
| 572 | 3300047673 | Ga0495593_0047254 | Ga0495593_0047254_584_904 | 101 |
| 573 | 3300048088 | Ga0495602_0004569 | Ga0495602_0004569_11528_11839 | 101 |
| 574 | 3300048089 | Ga0495614_0000233 | Ga0495614_0000233_20405_20716 | 101 |
| 575 | 3300048903 | Ga0496100_0281747 | Ga0496100_0281747_138_443 | 101 |
| 576 | 3300048903 | Ga0496100_1187024 | Ga0496100_1187024_87_431 | 101 |
| 577 | 3300048904 | Ga0496101_0048177 | Ga0496101_0048177_1063_1368 | 101 |
| 578 | 3300048905 | Ga0496102_0625834 | Ga0496102_0625834_427_732 | 101 |
| 579 | 3300048906 | Ga0496103_0659791 | Ga0496103_0659791_337_642 | 101 |
| 580 | 3300048907 | Ga0496104_0009152 | Ga0496104_0009152_497_802 | 101 |
| 581 | 3300048908 | Ga0496105_0010297 | Ga0496105_0010297_2018_2323 | 101 |
| 582 | 3300048909 | Ga0496106_0024365 | Ga0496106_0024365_3763_4068 | 101 |
| 583 | 3300048909 | Ga0496106_0876112 | Ga0496106_0876112_115_420 | 101 |
| 584 | 3300048910 | Ga0496107_0030034 | Ga0496107_0030034_1490_1795 | 101 |
| 585 | 3300048911 | Ga0496108_0051828 | Ga0496108_0051828_1796_2101 | 101 |
| 586 | 3300048912 | Ga0496109_0081697 | Ga0496109_0081697_822_1127 | 101 |
| 587 | 3300048913 | Ga0496110_0014579 | Ga0496110_0014579_5980_6285 | 101 |
| 588 | 3300048914 | Ga0496111_0185947 | Ga0496111_0185947_729_1034 | 101 |
| 589 | 3300048915 | Ga0496112_0006351 | Ga0496112_0006351_6116_6421 | 101 |
| 590 | 3300048916 | Ga0496113_0019439 | Ga0496113_0019439_1540_1845 | 101 |
| 591 | 3300048918 | Ga0496115_0134215 | Ga0496115_0134215_1392_1697 | 101 |
| 592 | 3300048920 | Ga0496117_0419418 | Ga0496117_0419418_177_488 | 101 |
| 593 | 3300048921 | Ga0496118_0539311 | Ga0496118_0539311_256_561 | 101 |
| 594 | 3300048923 | Ga0496120_0438914 | Ga0496120_0438914_180_491 | 101 |
| 595 | 3300048924 | Ga0496121_0033391 | Ga0496121_0033391_2759_3103 | 101 |
| 596 | 3300048924 | Ga0496121_0099508 | Ga0496121_0099508_1419_1730 | 101 |
| 597 | 3300048924 | Ga0496121_0192717 | Ga0496121_0192717_391_702 | 101 |
| 598 | 3300048924 | Ga0496121_0370110 | Ga0496121_0370110_133_444 | 101 |
| 599 | 3300048924 | Ga0496121_0432539 | Ga0496121_0432539_24_329 | 101 |
| 600 | 3300048926 | Ga0496123_0196366 | Ga0496123_0196366_20_325 | 101 |
| 601 | 3300048928 | Ga0496125_0012354 | Ga0496125_0012354_7753_8058 | 101 |
| 602 | 3300048929 | Ga0496126_0000511 | Ga0496126_0000511_48462_48773 | 101 |
| 603 | 3300048929 | Ga0496126_0000511 | Ga0496126_0000511_59794_60105 | 101 |
| 604 | 3300048929 | Ga0496126_0028256 | Ga0496126_0028256_2700_3011 | 101 |
| 605 | 3300048929 | Ga0496126_0272720 | Ga0496126_0272720_95_400 | 101 |
| 606 | 3300048929 | Ga0496126_0319356 | Ga0496126_0319356_557_868 | 101 |
| 607 | 3300049460 | Ga0495682_0009173 | Ga0495682_0009173_340_651 | 101 |
| 608 | 3300049568 | Ga0501031_0385074 | Ga0501031_0385074_490_816 | 101 |
| 609 | 3300049584 | Ga0501068_1203868 | Ga0501068_1203868_97_423 | 101 |
| 610 | 3300050492 | nmdc:mga0yw44_65385_c1 | nmdc:mga0yw44_65385_c1_1084_1437 | 101 |
| 611 | 3300053077 | Ga0495601_0232591 | Ga0495601_0232591_677_982 | 101 |
| 612 | 3300053078 | Ga0495612_0540813 | Ga0495612_0540813_98_403 | 101 |
| 613 | 3300053177 | Ga0500636_0541021 | Ga0500636_0541021_82_390 | 101 |
| 614 | 3300053737 | Ga0500601_012568 | Ga0500601_012568_96_401 | 101 |
| 615 | 3300059490 | Ga0587066_219825 | Ga0587066_219825_142_447 | 101 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar