F469492
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 615 | 333 | 615 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300053117|Ga0500593_001653|Ga0500593_001653_4882_5292 |
| Length | 136 |
| Sequence | MTTYTSPLATPGASALMQAKQQVNQSLLAQMSPSASKYEAKAKATAQDFEAVFLNQMFQQMFTGINGEGPFGGGPGVGVWRSFLTDEYAKSFAKAGGVGIGDQVYRELIARQSAQTMKAMSAIASKAYAPTAGATP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 184 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 214 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 215 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 319 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 320 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 322 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 324 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 325 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 326 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 327 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 330 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.5 |
| Nodule | 0 |
| Rhizoplane | 5.85 |
| Rhizosphere | 85.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10176943 | 3300003320 | Bacteria | 1144 |
| 2 | JGI25404J52841_10019331 | 3300003659 | Bacteria | 1476 |
| 3 | Ga0070658_10191871 | 3300005327 | Bacteria | 1722 |
| 4 | Ga0070683_100024294 | 3300005329 | Bacteria | 5426 |
| 5 | Ga0070690_100015961 | 3300005330 | Bacteria | 4489 |
| 6 | Ga0070670_100227913 | 3300005331 | Bacteria | 1621 |
| 7 | Ga0068869_100177526 | 3300005334 | Bacteria | 1668 |
| 8 | Ga0070666_10001845 | 3300005335 | Bacteria | 12909 |
| 9 | Ga0070680_100057441 | 3300005336 | Bacteria | 3181 |
| 10 | Ga0070680_100147989 | 3300005336 | Bacteria | 1971 |
| 11 | Ga0070680_100481513 | 3300005336 | Bacteria | 1061 |
| 12 | Ga0070680_100641908 | 3300005336 | Bacteria | 912 |
| 13 | Ga0070682_100005374 | 3300005337 | Bacteria | 7128 |
| 14 | Ga0070682_101300168 | 3300005337 | Unclassified | 618 |
| 15 | Ga0068868_100062889 | 3300005338 | Bacteria | 2943 |
| 16 | Ga0070660_100123815 | 3300005339 | Bacteria | 2065 |
| 17 | Ga0070660_100134875 | 3300005339 | Bacteria | 1978 |
| 18 | Ga0070660_101246996 | 3300005339 | Bacteria | 631 |
| 19 | Ga0070689_100028158 | 3300005340 | Bacteria | 4245 |
| 20 | Ga0070691_10030524 | 3300005341 | Bacteria | 2524 |
| 21 | Ga0070691_10191087 | 3300005341 | Bacteria | 1071 |
| 22 | Ga0070661_100029342 | 3300005344 | Bacteria | 3969 |
| 23 | Ga0070661_100194517 | 3300005344 | Bacteria | 1548 |
| 24 | Ga0070668_101345143 | 3300005347 | Bacteria | 650 |
| 25 | Ga0070669_101683074 | 3300005353 | Bacteria | 553 |
| 26 | Ga0070671_100012503 | 3300005355 | Bacteria | 6836 |
| 27 | Ga0070671_100030107 | 3300005355 | Bacteria | 4479 |
| 28 | Ga0070674_100312877 | 3300005356 | Bacteria | 1256 |
| 29 | Ga0070674_100759777 | 3300005356 | Bacteria | 834 |
| 30 | Ga0070674_100767620 | 3300005356 | Unclassified | 830 |
| 31 | Ga0070673_100015672 | 3300005364 | Bacteria | 5333 |
| 32 | Ga0070673_100423709 | 3300005364 | Bacteria | 1194 |
| 33 | Ga0070688_100050062 | 3300005365 | Bacteria | 2602 |
| 34 | Ga0070659_100125952 | 3300005366 | Bacteria | 2078 |
| 35 | Ga0070659_101690328 | 3300005366 | Bacteria | 566 |
| 36 | Ga0070667_100004611 | 3300005367 | Bacteria | 11574 |
| 37 | Ga0070667_100422221 | 3300005367 | Bacteria | 1216 |
| 38 | Ga0070709_10000798 | 3300005434 | Bacteria | 17596 |
| 39 | Ga0070709_10833557 | 3300005434 | Bacteria | 726 |
| 40 | Ga0070714_100012792 | 3300005435 | Bacteria | 6706 |
| 41 | Ga0070713_100000542 | 3300005436 | Bacteria | 23949 |
| 42 | Ga0070713_100647088 | 3300005436 | Bacteria | 1006 |
| 43 | Ga0070710_10248491 | 3300005437 | Bacteria | 1142 |
| 44 | Ga0070711_100006269 | 3300005439 | Bacteria | 7165 |
| 45 | Ga0070705_100175597 | 3300005440 | Bacteria | 1446 |
| 46 | Ga0070705_100965166 | 3300005440 | Bacteria | 690 |
| 47 | Ga0070694_101688235 | 3300005444 | Bacteria | 539 |
| 48 | Ga0070663_100001077 | 3300005455 | Bacteria | 14953 |
| 49 | Ga0070663_100008134 | 3300005455 | Bacteria | 6433 |
| 50 | Ga0070663_101602072 | 3300005455 | Bacteria | 581 |
| 51 | Ga0070678_100003061 | 3300005456 | Bacteria | 9268 |
| 52 | Ga0070678_100005803 | 3300005456 | Bacteria | 7184 |
| 53 | Ga0070662_100085546 | 3300005457 | Bacteria | 2357 |
| 54 | Ga0070662_100380281 | 3300005457 | Bacteria | 1162 |
| 55 | Ga0070662_100425524 | 3300005457 | Bacteria | 1099 |
| 56 | Ga0070681_10023237 | 3300005458 | Bacteria | 6233 |
| 57 | Ga0070681_10030981 | 3300005458 | Bacteria | 5369 |
| 58 | Ga0070681_10104130 | 3300005458 | Bacteria | 2780 |
| 59 | Ga0070681_10290090 | 3300005458 | Bacteria | 1546 |
| 60 | Ga0070681_10954326 | 3300005458 | Bacteria | 777 |
| 61 | Ga0070681_11718537 | 3300005458 | Bacteria | 554 |
| 62 | Ga0068867_100145840 | 3300005459 | Bacteria | 1855 |
| 63 | Ga0070685_10062073 | 3300005466 | Bacteria | 2190 |
| 64 | Ga0070685_10223530 | 3300005466 | Bacteria | 1235 |
| 65 | Ga0070679_100007329 | 3300005530 | Bacteria | 10305 |
| 66 | Ga0070679_100034212 | 3300005530 | Bacteria | 5035 |
| 67 | Ga0070679_100228645 | 3300005530 | Bacteria | 1820 |
| 68 | Ga0070679_100889898 | 3300005530 | Bacteria | 834 |
| 69 | Ga0070684_100165058 | 3300005535 | Bacteria | 2010 |
| 70 | Ga0070684_100440138 | 3300005535 | Bacteria | 1204 |
| 71 | Ga0070697_100243808 | 3300005536 | Bacteria | 1535 |
| 72 | Ga0070697_101478042 | 3300005536 | Bacteria | 607 |
| 73 | Ga0068853_100446759 | 3300005539 | Bacteria | 1216 |
| 74 | Ga0068853_101460441 | 3300005539 | Bacteria | 662 |
| 75 | Ga0070686_100022150 | 3300005544 | Bacteria | 3782 |
| 76 | Ga0070686_100498409 | 3300005544 | Bacteria | 945 |
| 77 | Ga0070695_100086031 | 3300005545 | Bacteria | 2088 |
| 78 | Ga0070696_100062647 | 3300005546 | Bacteria | 2604 |
| 79 | Ga0070693_100074436 | 3300005547 | Bacteria | 2009 |
| 80 | Ga0070693_100290881 | 3300005547 | Bacteria | 1097 |
| 81 | Ga0070693_100444723 | 3300005547 | Bacteria | 908 |
| 82 | Ga0070665_100058836 | 3300005548 | Bacteria | 3852 |
| 83 | Ga0070665_100286928 | 3300005548 | Bacteria | 1648 |
| 84 | Ga0070665_100508866 | 3300005548 | Bacteria | 1216 |
| 85 | Ga0068855_100212502 | 3300005563 | Bacteria | 2173 |
| 86 | Ga0070664_100059899 | 3300005564 | Bacteria | 3240 |
| 87 | Ga0070664_100359794 | 3300005564 | Bacteria | 1325 |
| 88 | Ga0070664_101196803 | 3300005564 | Unclassified | 717 |
| 89 | Ga0068854_100907371 | 3300005578 | Bacteria | 775 |
| 90 | Ga0068856_100230628 | 3300005614 | Bacteria | 1867 |
| 91 | Ga0068856_100895798 | 3300005614 | Bacteria | 906 |
| 92 | Ga0070702_100011277 | 3300005615 | Bacteria | 4439 |
| 93 | Ga0070702_100328882 | 3300005615 | Bacteria | 1068 |
| 94 | Ga0068852_101532930 | 3300005616 | Bacteria | 689 |
| 95 | Ga0068859_100008370 | 3300005617 | Bacteria | 10482 |
| 96 | Ga0068864_100001336 | 3300005618 | Bacteria | 20519 |
| 97 | Ga0068866_10400484 | 3300005718 | Bacteria | 885 |
| 98 | Ga0068866_10767941 | 3300005718 | Bacteria | 667 |
| 99 | Ga0068861_100870147 | 3300005719 | Bacteria | 851 |
| 100 | Ga0068861_101176745 | 3300005719 | Bacteria | 740 |
| 101 | Ga0068863_100116063 | 3300005841 | Bacteria | 2551 |
| 102 | Ga0068858_100015809 | 3300005842 | Bacteria | 7097 |
| 103 | Ga0068858_100818922 | 3300005842 | Bacteria | 909 |
| 104 | Ga0068860_100044761 | 3300005843 | Bacteria | 4217 |
| 105 | Ga0081455_10568086 | 3300005937 | Bacteria | 746 |
| 106 | Ga0081540_1000003 | 3300005983 | Bacteria | 233942 |
| 107 | Ga0081540_1018027 | 3300005983 | Bacteria | 4346 |
| 108 | Ga0070717_10000891 | 3300006028 | Bacteria | 19776 |
| 109 | Ga0070717_10386848 | 3300006028 | Bacteria | 1255 |
| 110 | Ga0075368_10019793 | 3300006042 | Bacteria | 2542 |
| 111 | Ga0075368_10328764 | 3300006042 | Bacteria | 663 |
| 112 | Ga0075363_100103151 | 3300006048 | Bacteria | 1580 |
| 113 | Ga0075363_100134699 | 3300006048 | Bacteria | 1387 |
| 114 | Ga0070715_10000188 | 3300006163 | Bacteria | 14371 |
| 115 | Ga0070716_100000070 | 3300006173 | Bacteria | 39635 |
| 116 | Ga0070712_100019782 | 3300006175 | Bacteria | 4397 |
| 117 | Ga0070712_100139521 | 3300006175 | Bacteria | 1848 |
| 118 | Ga0075367_10073816 | 3300006178 | Bacteria | 2056 |
| 119 | Ga0075367_10177133 | 3300006178 | Bacteria | 1329 |
| 120 | Ga0075369_10054146 | 3300006186 | Bacteria | 1742 |
| 121 | Ga0075366_10082514 | 3300006195 | Bacteria | 1921 |
| 122 | Ga0075366_10125959 | 3300006195 | Bacteria | 1545 |
| 123 | Ga0097621_100006935 | 3300006237 | Bacteria | 8064 |
| 124 | Ga0097621_100007158 | 3300006237 | Bacteria | 7953 |
| 125 | Ga0097621_100796151 | 3300006237 | Bacteria | 876 |
| 126 | Ga0097621_101014763 | 3300006237 | Bacteria | 776 |
| 127 | Ga0075370_10139729 | 3300006353 | Bacteria | 1416 |
| 128 | Ga0075370_10538698 | 3300006353 | Bacteria | 706 |
| 129 | Ga0075370_10615018 | 3300006353 | Bacteria | 658 |
| 130 | Ga0068871_100005085 | 3300006358 | Bacteria | 9186 |
| 131 | Ga0068871_100165352 | 3300006358 | Bacteria | 1894 |
| 132 | Ga0068871_100437986 | 3300006358 | Bacteria | 1170 |
| 133 | Ga0075431_100246250 | 3300006847 | Bacteria | 1817 |
| 134 | Ga0075431_100307907 | 3300006847 | Bacteria | 1599 |
| 135 | Ga0075433_10418975 | 3300006852 | Bacteria | 1181 |
| 136 | Ga0075434_100099484 | 3300006871 | Bacteria | 2914 |
| 137 | Ga0075434_100159186 | 3300006871 | Bacteria | 2278 |
| 138 | Ga0075434_101539846 | 3300006871 | Bacteria | 674 |
| 139 | Ga0075429_101436094 | 3300006880 | Bacteria | 601 |
| 140 | Ga0068865_100002800 | 3300006881 | Bacteria | 10366 |
| 141 | Ga0068865_100197497 | 3300006881 | Bacteria | 1560 |
| 142 | Ga0075436_101248250 | 3300006914 | Bacteria | 561 |
| 143 | Ga0097620_100008370 | 3300006931 | Bacteria | 10482 |
| 144 | Ga0075435_100133897 | 3300007076 | Bacteria | 2075 |
| 145 | Ga0075435_100756761 | 3300007076 | Bacteria | 845 |
| 146 | Ga0075435_101248181 | 3300007076 | Bacteria | 650 |
| 147 | Ga0075435_101373399 | 3300007076 | Bacteria | 619 |
| 148 | Ga0099795_10186762 | 3300007788 | Bacteria | 868 |
| 149 | Ga0105251_10014272 | 3300009011 | Bacteria | 4404 |
| 150 | Ga0105250_10293755 | 3300009092 | Bacteria | 701 |
| 151 | Ga0105240_10631185 | 3300009093 | Bacteria | 1176 |
| 152 | Ga0105240_11475007 | 3300009093 | Bacteria | 714 |
| 153 | Ga0105245_10850549 | 3300009098 | Bacteria | 952 |
| 154 | Ga0105245_10889542 | 3300009098 | Bacteria | 932 |
| 155 | Ga0105245_11992105 | 3300009098 | Bacteria | 634 |
| 156 | Ga0105245_12013683 | 3300009098 | Bacteria | 631 |
| 157 | Ga0105247_10167680 | 3300009101 | Bacteria | 1458 |
| 158 | Ga0105247_10257587 | 3300009101 | Bacteria | 1195 |
| 159 | Ga0114129_10535068 | 3300009147 | Bacteria | 1526 |
| 160 | Ga0105243_10064491 | 3300009148 | Bacteria | 2940 |
| 161 | Ga0105243_10179160 | 3300009148 | Bacteria | 1842 |
| 162 | Ga0105241_10173175 | 3300009174 | Bacteria | 1784 |
| 163 | Ga0105241_10193833 | 3300009174 | Bacteria | 1693 |
| 164 | Ga0105242_10009490 | 3300009176 | Bacteria | 7457 |
| 165 | Ga0105242_10089852 | 3300009176 | Bacteria | 2582 |
| 166 | Ga0105242_10667567 | 3300009176 | Bacteria | 1013 |
| 167 | Ga0105248_10037690 | 3300009177 | Bacteria | 5409 |
| 168 | Ga0105248_11055547 | 3300009177 | Bacteria | 918 |
| 169 | Ga0105237_10064619 | 3300009545 | Bacteria | 3655 |
| 170 | Ga0105238_10123111 | 3300009551 | Bacteria | 2573 |
| 171 | Ga0105238_10695695 | 3300009551 | Bacteria | 1028 |
| 172 | Ga0105238_11654328 | 3300009551 | Bacteria | 671 |
| 173 | Ga0105249_10137916 | 3300009553 | Bacteria | 2336 |
| 174 | Ga0105249_12301432 | 3300009553 | Bacteria | 612 |
| 175 | Ga0105239_10507042 | 3300010375 | Bacteria | 1372 |
| 176 | Ga0105239_12154885 | 3300010375 | Bacteria | 648 |
| 177 | Ga0105246_10101648 | 3300011119 | Bacteria | 2094 |
| 178 | Ga0157323_1000389 | 3300012495 | Bacteria | 1941 |
| 179 | Ga0157370_10746637 | 3300013104 | Bacteria | 892 |
| 180 | Ga0157369_10975958 | 3300013105 | Bacteria | 868 |
| 181 | Ga0157374_10153623 | 3300013296 | Bacteria | 2239 |
| 182 | Ga0157374_10320240 | 3300013296 | Bacteria | 1536 |
| 183 | Ga0157378_10064887 | 3300013297 | Bacteria | 3267 |
| 184 | Ga0157378_13039760 | 3300013297 | Bacteria | 521 |
| 185 | Ga0163162_10082383 | 3300013306 | Bacteria | 3289 |
| 186 | Ga0163162_12278961 | 3300013306 | Bacteria | 622 |
| 187 | Ga0157372_13017437 | 3300013307 | Unclassified | 538 |
| 188 | Ga0157375_10110412 | 3300013308 | Bacteria | 2847 |
| 189 | Ga0157375_10632575 | 3300013308 | Bacteria | 1227 |
| 190 | Ga0163163_10325815 | 3300014325 | Bacteria | 1590 |
| 191 | Ga0157380_11091251 | 3300014326 | Bacteria | 837 |
| 192 | Ga0157380_12905008 | 3300014326 | Bacteria | 545 |
| 193 | Ga0182008_10529302 | 3300014497 | Bacteria | 652 |
| 194 | Ga0157377_10298185 | 3300014745 | Bacteria | 1063 |
| 195 | Ga0157379_10013763 | 3300014968 | Bacteria | 7091 |
| 196 | Ga0157379_11388392 | 3300014968 | Bacteria | 680 |
| 197 | Ga0157376_10031023 | 3300014969 | Bacteria | 4275 |
| 198 | Ga0157376_10309177 | 3300014969 | Bacteria | 1499 |
| 199 | Ga0157376_12510475 | 3300014969 | Bacteria | 555 |
| 200 | Ga0163161_10888949 | 3300017792 | Bacteria | 754 |
| 201 | Ga0213874_10158240 | 3300021377 | Bacteria | 794 |
| 202 | Ga0213876_10042234 | 3300021384 | Bacteria | 2409 |
| 203 | Ga0213876_10106412 | 3300021384 | Bacteria | 1488 |
| 204 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 205 | Ga0207713_1235890 | 3300025735 | Unclassified | 545 |
| 206 | Ga0207692_10001836 | 3300025898 | Bacteria | 8067 |
| 207 | Ga0207642_10249287 | 3300025899 | Bacteria | 1007 |
| 208 | Ga0207710_10065884 | 3300025900 | Bacteria | 1652 |
| 209 | Ga0207710_10078216 | 3300025900 | Bacteria | 1530 |
| 210 | Ga0207680_10016289 | 3300025903 | Bacteria | 3899 |
| 211 | Ga0207680_10704822 | 3300025903 | Bacteria | 723 |
| 212 | Ga0207685_10036983 | 3300025905 | Bacteria | 1794 |
| 213 | Ga0207685_10054294 | 3300025905 | Bacteria | 1560 |
| 214 | Ga0207685_10364049 | 3300025905 | Bacteria | 732 |
| 215 | Ga0207699_10002738 | 3300025906 | Bacteria | 8331 |
| 216 | Ga0207699_10102763 | 3300025906 | Bacteria | 1817 |
| 217 | Ga0207645_10152717 | 3300025907 | Bacteria | 1508 |
| 218 | Ga0207705_10175824 | 3300025909 | Bacteria | 1614 |
| 219 | Ga0207654_10168874 | 3300025911 | Bacteria | 1419 |
| 220 | Ga0207654_11305850 | 3300025911 | Bacteria | 529 |
| 221 | Ga0207707_10073903 | 3300025912 | Bacteria | 2973 |
| 222 | Ga0207707_10234685 | 3300025912 | Bacteria | 1596 |
| 223 | Ga0207707_10339172 | 3300025912 | Bacteria | 1296 |
| 224 | Ga0207707_10680308 | 3300025912 | Bacteria | 865 |
| 225 | Ga0207707_11615352 | 3300025912 | Bacteria | 510 |
| 226 | Ga0207695_10438315 | 3300025913 | Bacteria | 1190 |
| 227 | Ga0207693_10001091 | 3300025915 | Bacteria | 24395 |
| 228 | Ga0207693_10058837 | 3300025915 | Bacteria | 3011 |
| 229 | Ga0207663_10017295 | 3300025916 | Bacteria | 4014 |
| 230 | Ga0207660_10033534 | 3300025917 | Bacteria | 3552 |
| 231 | Ga0207660_10143887 | 3300025917 | Bacteria | 1825 |
| 232 | Ga0207660_10820983 | 3300025917 | Bacteria | 759 |
| 233 | Ga0207660_10953499 | 3300025917 | Bacteria | 700 |
| 234 | Ga0207657_10032820 | 3300025919 | Bacteria | 4686 |
| 235 | Ga0207657_10129524 | 3300025919 | Bacteria | 2069 |
| 236 | Ga0207649_10036286 | 3300025920 | Bacteria | 2968 |
| 237 | Ga0207652_10284953 | 3300025921 | Bacteria | 1490 |
| 238 | Ga0207694_10443490 | 3300025924 | Bacteria | 1083 |
| 239 | Ga0207694_10685254 | 3300025924 | Bacteria | 864 |
| 240 | Ga0207694_10797339 | 3300025924 | Bacteria | 798 |
| 241 | Ga0207650_10017784 | 3300025925 | Bacteria | 4979 |
| 242 | Ga0207687_10004918 | 3300025927 | Bacteria | 8875 |
| 243 | Ga0207687_10617694 | 3300025927 | Bacteria | 915 |
| 244 | Ga0207700_10000314 | 3300025928 | Bacteria | 28445 |
| 245 | Ga0207700_10637220 | 3300025928 | Bacteria | 950 |
| 246 | Ga0207664_10046843 | 3300025929 | Bacteria | 3395 |
| 247 | Ga0207664_10155592 | 3300025929 | Bacteria | 1946 |
| 248 | Ga0207644_10003205 | 3300025931 | Bacteria | 10538 |
| 249 | Ga0207644_10088588 | 3300025931 | Bacteria | 2302 |
| 250 | Ga0207690_10242953 | 3300025932 | Bacteria | 1388 |
| 251 | Ga0207706_10012582 | 3300025933 | Bacteria | 7703 |
| 252 | Ga0207706_10322961 | 3300025933 | Bacteria | 1343 |
| 253 | Ga0207686_10026756 | 3300025934 | Bacteria | 3369 |
| 254 | Ga0207686_10263226 | 3300025934 | Bacteria | 1265 |
| 255 | Ga0207709_10305998 | 3300025935 | Bacteria | 1184 |
| 256 | Ga0207709_10556349 | 3300025935 | Bacteria | 903 |
| 257 | Ga0207670_10002509 | 3300025936 | Bacteria | 9638 |
| 258 | Ga0207669_10268392 | 3300025937 | Bacteria | 1280 |
| 259 | Ga0207669_11118101 | 3300025937 | Bacteria | 665 |
| 260 | Ga0207704_10036589 | 3300025938 | Bacteria | 2826 |
| 261 | Ga0207704_10200876 | 3300025938 | Bacteria | 1459 |
| 262 | Ga0207665_10001714 | 3300025939 | Bacteria | 14739 |
| 263 | Ga0207665_10099467 | 3300025939 | Bacteria | 2028 |
| 264 | Ga0207711_10005059 | 3300025941 | Bacteria | 11184 |
| 265 | Ga0207711_10088567 | 3300025941 | Bacteria | 2718 |
| 266 | Ga0207689_10071654 | 3300025942 | Bacteria | 2847 |
| 267 | Ga0207661_10121150 | 3300025944 | Bacteria | 2227 |
| 268 | Ga0207679_10080039 | 3300025945 | Bacteria | 2493 |
| 269 | Ga0207667_10634180 | 3300025949 | Bacteria | 1075 |
| 270 | Ga0207667_11858690 | 3300025949 | Bacteria | 565 |
| 271 | Ga0207651_10403617 | 3300025960 | Bacteria | 1163 |
| 272 | Ga0207651_10482261 | 3300025960 | Bacteria | 1069 |
| 273 | Ga0207651_11248442 | 3300025960 | Bacteria | 667 |
| 274 | Ga0207712_11561062 | 3300025961 | Bacteria | 591 |
| 275 | Ga0207658_10514358 | 3300025986 | Bacteria | 1068 |
| 276 | Ga0207677_10008719 | 3300026023 | Bacteria | 5679 |
| 277 | Ga0207703_10018194 | 3300026035 | Bacteria | 5487 |
| 278 | Ga0207639_10649741 | 3300026041 | Bacteria | 976 |
| 279 | Ga0207639_11107793 | 3300026041 | Bacteria | 743 |
| 280 | Ga0207639_12239151 | 3300026041 | Bacteria | 508 |
| 281 | Ga0207678_10001936 | 3300026067 | Bacteria | 18897 |
| 282 | Ga0207678_10077251 | 3300026067 | Bacteria | 2852 |
| 283 | Ga0207678_10131012 | 3300026067 | Bacteria | 2139 |
| 284 | Ga0207678_10184414 | 3300026067 | Bacteria | 1782 |
| 285 | Ga0207702_10543384 | 3300026078 | Bacteria | 1136 |
| 286 | Ga0207702_11973256 | 3300026078 | Bacteria | 574 |
| 287 | Ga0207641_10036929 | 3300026088 | Bacteria | 4078 |
| 288 | Ga0207676_10005005 | 3300026095 | Bacteria | 9385 |
| 289 | Ga0207675_100169850 | 3300026118 | Bacteria | 2084 |
| 290 | Ga0207675_101724260 | 3300026118 | Bacteria | 646 |
| 291 | Ga0207683_10002621 | 3300026121 | Bacteria | 15708 |
| 292 | Ga0207683_10115371 | 3300026121 | Bacteria | 2408 |
| 293 | Ga0209813_10121472 | 3300027866 | Bacteria | 910 |
| 294 | Ga0209813_10250694 | 3300027866 | Bacteria | 672 |
| 295 | Ga0268266_10064928 | 3300028379 | Bacteria | 3154 |
| 296 | Ga0268266_10356711 | 3300028379 | Bacteria | 1375 |
| 297 | Ga0268266_10781507 | 3300028379 | Bacteria | 922 |
| 298 | Ga0268264_10109244 | 3300028381 | Bacteria | 2419 |
| 299 | Ga0265337_1015558 | 3300028556 | Bacteria | 2486 |
| 300 | Ga0265337_1030134 | 3300028556 | Bacteria | 1618 |
| 301 | Ga0265324_10134480 | 3300029957 | Bacteria | 840 |
| 302 | Ga0265330_10023331 | 3300031235 | Bacteria | 2810 |
| 303 | Ga0265332_10005829 | 3300031238 | Bacteria | 5646 |
| 304 | Ga0265332_10098849 | 3300031238 | Bacteria | 1232 |
| 305 | Ga0265328_10076993 | 3300031239 | Bacteria | 1228 |
| 306 | Ga0265320_10071541 | 3300031240 | Bacteria | 1633 |
| 307 | Ga0265320_10113594 | 3300031240 | Bacteria | 1239 |
| 308 | Ga0265325_10002931 | 3300031241 | Bacteria | 11377 |
| 309 | Ga0265325_10037879 | 3300031241 | Bacteria | 2547 |
| 310 | Ga0265325_10052515 | 3300031241 | Bacteria | 2092 |
| 311 | Ga0265325_10318279 | 3300031241 | Bacteria | 692 |
| 312 | Ga0265329_10003992 | 3300031242 | Bacteria | 6289 |
| 313 | Ga0265329_10142467 | 3300031242 | Bacteria | 775 |
| 314 | Ga0265340_10005149 | 3300031247 | Bacteria | 7270 |
| 315 | Ga0265340_10011956 | 3300031247 | Bacteria | 4594 |
| 316 | Ga0265339_10002519 | 3300031249 | Bacteria | 13078 |
| 317 | Ga0265339_10064067 | 3300031249 | Bacteria | 1972 |
| 318 | Ga0265339_10086252 | 3300031249 | Bacteria | 1652 |
| 319 | Ga0265339_10283001 | 3300031249 | Bacteria | 794 |
| 320 | Ga0265331_10134110 | 3300031250 | Bacteria | 1128 |
| 321 | Ga0265316_10017290 | 3300031344 | Bacteria | 6240 |
| 322 | Ga0265316_10047614 | 3300031344 | Bacteria | 3390 |
| 323 | Ga0265316_10051732 | 3300031344 | Bacteria | 3225 |
| 324 | Ga0265316_10075468 | 3300031344 | Bacteria | 2592 |
| 325 | Ga0265313_10001997 | 3300031595 | Bacteria | 18359 |
| 326 | Ga0265313_10099701 | 3300031595 | Bacteria | 1290 |
| 327 | Ga0265313_10112032 | 3300031595 | Bacteria | 1199 |
| 328 | Ga0265314_10014930 | 3300031711 | Bacteria | 6186 |
| 329 | Ga0265314_10019937 | 3300031711 | Bacteria | 5185 |
| 330 | Ga0265314_10074056 | 3300031711 | Bacteria | 2269 |
| 331 | Ga0265342_10006504 | 3300031712 | Bacteria | 8695 |
| 332 | Ga0307412_12149219 | 3300031911 | Bacteria | 519 |
| 333 | Ga0316583_10005292 | 3300032133 | Bacteria | 4627 |
| 334 | Ga0373934_0024821 | 3300035086 | Bacteria | 2319 |
| 335 | Ga0373934_0102650 | 3300035086 | Bacteria | 1156 |
| 336 | Ga0373944_0072089 | 3300035089 | Bacteria | 1127 |
| 337 | Ga0373923_0101355 | 3300035111 | Bacteria | 1270 |
| 338 | Ga0373932_0080290 | 3300035112 | Bacteria | 1029 |
| 339 | Ga0373932_0119090 | 3300035112 | Bacteria | 879 |
| 340 | Ga0373932_0282086 | 3300035112 | Bacteria | 615 |
| 341 | Ga0373936_0160207 | 3300035113 | Bacteria | 980 |
| 342 | Ga0373939_0056975 | 3300035114 | Bacteria | 1232 |
| 343 | Ga0373945_0010904 | 3300035116 | Bacteria | 2998 |
| 344 | Ga0373945_0061192 | 3300035116 | Bacteria | 1406 |
| 345 | Ga0373953_0026843 | 3300035117 | Bacteria | 2209 |
| 346 | Ga0373954_0027925 | 3300035118 | Bacteria | 2593 |
| 347 | Ga0373954_0305248 | 3300035118 | Bacteria | 785 |
| 348 | Ga0373956_0032535 | 3300035119 | Bacteria | 2288 |
| 349 | Ga0373956_0055566 | 3300035119 | Bacteria | 1786 |
| 350 | Ga0373943_0075186 | 3300035170 | Bacteria | 1720 |
| 351 | Ga0373946_0055982 | 3300035171 | Bacteria | 1664 |
| 352 | Ga0373955_0128987 | 3300035172 | Bacteria | 1475 |
| 353 | Ga0373955_0181984 | 3300035172 | Bacteria | 1247 |
| 354 | Ga0373955_0242322 | 3300035172 | Unclassified | 1080 |
| 355 | Ga0373942_0035132 | 3300035207 | Bacteria | 1344 |
| 356 | Ga0373942_0055151 | 3300035207 | Bacteria | 1125 |
| 357 | Ga0373942_0126734 | 3300035207 | Bacteria | 802 |
| 358 | Ga0373961_0285708 | 3300035241 | Bacteria | 606 |
| 359 | Ga0373961_0336204 | 3300035241 | Bacteria | 566 |
| 360 | Ga0373924_0008269 | 3300035410 | Bacteria | 3776 |
| 361 | Ga0373924_0146308 | 3300035410 | Bacteria | 1032 |
| 362 | Ga0373924_0265116 | 3300035410 | Bacteria | 761 |
| 363 | Ga0373935_0099566 | 3300035692 | Bacteria | 1914 |
| 364 | Ga0373935_0497899 | 3300035692 | Bacteria | 884 |
| 365 | Ga0373927_0232431 | 3300035695 | Bacteria | 1211 |
| 366 | Ga0373927_0435975 | 3300035695 | Bacteria | 865 |
| 367 | Ga0373933_0021842 | 3300035724 | Bacteria | 3640 |
| 368 | Ga0373933_0282147 | 3300035724 | Bacteria | 1073 |
| 369 | Ga0373933_0665966 | 3300035724 | Bacteria | 684 |
| 370 | Ga0373947_0151815 | 3300035725 | Bacteria | 1492 |
| 371 | Ga0373937_0055703 | 3300036401 | Bacteria | 3630 |
| 372 | Ga0373937_0093558 | 3300036401 | Unclassified | 2787 |
| 373 | Ga0373937_0465594 | 3300036401 | Bacteria | 1200 |
| 374 | Ga0373937_0623609 | 3300036401 | Bacteria | 1023 |
| 375 | Ga0373937_1892354 | 3300036401 | Unclassified | 543 |
| 376 | Ga0373925_0310543 | 3300037068 | Bacteria | 1274 |
| 377 | Ga0395899_0148014 | 3300037312 | Bacteria | 1666 |
| 378 | Ga0395900_0008079 | 3300037418 | Bacteria | 10831 |
| 379 | Ga0395900_0683643 | 3300037418 | Bacteria | 961 |
| 380 | Ga0395898_0002839 | 3300037466 | Bacteria | 19824 |
| 381 | Ga0395898_0191808 | 3300037466 | Bacteria | 1952 |
| 382 | Ga0395898_0951807 | 3300037466 | Bacteria | 796 |
| 383 | Ga0436364_0630498 | 3300037853 | Bacteria | 31334 |
| 384 | Ga0395901_0612312 | 3300038443 | Bacteria | 1097 |
| 385 | Ga0436365_0184640 | 3300039437 | Bacteria | 8493 |
| 386 | Ga0436365_0565416 | 3300039437 | Bacteria | 1123 |
| 387 | Ga0436365_0772801 | 3300039437 | Bacteria | 2792 |
| 388 | Ga0436365_1570839 | 3300039437 | Bacteria | 1930 |
| 389 | Ga0436363_0029285 | 3300039450 | Bacteria | 1396 |
| 390 | Ga0436363_0375257 | 3300039450 | Bacteria | 1540 |
| 391 | Ga0436362_0414516 | 3300039453 | Bacteria | 998 |
| 392 | Ga0439453_0021475 | 3300041408 | Bacteria | 1164 |
| 393 | Ga0439435_0232826 | 3300042436 | Bacteria | 616 |
| 394 | Ga0495592_0013052 | 3300046454 | Bacteria | 6321 |
| 395 | Ga0495592_0078040 | 3300046454 | Bacteria | 2399 |
| 396 | Ga0495592_0400810 | 3300046454 | Bacteria | 869 |
| 397 | Ga0495603_0153108 | 3300046455 | Bacteria | 1339 |
| 398 | Ga0495629_0170224 | 3300046459 | Bacteria | 1512 |
| 399 | Ga0495651_0205743 | 3300046462 | Bacteria | 1374 |
| 400 | Ga0495653_0010489 | 3300046463 | Bacteria | 7582 |
| 401 | Ga0495653_0158629 | 3300046463 | Bacteria | 1573 |
| 402 | Ga0495580_0359205 | 3300046472 | Bacteria | 986 |
| 403 | Ga0495639_0380036 | 3300046475 | Bacteria | 712 |
| 404 | Ga0495662_0467258 | 3300046476 | Bacteria | 619 |
| 405 | Ga0495662_0509396 | 3300046476 | Bacteria | 590 |
| 406 | Ga0495664_0010463 | 3300046477 | Bacteria | 5207 |
| 407 | Ga0495584_0189467 | 3300046491 | Bacteria | 1045 |
| 408 | Ga0495608_0062219 | 3300046511 | Bacteria | 2453 |
| 409 | Ga0495608_0295982 | 3300046511 | Bacteria | 1002 |
| 410 | Ga0495618_0001624 | 3300046514 | Bacteria | 15030 |
| 411 | Ga0495628_0051201 | 3300046516 | Bacteria | 3265 |
| 412 | Ga0495628_1049998 | 3300046516 | Bacteria | 558 |
| 413 | Ga0495628_1183126 | 3300046516 | Bacteria | 519 |
| 414 | Ga0495630_0183198 | 3300046517 | Bacteria | 1597 |
| 415 | Ga0495666_0074588 | 3300046526 | Bacteria | 1609 |
| 416 | Ga0495586_0087988 | 3300046535 | Bacteria | 1713 |
| 417 | Ga0495586_0439063 | 3300046535 | Unclassified | 752 |
| 418 | Ga0495587_0220756 | 3300046536 | Bacteria | 1069 |
| 419 | Ga0495645_0338934 | 3300046543 | Bacteria | 971 |
| 420 | Ga0495622_0209802 | 3300046557 | Bacteria | 866 |
| 421 | Ga0495667_0015315 | 3300046559 | Bacteria | 5179 |
| 422 | Ga0495667_0059379 | 3300046559 | Bacteria | 2510 |
| 423 | Ga0495667_0070675 | 3300046559 | Bacteria | 2277 |
| 424 | Ga0495634_0034949 | 3300046642 | Bacteria | 3446 |
| 425 | Ga0495634_0244036 | 3300046642 | Unclassified | 1101 |
| 426 | Ga0495635_0092806 | 3300046663 | Bacteria | 2064 |
| 427 | Ga0495635_0217969 | 3300046663 | Bacteria | 1291 |
| 428 | Ga0495635_0599486 | 3300046663 | Bacteria | 719 |
| 429 | Ga0495657_0015348 | 3300046675 | Bacteria | 5609 |
| 430 | Ga0495657_0150852 | 3300046675 | Bacteria | 1443 |
| 431 | Ga0495657_0192504 | 3300046675 | Bacteria | 1246 |
| 432 | Ga0495599_0191968 | 3300046678 | Bacteria | 1256 |
| 433 | Ga0495623_0077738 | 3300046679 | Bacteria | 2057 |
| 434 | Ga0495646_0006600 | 3300046680 | Bacteria | 7362 |
| 435 | Ga0495646_0315715 | 3300046680 | Bacteria | 824 |
| 436 | Ga0495647_0021224 | 3300046681 | Bacteria | 2337 |
| 437 | Ga0495658_0161036 | 3300046683 | Bacteria | 1384 |
| 438 | Ga0495624_0029185 | 3300046690 | Bacteria | 3600 |
| 439 | Ga0495600_0001316 | 3300046809 | Bacteria | 13706 |
| 440 | Ga0495600_0047790 | 3300046809 | Bacteria | 2792 |
| 441 | Ga0495600_0251436 | 3300046809 | Bacteria | 1124 |
| 442 | Ga0495600_0263427 | 3300046809 | Bacteria | 1094 |
| 443 | Ga0495604_0069099 | 3300047317 | Bacteria | 2678 |
| 444 | Ga0495604_0188544 | 3300047317 | Bacteria | 1438 |
| 445 | Ga0495604_0249604 | 3300047317 | Bacteria | 1210 |
| 446 | Ga0495674_0182793 | 3300047319 | Bacteria | 1745 |
| 447 | Ga0495674_0481780 | 3300047319 | Bacteria | 994 |
| 448 | Ga0495674_0497824 | 3300047319 | Bacteria | 975 |
| 449 | Ga0495674_0612573 | 3300047319 | Unclassified | 862 |
| 450 | Ga0495676_0373812 | 3300047321 | Bacteria | 949 |
| 451 | Ga0495676_0554001 | 3300047321 | Bacteria | 751 |
| 452 | Ga0495680_0003716 | 3300047322 | Bacteria | 14886 |
| 453 | Ga0495680_0024306 | 3300047322 | Bacteria | 5027 |
| 454 | Ga0495680_0672165 | 3300047322 | Bacteria | 686 |
| 455 | Ga0495675_0000825 | 3300047444 | Bacteria | 19007 |
| 456 | Ga0495675_0195179 | 3300047444 | Bacteria | 1234 |
| 457 | Ga0495684_0159506 | 3300047471 | Bacteria | 1683 |
| 458 | Ga0495593_0042336 | 3300047673 | Bacteria | 2444 |
| 459 | Ga0495593_0403932 | 3300047673 | Bacteria | 683 |
| 460 | Ga0495602_0047335 | 3300048088 | Bacteria | 3875 |
| 461 | Ga0495602_0173208 | 3300048088 | Bacteria | 1673 |
| 462 | Ga0495602_0445207 | 3300048088 | Bacteria | 915 |
| 463 | Ga0495602_0606782 | 3300048088 | Bacteria | 752 |
| 464 | Ga0495602_0718906 | 3300048088 | Unclassified | 676 |
| 465 | Ga0495614_0064643 | 3300048089 | Bacteria | 1574 |
| 466 | Ga0496100_0062943 | 3300048903 | Bacteria | 2450 |
| 467 | Ga0496100_0324919 | 3300048903 | Bacteria | 1156 |
| 468 | Ga0496101_0022527 | 3300048904 | Bacteria | 4337 |
| 469 | Ga0496101_0162093 | 3300048904 | Bacteria | 1715 |
| 470 | Ga0496102_0002969 | 3300048905 | Bacteria | 14359 |
| 471 | Ga0496102_0065885 | 3300048905 | Bacteria | 3320 |
| 472 | Ga0496102_0869405 | 3300048905 | Bacteria | 823 |
| 473 | Ga0496103_0013630 | 3300048906 | Bacteria | 4822 |
| 474 | Ga0496103_0189205 | 3300048906 | Bacteria | 1323 |
| 475 | Ga0496103_0869857 | 3300048906 | Bacteria | 566 |
| 476 | Ga0496104_0018106 | 3300048907 | Bacteria | 6423 |
| 477 | Ga0496104_0100591 | 3300048907 | Bacteria | 2767 |
| 478 | Ga0496104_1679867 | 3300048907 | Bacteria | 537 |
| 479 | Ga0496105_0009940 | 3300048908 | Bacteria | 7464 |
| 480 | Ga0496105_0614218 | 3300048908 | Bacteria | 842 |
| 481 | Ga0496106_0078833 | 3300048909 | Bacteria | 2528 |
| 482 | Ga0496106_0134955 | 3300048909 | Bacteria | 1937 |
| 483 | Ga0496106_0364752 | 3300048909 | Bacteria | 1160 |
| 484 | Ga0496107_0023256 | 3300048910 | Bacteria | 4381 |
| 485 | Ga0496107_0142662 | 3300048910 | Bacteria | 1770 |
| 486 | Ga0496107_1214975 | 3300048910 | Bacteria | 541 |
| 487 | Ga0496108_0136032 | 3300048911 | Bacteria | 2114 |
| 488 | Ga0496108_0841044 | 3300048911 | Bacteria | 790 |
| 489 | Ga0496109_0042909 | 3300048912 | Bacteria | 4099 |
| 490 | Ga0496109_0257680 | 3300048912 | Bacteria | 1643 |
| 491 | Ga0496110_0042096 | 3300048913 | Bacteria | 3986 |
| 492 | Ga0496111_0181927 | 3300048914 | Bacteria | 1562 |
| 493 | Ga0496112_0055254 | 3300048915 | Bacteria | 3903 |
| 494 | Ga0496113_0892186 | 3300048916 | Bacteria | 703 |
| 495 | Ga0496113_1506776 | 3300048916 | Bacteria | 519 |
| 496 | Ga0496114_0006050 | 3300048917 | Bacteria | 9521 |
| 497 | Ga0496114_0008678 | 3300048917 | Bacteria | 8054 |
| 498 | Ga0496115_0122847 | 3300048918 | Bacteria | 2137 |
| 499 | Ga0496115_0171803 | 3300048918 | Bacteria | 1792 |
| 500 | Ga0496115_0257790 | 3300048918 | Bacteria | 1434 |
| 501 | Ga0496115_0286968 | 3300048918 | Bacteria | 1350 |
| 502 | Ga0496121_0101767 | 3300048924 | Bacteria | 2215 |
| 503 | Ga0496125_0179316 | 3300048928 | Bacteria | 1414 |
| 504 | Ga0496126_1036985 | 3300048929 | Bacteria | 613 |
| 505 | Ga0501031_0026245 | 3300049568 | Bacteria | 3798 |
| 506 | Ga0501032_0034439 | 3300049569 | Bacteria | 3467 |
| 507 | Ga0501032_0699148 | 3300049569 | Bacteria | 643 |
| 508 | Ga0501033_0006873 | 3300049570 | Bacteria | 8881 |
| 509 | Ga0501034_0091081 | 3300049571 | Bacteria | 3047 |
| 510 | Ga0501034_0171946 | 3300049571 | Bacteria | 2133 |
| 511 | Ga0501034_0457122 | 3300049571 | Bacteria | 1194 |
| 512 | Ga0501036_0030607 | 3300049572 | Bacteria | 4545 |
| 513 | Ga0501036_0207363 | 3300049572 | Bacteria | 1647 |
| 514 | Ga0501036_0436238 | 3300049572 | Bacteria | 1092 |
| 515 | Ga0501036_0472060 | 3300049572 | Bacteria | 1045 |
| 516 | Ga0501037_0111993 | 3300049573 | Bacteria | 1965 |
| 517 | Ga0501038_0095544 | 3300049574 | Bacteria | 2482 |
| 518 | Ga0501038_0096460 | 3300049574 | Bacteria | 2468 |
| 519 | Ga0501038_1233362 | 3300049574 | Bacteria | 542 |
| 520 | Ga0501039_0035196 | 3300049575 | Bacteria | 3864 |
| 521 | Ga0501042_0549282 | 3300049578 | Bacteria | 840 |
| 522 | Ga0501043_0156745 | 3300049579 | Bacteria | 1780 |
| 523 | Ga0501046_0303910 | 3300049580 | Bacteria | 1165 |
| 524 | Ga0501047_0179216 | 3300049581 | Bacteria | 1985 |
| 525 | Ga0501047_0213973 | 3300049581 | Bacteria | 1785 |
| 526 | Ga0501048_0209998 | 3300049582 | Bacteria | 1381 |
| 527 | Ga0501069_0004220 | 3300049585 | Bacteria | 7423 |
| 528 | Ga0501069_0278042 | 3300049585 | Bacteria | 979 |
| 529 | Ga0501070_0004243 | 3300049586 | Bacteria | 12323 |
| 530 | Ga0501070_0064277 | 3300049586 | Bacteria | 3039 |
| 531 | Ga0501070_0067254 | 3300049586 | Bacteria | 2968 |
| 532 | Ga0501070_0135004 | 3300049586 | Bacteria | 2037 |
| 533 | Ga0501070_0146014 | 3300049586 | Bacteria | 1952 |
| 534 | Ga0501070_0255992 | 3300049586 | Bacteria | 1431 |
| 535 | Ga0501070_0257439 | 3300049586 | Bacteria | 1427 |
| 536 | Ga0501070_0993124 | 3300049586 | Bacteria | 651 |
| 537 | Ga0501071_0063694 | 3300049587 | Bacteria | 2674 |
| 538 | Ga0501071_0159427 | 3300049587 | Bacteria | 1686 |
| 539 | Ga0501071_0254878 | 3300049587 | Bacteria | 1325 |
| 540 | Ga0501072_0023469 | 3300049588 | Bacteria | 4792 |
| 541 | Ga0501072_0368233 | 3300049588 | Bacteria | 1141 |
| 542 | Ga0501073_0255594 | 3300049589 | Bacteria | 1209 |
| 543 | Ga0501073_1077045 | 3300049589 | Bacteria | 552 |
| 544 | Ga0501074_0131869 | 3300049590 | Bacteria | 1787 |
| 545 | Ga0501074_0580544 | 3300049590 | Bacteria | 793 |
| 546 | Ga0501074_1013238 | 3300049590 | Bacteria | 584 |
| 547 | Ga0501079_0133123 | 3300049741 | Bacteria | 1935 |
| 548 | Ga0501079_0856519 | 3300049741 | Bacteria | 716 |
| 549 | Ga0501079_0922833 | 3300049741 | Bacteria | 688 |
| 550 | Ga0501080_0031252 | 3300049742 | Bacteria | 4962 |
| 551 | Ga0501080_0053278 | 3300049742 | Bacteria | 3766 |
| 552 | Ga0501080_0075358 | 3300049742 | Bacteria | 3138 |
| 553 | Ga0501080_0276558 | 3300049742 | Bacteria | 1527 |
| 554 | Ga0501081_0135643 | 3300049743 | Bacteria | 1762 |
| 555 | Ga0501083_0076645 | 3300049744 | Bacteria | 2219 |
| 556 | Ga0501083_0444504 | 3300049744 | Bacteria | 844 |
| 557 | Ga0501083_0883259 | 3300049744 | Bacteria | 582 |
| 558 | Ga0501083_0990206 | 3300049744 | Bacteria | 547 |
| 559 | Ga0501035_0001590 | 3300049822 | Bacteria | 23012 |
| 560 | Ga0501035_0340700 | 3300049822 | Bacteria | 1256 |
| 561 | Ga0501044_0418618 | 3300049823 | Bacteria | 1250 |
| 562 | Ga0501044_0527036 | 3300049823 | Bacteria | 1080 |
| 563 | nmdc:mga03n38_741363_c1 | 3300050490 | Bacteria | 569 |
| 564 | nmdc:mga03n38_805936_c1 | 3300050490 | Bacteria | 547 |
| 565 | nmdc:mga03n38_927435_c1 | 3300050490 | Bacteria | 513 |
| 566 | nmdc:mga00v17_142644_c1 | 3300050491 | Bacteria | 1536 |
| 567 | nmdc:mga0yw44_462308_c1 | 3300050492 | Bacteria | 860 |
| 568 | nmdc:mga0k408_127456_c1 | 3300050493 | Bacteria | 1510 |
| 569 | nmdc:mga0k408_86042_c1 | 3300050493 | Bacteria | 1845 |
| 570 | nmdc:mga06z11_246837_c1 | 3300050494 | Bacteria | 1050 |
| 571 | nmdc:mga04h51_284574_c1 | 3300050495 | Bacteria | 670 |
| 572 | nmdc:mga04h51_87303_c1 | 3300050495 | Bacteria | 1117 |
| 573 | nmdc:mga07m45_100602_c1 | 3300050496 | Bacteria | 1660 |
| 574 | nmdc:mga05p37_1066971_c1 | 3300050507 | Bacteria | 850 |
| 575 | nmdc:mga09592_1322420_c1 | 3300050508 | Bacteria | 592 |
| 576 | nmdc:mga06r32_404081_c1 | 3300050510 | Bacteria | 1348 |
| 577 | nmdc:mga08y16_185617_c1 | 3300050511 | Bacteria | 2158 |
| 578 | nmdc:mga0n895_107131_c1 | 3300050512 | Bacteria | 2808 |
| 579 | nmdc:mga0n895_347184_c1 | 3300050512 | Bacteria | 1503 |
| 580 | nmdc:mga0n895_935902_c1 | 3300050512 | Bacteria | 850 |
| 581 | nmdc:mga0rr50_1430558_c1 | 3300050513 | Bacteria | 585 |
| 582 | nmdc:mga0rr50_558984_c1 | 3300050513 | Bacteria | 974 |
| 583 | nmdc:mga08x19_1300533_c1 | 3300050514 | Bacteria | 515 |
| 584 | nmdc:mga0a205_202102_c1 | 3300050515 | Bacteria | 1877 |
| 585 | Ga0495601_0007672 | 3300053077 | Bacteria | 6342 |
| 586 | Ga0495601_0019305 | 3300053077 | Bacteria | 4157 |
| 587 | Ga0495601_0020464 | 3300053077 | Bacteria | 4043 |
| 588 | Ga0495601_0079803 | 3300053077 | Bacteria | 2098 |
| 589 | Ga0495612_0016931 | 3300053078 | Bacteria | 2919 |
| 590 | Ga0495612_0098824 | 3300053078 | Bacteria | 1241 |
| 591 | Ga0495595_0003291 | 3300053084 | Bacteria | 6418 |
| 592 | Ga0495595_0008792 | 3300053084 | Bacteria | 4159 |
| 593 | Ga0495595_0090233 | 3300053084 | Bacteria | 1469 |
| 594 | Ga0495595_0305633 | 3300053084 | Bacteria | 800 |
| 595 | Ga0495619_0000468 | 3300053085 | Bacteria | 27254 |
| 596 | Ga0495619_0074226 | 3300053085 | Bacteria | 2280 |
| 597 | Ga0495619_0087447 | 3300053085 | Bacteria | 2107 |
| 598 | Ga0500578_0152274 | 3300053086 | Bacteria | 1440 |
| 599 | Ga0500643_009268 | 3300053087 | Bacteria | 3770 |
| 600 | Ga0500644_0000587 | 3300053088 | Bacteria | 13932 |
| 601 | Ga0500646_0027538 | 3300053090 | Bacteria | 1547 |
| 602 | Ga0500646_0312298 | 3300053090 | Bacteria | 566 |
| 603 | Ga0500566_0089080 | 3300053094 | Bacteria | 1707 |
| 604 | Ga0500593_001653 | 3300053117 | Bacteria | 8038 |
| 605 | Ga0500595_000083 | 3300053119 | Bacteria | 66474 |
| 606 | Ga0500642_0220330 | 3300053130 | Bacteria | 879 |
| 607 | Ga0500652_027162 | 3300053131 | Bacteria | 2211 |
| 608 | Ga0500655_057967 | 3300053133 | Bacteria | 777 |
| 609 | Ga0500568_0179002 | 3300053139 | Bacteria | 780 |
| 610 | Ga0500577_0093864 | 3300053142 | Bacteria | 1217 |
| 611 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 612 | Ga0500645_000680 | 3300053730 | Bacteria | 21248 |
| 613 | Ga0501084_0055173 | 3300054114 | Bacteria | 3325 |
| 614 | Ga0501084_0789052 | 3300054114 | Bacteria | 800 |
| 615 | Ga0501082_1207487 | 3300060353 | Unclassified | 661 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005548 | Ga0070665_100508866 | Ga0070665_1005088661 | 86 |
| 2 | 3300026067 | Ga0207678_10131012 | Ga0207678_101310123 | 90 |
| 3 | 3300049587 | Ga0501071_0159427 | Ga0501071_0159427_1151_1486 | 91 |
| 4 | 3300049741 | Ga0501079_0133123 | Ga0501079_0133123_1191_1526 | 91 |
| 5 | 3300005356 | Ga0070674_100767620 | Ga0070674_1007676202 | 95 |
| 6 | 3300005337 | Ga0070682_101300168 | Ga0070682_1013001681 | 96 |
| 7 | 3300005458 | Ga0070681_10954326 | Ga0070681_109543261 | 96 |
| 8 | 3300025912 | Ga0207707_11615352 | Ga0207707_116153521 | 96 |
| 9 | 3300026078 | Ga0207702_11973256 | Ga0207702_119732562 | 96 |
| 10 | 3300035116 | Ga0373945_0061192 | Ga0373945_0061192_432_770 | 97 |
| 11 | 3300035170 | Ga0373943_0075186 | Ga0373943_0075186_141_479 | 97 |
| 12 | 3300035172 | Ga0373955_0128987 | Ga0373955_0128987_789_1127 | 97 |
| 13 | 3300035410 | Ga0373924_0265116 | Ga0373924_0265116_184_522 | 97 |
| 14 | 3300035692 | Ga0373935_0099566 | Ga0373935_0099566_1017_1355 | 97 |
| 15 | 3300035695 | Ga0373927_0435975 | Ga0373927_0435975_409_747 | 97 |
| 16 | 3300035724 | Ga0373933_0282147 | Ga0373933_0282147_679_1017 | 97 |
| 17 | 3300036401 | Ga0373937_0623609 | Ga0373937_0623609_83_421 | 97 |
| 18 | 3300046454 | Ga0495592_0078040 | Ga0495592_0078040_1195_1533 | 97 |
| 19 | 3300046463 | Ga0495653_0158629 | Ga0495653_0158629_841_1179 | 97 |
| 20 | 3300046475 | Ga0495639_0380036 | Ga0495639_0380036_343_681 | 97 |
| 21 | 3300046516 | Ga0495628_0051201 | Ga0495628_0051201_373_711 | 97 |
| 22 | 3300046678 | Ga0495599_0191968 | Ga0495599_0191968_456_794 | 97 |
| 23 | 3300046809 | Ga0495600_0263427 | Ga0495600_0263427_150_488 | 97 |
| 24 | 3300047317 | Ga0495604_0249604 | Ga0495604_0249604_792_1130 | 97 |
| 25 | 3300047319 | Ga0495674_0497824 | Ga0495674_0497824_616_954 | 97 |
| 26 | 3300047444 | Ga0495675_0195179 | Ga0495675_0195179_637_975 | 97 |
| 27 | 3300048088 | Ga0495602_0173208 | Ga0495602_0173208_1318_1656 | 97 |
| 28 | 3300053077 | Ga0495601_0019305 | Ga0495601_0019305_125_463 | 97 |
| 29 | 3300053078 | Ga0495612_0098824 | Ga0495612_0098824_192_530 | 97 |
| 30 | 3300053084 | Ga0495595_0305633 | Ga0495595_0305633_285_623 | 97 |
| 31 | 3300053085 | Ga0495619_0087447 | Ga0495619_0087447_1739_2077 | 97 |
| 32 | 3300006847 | Ga0075431_100307907 | Ga0075431_1003079071 | 98 |
| 33 | 3300006880 | Ga0075429_101436094 | Ga0075429_1014360942 | 98 |
| 34 | 3300007788 | Ga0099795_10186762 | Ga0099795_101867622 | 98 |
| 35 | 3300049569 | Ga0501032_0699148 | Ga0501032_0699148_220_582 | 98 |
| 36 | 3300049572 | Ga0501036_0436238 | Ga0501036_0436238_183_545 | 98 |
| 37 | 3300049578 | Ga0501042_0549282 | Ga0501042_0549282_100_462 | 98 |
| 38 | 3300049580 | Ga0501046_0303910 | Ga0501046_0303910_781_1143 | 98 |
| 39 | 3300049587 | Ga0501071_0254878 | Ga0501071_0254878_782_1144 | 98 |
| 40 | 3300049588 | Ga0501072_0368233 | Ga0501072_0368233_745_1107 | 98 |
| 41 | 3300049590 | Ga0501074_1013238 | Ga0501074_1013238_136_498 | 98 |
| 42 | 3300049741 | Ga0501079_0856519 | Ga0501079_0856519_314_676 | 98 |
| 43 | 3300049743 | Ga0501081_0135643 | Ga0501081_0135643_1164_1526 | 98 |
| 44 | 3300005615 | Ga0070702_100328882 | Ga0070702_1003288821 | 99 |
| 45 | 3300031235 | Ga0265330_10023331 | Ga0265330_100233312 | 99 |
| 46 | 3300031238 | Ga0265332_10005829 | Ga0265332_100058294 | 99 |
| 47 | 3300031239 | Ga0265328_10076993 | Ga0265328_100769932 | 99 |
| 48 | 3300031240 | Ga0265320_10071541 | Ga0265320_100715412 | 99 |
| 49 | 3300031240 | Ga0265320_10113594 | Ga0265320_101135942 | 99 |
| 50 | 3300031241 | Ga0265325_10037879 | Ga0265325_100378793 | 99 |
| 51 | 3300031241 | Ga0265325_10052515 | Ga0265325_100525153 | 99 |
| 52 | 3300031242 | Ga0265329_10003992 | Ga0265329_100039925 | 99 |
| 53 | 3300031242 | Ga0265329_10142467 | Ga0265329_101424672 | 99 |
| 54 | 3300031247 | Ga0265340_10005149 | Ga0265340_100051495 | 99 |
| 55 | 3300031247 | Ga0265340_10011956 | Ga0265340_100119565 | 99 |
| 56 | 3300031249 | Ga0265339_10064067 | Ga0265339_100640673 | 99 |
| 57 | 3300031249 | Ga0265339_10086252 | Ga0265339_100862524 | 99 |
| 58 | 3300031250 | Ga0265331_10134110 | Ga0265331_101341102 | 99 |
| 59 | 3300031344 | Ga0265316_10047614 | Ga0265316_100476142 | 99 |
| 60 | 3300031344 | Ga0265316_10051732 | Ga0265316_100517323 | 99 |
| 61 | 3300031595 | Ga0265313_10099701 | Ga0265313_100997013 | 99 |
| 62 | 3300031711 | Ga0265314_10019937 | Ga0265314_100199375 | 99 |
| 63 | 3300031711 | Ga0265314_10074056 | Ga0265314_100740562 | 99 |
| 64 | 3300031712 | Ga0265342_10006504 | Ga0265342_100065045 | 99 |
| 65 | 3300035207 | Ga0373942_0035132 | Ga0373942_0035132_117_416 | 99 |
| 66 | 3300035241 | Ga0373961_0336204 | Ga0373961_0336204_255_554 | 99 |
| 67 | 3300046491 | Ga0495584_0189467 | Ga0495584_0189467_100_429 | 99 |
| 68 | 3300050495 | nmdc:mga04h51_284574_c1 | nmdc:mga04h51_284574_c1_328_630 | 99 |
| 69 | 3300006847 | Ga0075431_100246250 | Ga0075431_1002462502 | 100 |
| 70 | 3300006852 | Ga0075433_10418975 | Ga0075433_104189752 | 100 |
| 71 | 3300006871 | Ga0075434_100159186 | Ga0075434_1001591862 | 100 |
| 72 | 3300007076 | Ga0075435_101248181 | Ga0075435_1012481812 | 100 |
| 73 | 3300009098 | Ga0105245_12013683 | Ga0105245_120136832 | 100 |
| 74 | 3300009553 | Ga0105249_12301432 | Ga0105249_123014322 | 100 |
| 75 | 3300014326 | Ga0157380_12905008 | Ga0157380_129050082 | 100 |
| 76 | 3300025960 | Ga0207651_11248442 | Ga0207651_112484422 | 100 |
| 77 | 3300025961 | Ga0207712_11561062 | Ga0207712_115610622 | 100 |
| 78 | 3300026118 | Ga0207675_101724260 | Ga0207675_1017242602 | 100 |
| 79 | 3300035241 | Ga0373961_0285708 | Ga0373961_0285708_283_591 | 100 |
| 80 | 3300050511 | nmdc:mga08y16_185617_c1 | nmdc:mga08y16_185617_c1_317_646 | 100 |
| 81 | 3300050512 | nmdc:mga0n895_347184_c1 | nmdc:mga0n895_347184_c1_308_637 | 100 |
| 82 | 3300050513 | nmdc:mga0rr50_1430558_c1 | nmdc:mga0rr50_1430558_c1_191_520 | 100 |
| 83 | 3300050515 | nmdc:mga0a205_202102_c1 | nmdc:mga0a205_202102_c1_1093_1422 | 100 |
| 84 | 3300013306 | Ga0163162_12278961 | Ga0163162_122789612 | 101 |
| 85 | 3300053090 | Ga0500646_0312298 | Ga0500646_0312298_26_364 | 101 |
| 86 | 3300005327 | Ga0070658_10191871 | Ga0070658_101918712 | 102 |
| 87 | 3300005336 | Ga0070680_100057441 | Ga0070680_1000574412 | 102 |
| 88 | 3300005339 | Ga0070660_100123815 | Ga0070660_1001238152 | 102 |
| 89 | 3300005458 | Ga0070681_10030981 | Ga0070681_100309814 | 102 |
| 90 | 3300005530 | Ga0070679_100007329 | Ga0070679_1000073299 | 102 |
| 91 | 3300005539 | Ga0068853_101460441 | Ga0068853_1014604412 | 102 |
| 92 | 3300025909 | Ga0207705_10175824 | Ga0207705_101758243 | 102 |
| 93 | 3300025912 | Ga0207707_10073903 | Ga0207707_100739034 | 102 |
| 94 | 3300025917 | Ga0207660_10033534 | Ga0207660_100335344 | 102 |
| 95 | 3300025921 | Ga0207652_10284953 | Ga0207652_102849532 | 102 |
| 96 | 3300026041 | Ga0207639_11107793 | Ga0207639_111077932 | 102 |
| 97 | 3300060353 | Ga0501082_1207487 | Ga0501082_1207487_280_615 | 103 |
| 98 | 3300003659 | JGI25404J52841_10019331 | JGI25404J52841_100193312 | 104 |
| 99 | 3300005547 | Ga0070693_100074436 | Ga0070693_1000744364 | 104 |
| 100 | 3300005564 | Ga0070664_101196803 | Ga0070664_1011968032 | 104 |
| 101 | 3300005578 | Ga0068854_100907371 | Ga0068854_1009073712 | 104 |
| 102 | 3300005616 | Ga0068852_101532930 | Ga0068852_1015329302 | 104 |
| 103 | 3300005719 | Ga0068861_100870147 | Ga0068861_1008701472 | 104 |
| 104 | 3300005937 | Ga0081455_10568086 | Ga0081455_105680862 | 104 |
| 105 | 3300005983 | Ga0081540_1000003 | Ga0081540_10000031 | 104 |
| 106 | 3300006358 | Ga0068871_100437986 | Ga0068871_1004379862 | 104 |
| 107 | 3300009098 | Ga0105245_10889542 | Ga0105245_108895422 | 104 |
| 108 | 3300009551 | Ga0105238_10695695 | Ga0105238_106956952 | 104 |
| 109 | 3300010375 | Ga0105239_12154885 | Ga0105239_121548852 | 104 |
| 110 | 3300021384 | Ga0213876_10106412 | Ga0213876_101064122 | 104 |
| 111 | 3300021388 | Ga0213875_10000003 | Ga0213875_1000000332 | 104 |
| 112 | 3300025924 | Ga0207694_10443490 | Ga0207694_104434903 | 104 |
| 113 | 3300035112 | Ga0373932_0119090 | Ga0373932_0119090_84_401 | 104 |
| 114 | 3300035114 | Ga0373939_0056975 | Ga0373939_0056975_761_1078 | 104 |
| 115 | 3300035207 | Ga0373942_0055151 | Ga0373942_0055151_788_1105 | 104 |
| 116 | 3300037853 | Ga0436364_0630498 | Ga0436364_0630498_12814_13158 | 104 |
| 117 | 3300039437 | Ga0436365_0565416 | Ga0436365_0565416_249_590 | 104 |
| 118 | 3300039437 | Ga0436365_0772801 | Ga0436365_0772801_2019_2360 | 104 |
| 119 | 3300039437 | Ga0436365_1570839 | Ga0436365_1570839_1537_1881 | 104 |
| 120 | 3300039450 | Ga0436363_0029285 | Ga0436363_0029285_71_412 | 104 |
| 121 | 3300005466 | Ga0070685_10223530 | Ga0070685_102235303 | 105 |
| 122 | 3300006042 | Ga0075368_10328764 | Ga0075368_103287642 | 105 |
| 123 | 3300006048 | Ga0075363_100103151 | Ga0075363_1001031512 | 105 |
| 124 | 3300006178 | Ga0075367_10177133 | Ga0075367_101771332 | 105 |
| 125 | 3300006195 | Ga0075366_10125959 | Ga0075366_101259592 | 105 |
| 126 | 3300006237 | Ga0097621_101014763 | Ga0097621_1010147632 | 105 |
| 127 | 3300006353 | Ga0075370_10538698 | Ga0075370_105386982 | 105 |
| 128 | 3300006353 | Ga0075370_10615018 | Ga0075370_106150182 | 105 |
| 129 | 3300009098 | Ga0105245_11992105 | Ga0105245_119921052 | 105 |
| 130 | 3300021377 | Ga0213874_10158240 | Ga0213874_101582402 | 105 |
| 131 | 3300027866 | Ga0209813_10250694 | Ga0209813_102506941 | 105 |
| 132 | 3300028379 | Ga0268266_10356711 | Ga0268266_103567113 | 105 |
| 133 | 3300039450 | Ga0436363_0375257 | Ga0436363_0375257_278_607 | 105 |
| 134 | 3300041408 | Ga0439453_0021475 | Ga0439453_0021475_733_1053 | 105 |
| 135 | 3300042436 | Ga0439435_0232826 | Ga0439435_0232826_25_345 | 105 |
| 136 | 3300050491 | nmdc:mga00v17_142644_c1 | nmdc:mga00v17_142644_c1_192_533 | 105 |
| 137 | 3300050493 | nmdc:mga0k408_86042_c1 | nmdc:mga0k408_86042_c1_459_779 | 105 |
| 138 | 3300050494 | nmdc:mga06z11_246837_c1 | nmdc:mga06z11_246837_c1_224_544 | 105 |
| 139 | 3300005336 | Ga0070680_100147989 | Ga0070680_1001479893 | 106 |
| 140 | 3300005341 | Ga0070691_10191087 | Ga0070691_101910872 | 106 |
| 141 | 3300005458 | Ga0070681_10104130 | Ga0070681_101041302 | 106 |
| 142 | 3300005530 | Ga0070679_100228645 | Ga0070679_1002286454 | 106 |
| 143 | 3300006042 | Ga0075368_10019793 | Ga0075368_100197932 | 106 |
| 144 | 3300006048 | Ga0075363_100134699 | Ga0075363_1001346992 | 106 |
| 145 | 3300006178 | Ga0075367_10073816 | Ga0075367_100738162 | 106 |
| 146 | 3300006186 | Ga0075369_10054146 | Ga0075369_100541462 | 106 |
| 147 | 3300006195 | Ga0075366_10082514 | Ga0075366_100825144 | 106 |
| 148 | 3300006353 | Ga0075370_10139729 | Ga0075370_101397292 | 106 |
| 149 | 3300025912 | Ga0207707_10234685 | Ga0207707_102346852 | 106 |
| 150 | 3300025917 | Ga0207660_10143887 | Ga0207660_101438873 | 106 |
| 151 | 3300025949 | Ga0207667_11858690 | Ga0207667_118586902 | 106 |
| 152 | 3300027866 | Ga0209813_10121472 | Ga0209813_101214722 | 106 |
| 153 | 3300049571 | Ga0501034_0457122 | Ga0501034_0457122_642_971 | 106 |
| 154 | 3300049572 | Ga0501036_0472060 | Ga0501036_0472060_119_448 | 106 |
| 155 | 3300049574 | Ga0501038_1233362 | Ga0501038_1233362_74_403 | 106 |
| 156 | 3300049581 | Ga0501047_0213973 | Ga0501047_0213973_1346_1675 | 106 |
| 157 | 3300049585 | Ga0501069_0278042 | Ga0501069_0278042_444_773 | 106 |
| 158 | 3300049586 | Ga0501070_0064277 | Ga0501070_0064277_2395_2733 | 106 |
| 159 | 3300049586 | Ga0501070_0067254 | Ga0501070_0067254_1112_1462 | 106 |
| 160 | 3300049586 | Ga0501070_0255992 | Ga0501070_0255992_1029_1358 | 106 |
| 161 | 3300049588 | Ga0501072_0023469 | Ga0501072_0023469_214_543 | 106 |
| 162 | 3300049589 | Ga0501073_0255594 | Ga0501073_0255594_645_986 | 106 |
| 163 | 3300049589 | Ga0501073_1077045 | Ga0501073_1077045_13_342 | 106 |
| 164 | 3300049590 | Ga0501074_0131869 | Ga0501074_0131869_626_955 | 106 |
| 165 | 3300049590 | Ga0501074_0580544 | Ga0501074_0580544_357_707 | 106 |
| 166 | 3300049741 | Ga0501079_0922833 | Ga0501079_0922833_74_403 | 106 |
| 167 | 3300049742 | Ga0501080_0031252 | Ga0501080_0031252_2435_2773 | 106 |
| 168 | 3300049742 | Ga0501080_0053278 | Ga0501080_0053278_843_1193 | 106 |
| 169 | 3300049742 | Ga0501080_0075358 | Ga0501080_0075358_1026_1355 | 106 |
| 170 | 3300049744 | Ga0501083_0076645 | Ga0501083_0076645_1121_1459 | 106 |
| 171 | 3300049823 | Ga0501044_0418618 | Ga0501044_0418618_797_1126 | 106 |
| 172 | 3300050490 | nmdc:mga03n38_741363_c1 | nmdc:mga03n38_741363_c1_201_548 | 106 |
| 173 | 3300050490 | nmdc:mga03n38_805936_c1 | nmdc:mga03n38_805936_c1_152_532 | 106 |
| 174 | 3300050492 | nmdc:mga0yw44_462308_c1 | nmdc:mga0yw44_462308_c1_354_701 | 106 |
| 175 | 3300050493 | nmdc:mga0k408_127456_c1 | nmdc:mga0k408_127456_c1_730_1077 | 106 |
| 176 | 3300050495 | nmdc:mga04h51_87303_c1 | nmdc:mga04h51_87303_c1_396_743 | 106 |
| 177 | 3300050496 | nmdc:mga07m45_100602_c1 | nmdc:mga07m45_100602_c1_710_1057 | 106 |
| 178 | 3300054114 | Ga0501084_0055173 | Ga0501084_0055173_1752_2102 | 106 |
| 179 | 3300054114 | Ga0501084_0789052 | Ga0501084_0789052_322_651 | 106 |
| 180 | 3300005329 | Ga0070683_100024294 | Ga0070683_1000242945 | 107 |
| 181 | 3300005330 | Ga0070690_100015961 | Ga0070690_1000159614 | 107 |
| 182 | 3300005331 | Ga0070670_100227913 | Ga0070670_1002279133 | 107 |
| 183 | 3300005334 | Ga0068869_100177526 | Ga0068869_1001775262 | 107 |
| 184 | 3300005335 | Ga0070666_10001845 | Ga0070666_1000184514 | 107 |
| 185 | 3300005336 | Ga0070680_100481513 | Ga0070680_1004815132 | 107 |
| 186 | 3300005337 | Ga0070682_100005374 | Ga0070682_1000053747 | 107 |
| 187 | 3300005338 | Ga0068868_100062889 | Ga0068868_1000628892 | 107 |
| 188 | 3300005339 | Ga0070660_100134875 | Ga0070660_1001348752 | 107 |
| 189 | 3300005339 | Ga0070660_101246996 | Ga0070660_1012469961 | 107 |
| 190 | 3300005340 | Ga0070689_100028158 | Ga0070689_1000281583 | 107 |
| 191 | 3300005341 | Ga0070691_10030524 | Ga0070691_100305242 | 107 |
| 192 | 3300005344 | Ga0070661_100029342 | Ga0070661_1000293423 | 107 |
| 193 | 3300005344 | Ga0070661_100194517 | Ga0070661_1001945172 | 107 |
| 194 | 3300005347 | Ga0070668_101345143 | Ga0070668_1013451432 | 107 |
| 195 | 3300005353 | Ga0070669_101683074 | Ga0070669_1016830741 | 107 |
| 196 | 3300005355 | Ga0070671_100012503 | Ga0070671_1000125039 | 107 |
| 197 | 3300005355 | Ga0070671_100030107 | Ga0070671_1000301072 | 107 |
| 198 | 3300005356 | Ga0070674_100312877 | Ga0070674_1003128771 | 107 |
| 199 | 3300005356 | Ga0070674_100759777 | Ga0070674_1007597771 | 107 |
| 200 | 3300005364 | Ga0070673_100015672 | Ga0070673_1000156726 | 107 |
| 201 | 3300005364 | Ga0070673_100423709 | Ga0070673_1004237092 | 107 |
| 202 | 3300005365 | Ga0070688_100050062 | Ga0070688_1000500623 | 107 |
| 203 | 3300005366 | Ga0070659_100125952 | Ga0070659_1001259522 | 107 |
| 204 | 3300005366 | Ga0070659_101690328 | Ga0070659_1016903282 | 107 |
| 205 | 3300005367 | Ga0070667_100004611 | Ga0070667_10000461114 | 107 |
| 206 | 3300005367 | Ga0070667_100422221 | Ga0070667_1004222212 | 107 |
| 207 | 3300005434 | Ga0070709_10000798 | Ga0070709_1000079816 | 107 |
| 208 | 3300005434 | Ga0070709_10833557 | Ga0070709_108335572 | 107 |
| 209 | 3300005435 | Ga0070714_100012792 | Ga0070714_1000127929 | 107 |
| 210 | 3300005436 | Ga0070713_100000542 | Ga0070713_10000054214 | 107 |
| 211 | 3300005436 | Ga0070713_100647088 | Ga0070713_1006470882 | 107 |
| 212 | 3300005437 | Ga0070710_10248491 | Ga0070710_102484912 | 107 |
| 213 | 3300005439 | Ga0070711_100006269 | Ga0070711_1000062699 | 107 |
| 214 | 3300005440 | Ga0070705_100175597 | Ga0070705_1001755972 | 107 |
| 215 | 3300005440 | Ga0070705_100965166 | Ga0070705_1009651662 | 107 |
| 216 | 3300005444 | Ga0070694_101688235 | Ga0070694_1016882351 | 107 |
| 217 | 3300005455 | Ga0070663_100001077 | Ga0070663_10000107711 | 107 |
| 218 | 3300005455 | Ga0070663_100008134 | Ga0070663_1000081347 | 107 |
| 219 | 3300005455 | Ga0070663_101602072 | Ga0070663_1016020721 | 107 |
| 220 | 3300005456 | Ga0070678_100003061 | Ga0070678_1000030617 | 107 |
| 221 | 3300005456 | Ga0070678_100005803 | Ga0070678_1000058032 | 107 |
| 222 | 3300005457 | Ga0070662_100085546 | Ga0070662_1000855462 | 107 |
| 223 | 3300005457 | Ga0070662_100425524 | Ga0070662_1004255242 | 107 |
| 224 | 3300005458 | Ga0070681_10023237 | Ga0070681_100232377 | 107 |
| 225 | 3300005458 | Ga0070681_10290090 | Ga0070681_102900902 | 107 |
| 226 | 3300005459 | Ga0068867_100145840 | Ga0068867_1001458402 | 107 |
| 227 | 3300005466 | Ga0070685_10062073 | Ga0070685_100620732 | 107 |
| 228 | 3300005530 | Ga0070679_100034212 | Ga0070679_1000342122 | 107 |
| 229 | 3300005535 | Ga0070684_100165058 | Ga0070684_1001650583 | 107 |
| 230 | 3300005535 | Ga0070684_100440138 | Ga0070684_1004401382 | 107 |
| 231 | 3300005536 | Ga0070697_100243808 | Ga0070697_1002438083 | 107 |
| 232 | 3300005536 | Ga0070697_101478042 | Ga0070697_1014780421 | 107 |
| 233 | 3300005539 | Ga0068853_100446759 | Ga0068853_1004467592 | 107 |
| 234 | 3300005544 | Ga0070686_100022150 | Ga0070686_1000221503 | 107 |
| 235 | 3300005544 | Ga0070686_100498409 | Ga0070686_1004984091 | 107 |
| 236 | 3300005545 | Ga0070695_100086031 | Ga0070695_1000860313 | 107 |
| 237 | 3300005546 | Ga0070696_100062647 | Ga0070696_1000626474 | 107 |
| 238 | 3300005547 | Ga0070693_100290881 | Ga0070693_1002908812 | 107 |
| 239 | 3300005547 | Ga0070693_100444723 | Ga0070693_1004447231 | 107 |
| 240 | 3300005548 | Ga0070665_100058836 | Ga0070665_1000588365 | 107 |
| 241 | 3300005548 | Ga0070665_100286928 | Ga0070665_1002869282 | 107 |
| 242 | 3300005563 | Ga0068855_100212502 | Ga0068855_1002125023 | 107 |
| 243 | 3300005564 | Ga0070664_100059899 | Ga0070664_1000598993 | 107 |
| 244 | 3300005614 | Ga0068856_100230628 | Ga0068856_1002306282 | 107 |
| 245 | 3300005615 | Ga0070702_100011277 | Ga0070702_1000112777 | 107 |
| 246 | 3300005617 | Ga0068859_100008370 | Ga0068859_1000083702 | 107 |
| 247 | 3300005618 | Ga0068864_100001336 | Ga0068864_10000133612 | 107 |
| 248 | 3300005718 | Ga0068866_10400484 | Ga0068866_104004842 | 107 |
| 249 | 3300005718 | Ga0068866_10767941 | Ga0068866_107679412 | 107 |
| 250 | 3300005719 | Ga0068861_101176745 | Ga0068861_1011767452 | 107 |
| 251 | 3300005841 | Ga0068863_100116063 | Ga0068863_1001160633 | 107 |
| 252 | 3300005842 | Ga0068858_100015809 | Ga0068858_1000158099 | 107 |
| 253 | 3300005842 | Ga0068858_100818922 | Ga0068858_1008189222 | 107 |
| 254 | 3300005843 | Ga0068860_100044761 | Ga0068860_1000447613 | 107 |
| 255 | 3300005983 | Ga0081540_1018027 | Ga0081540_10180273 | 107 |
| 256 | 3300006028 | Ga0070717_10000891 | Ga0070717_1000089117 | 107 |
| 257 | 3300006028 | Ga0070717_10386848 | Ga0070717_103868482 | 107 |
| 258 | 3300006163 | Ga0070715_10000188 | Ga0070715_1000018811 | 107 |
| 259 | 3300006173 | Ga0070716_100000070 | Ga0070716_10000007024 | 107 |
| 260 | 3300006175 | Ga0070712_100019782 | Ga0070712_1000197827 | 107 |
| 261 | 3300006175 | Ga0070712_100139521 | Ga0070712_1001395213 | 107 |
| 262 | 3300006237 | Ga0097621_100006935 | Ga0097621_1000069353 | 107 |
| 263 | 3300006237 | Ga0097621_100007158 | Ga0097621_10000715812 | 107 |
| 264 | 3300006237 | Ga0097621_100796151 | Ga0097621_1007961512 | 107 |
| 265 | 3300006358 | Ga0068871_100005085 | Ga0068871_1000050853 | 107 |
| 266 | 3300006358 | Ga0068871_100165352 | Ga0068871_1001653522 | 107 |
| 267 | 3300006871 | Ga0075434_100099484 | Ga0075434_1000994844 | 107 |
| 268 | 3300006871 | Ga0075434_101539846 | Ga0075434_1015398462 | 107 |
| 269 | 3300006881 | Ga0068865_100002800 | Ga0068865_1000028009 | 107 |
| 270 | 3300006881 | Ga0068865_100197497 | Ga0068865_1001974972 | 107 |
| 271 | 3300006914 | Ga0075436_101248250 | Ga0075436_1012482502 | 107 |
| 272 | 3300006931 | Ga0097620_100008370 | Ga0097620_1000083702 | 107 |
| 273 | 3300007076 | Ga0075435_100133897 | Ga0075435_1001338973 | 107 |
| 274 | 3300007076 | Ga0075435_100756761 | Ga0075435_1007567612 | 107 |
| 275 | 3300007076 | Ga0075435_101373399 | Ga0075435_1013733992 | 107 |
| 276 | 3300009011 | Ga0105251_10014272 | Ga0105251_100142722 | 107 |
| 277 | 3300009092 | Ga0105250_10293755 | Ga0105250_102937552 | 107 |
| 278 | 3300009093 | Ga0105240_10631185 | Ga0105240_106311852 | 107 |
| 279 | 3300009093 | Ga0105240_11475007 | Ga0105240_114750072 | 107 |
| 280 | 3300009098 | Ga0105245_10850549 | Ga0105245_108505493 | 107 |
| 281 | 3300009101 | Ga0105247_10167680 | Ga0105247_101676802 | 107 |
| 282 | 3300009101 | Ga0105247_10257587 | Ga0105247_102575872 | 107 |
| 283 | 3300009148 | Ga0105243_10064491 | Ga0105243_100644914 | 107 |
| 284 | 3300009148 | Ga0105243_10179160 | Ga0105243_101791602 | 107 |
| 285 | 3300009174 | Ga0105241_10173175 | Ga0105241_101731752 | 107 |
| 286 | 3300009174 | Ga0105241_10193833 | Ga0105241_101938333 | 107 |
| 287 | 3300009176 | Ga0105242_10009490 | Ga0105242_100094908 | 107 |
| 288 | 3300009176 | Ga0105242_10089852 | Ga0105242_100898524 | 107 |
| 289 | 3300009176 | Ga0105242_10667567 | Ga0105242_106675672 | 107 |
| 290 | 3300009177 | Ga0105248_10037690 | Ga0105248_100376907 | 107 |
| 291 | 3300009177 | Ga0105248_11055547 | Ga0105248_110555472 | 107 |
| 292 | 3300009545 | Ga0105237_10064619 | Ga0105237_100646193 | 107 |
| 293 | 3300009551 | Ga0105238_10123111 | Ga0105238_101231112 | 107 |
| 294 | 3300009551 | Ga0105238_11654328 | Ga0105238_116543282 | 107 |
| 295 | 3300009553 | Ga0105249_10137916 | Ga0105249_101379163 | 107 |
| 296 | 3300010375 | Ga0105239_10507042 | Ga0105239_105070422 | 107 |
| 297 | 3300011119 | Ga0105246_10101648 | Ga0105246_101016483 | 107 |
| 298 | 3300012495 | Ga0157323_1000389 | Ga0157323_10003891 | 107 |
| 299 | 3300013104 | Ga0157370_10746637 | Ga0157370_107466372 | 107 |
| 300 | 3300013105 | Ga0157369_10975958 | Ga0157369_109759582 | 107 |
| 301 | 3300013296 | Ga0157374_10153623 | Ga0157374_101536233 | 107 |
| 302 | 3300013296 | Ga0157374_10320240 | Ga0157374_103202402 | 107 |
| 303 | 3300013297 | Ga0157378_10064887 | Ga0157378_100648873 | 107 |
| 304 | 3300013297 | Ga0157378_13039760 | Ga0157378_130397602 | 107 |
| 305 | 3300013306 | Ga0163162_10082383 | Ga0163162_100823833 | 107 |
| 306 | 3300013307 | Ga0157372_13017437 | Ga0157372_130174371 | 107 |
| 307 | 3300013308 | Ga0157375_10110412 | Ga0157375_101104122 | 107 |
| 308 | 3300013308 | Ga0157375_10632575 | Ga0157375_106325752 | 107 |
| 309 | 3300014325 | Ga0163163_10325815 | Ga0163163_103258152 | 107 |
| 310 | 3300014326 | Ga0157380_11091251 | Ga0157380_110912512 | 107 |
| 311 | 3300014497 | Ga0182008_10529302 | Ga0182008_105293022 | 107 |
| 312 | 3300014745 | Ga0157377_10298185 | Ga0157377_102981852 | 107 |
| 313 | 3300014968 | Ga0157379_10013763 | Ga0157379_100137636 | 107 |
| 314 | 3300014968 | Ga0157379_11388392 | Ga0157379_113883922 | 107 |
| 315 | 3300014969 | Ga0157376_10031023 | Ga0157376_100310234 | 107 |
| 316 | 3300014969 | Ga0157376_10309177 | Ga0157376_103091772 | 107 |
| 317 | 3300014969 | Ga0157376_12510475 | Ga0157376_125104752 | 107 |
| 318 | 3300017792 | Ga0163161_10888949 | Ga0163161_108889492 | 107 |
| 319 | 3300025735 | Ga0207713_1235890 | Ga0207713_12358902 | 107 |
| 320 | 3300025898 | Ga0207692_10001836 | Ga0207692_100018365 | 107 |
| 321 | 3300025899 | Ga0207642_10249287 | Ga0207642_102492872 | 107 |
| 322 | 3300025900 | Ga0207710_10065884 | Ga0207710_100658844 | 107 |
| 323 | 3300025900 | Ga0207710_10078216 | Ga0207710_100782163 | 107 |
| 324 | 3300025903 | Ga0207680_10016289 | Ga0207680_100162894 | 107 |
| 325 | 3300025903 | Ga0207680_10704822 | Ga0207680_107048221 | 107 |
| 326 | 3300025905 | Ga0207685_10036983 | Ga0207685_100369833 | 107 |
| 327 | 3300025905 | Ga0207685_10054294 | Ga0207685_100542942 | 107 |
| 328 | 3300025905 | Ga0207685_10364049 | Ga0207685_103640492 | 107 |
| 329 | 3300025906 | Ga0207699_10002738 | Ga0207699_1000273810 | 107 |
| 330 | 3300025906 | Ga0207699_10102763 | Ga0207699_101027632 | 107 |
| 331 | 3300025907 | Ga0207645_10152717 | Ga0207645_101527173 | 107 |
| 332 | 3300025911 | Ga0207654_10168874 | Ga0207654_101688742 | 107 |
| 333 | 3300025911 | Ga0207654_11305850 | Ga0207654_113058501 | 107 |
| 334 | 3300025912 | Ga0207707_10339172 | Ga0207707_103391723 | 107 |
| 335 | 3300025912 | Ga0207707_10680308 | Ga0207707_106803081 | 107 |
| 336 | 3300025913 | Ga0207695_10438315 | Ga0207695_104383152 | 107 |
| 337 | 3300025915 | Ga0207693_10001091 | Ga0207693_1000109114 | 107 |
| 338 | 3300025915 | Ga0207693_10058837 | Ga0207693_100588373 | 107 |
| 339 | 3300025916 | Ga0207663_10017295 | Ga0207663_100172953 | 107 |
| 340 | 3300025917 | Ga0207660_10820983 | Ga0207660_108209832 | 107 |
| 341 | 3300025917 | Ga0207660_10953499 | Ga0207660_109534992 | 107 |
| 342 | 3300025919 | Ga0207657_10032820 | Ga0207657_100328203 | 107 |
| 343 | 3300025919 | Ga0207657_10129524 | Ga0207657_101295242 | 107 |
| 344 | 3300025920 | Ga0207649_10036286 | Ga0207649_100362864 | 107 |
| 345 | 3300025924 | Ga0207694_10685254 | Ga0207694_106852542 | 107 |
| 346 | 3300025924 | Ga0207694_10797339 | Ga0207694_107973392 | 107 |
| 347 | 3300025925 | Ga0207650_10017784 | Ga0207650_100177847 | 107 |
| 348 | 3300025927 | Ga0207687_10004918 | Ga0207687_100049188 | 107 |
| 349 | 3300025927 | Ga0207687_10617694 | Ga0207687_106176942 | 107 |
| 350 | 3300025928 | Ga0207700_10000314 | Ga0207700_1000031427 | 107 |
| 351 | 3300025928 | Ga0207700_10637220 | Ga0207700_106372202 | 107 |
| 352 | 3300025929 | Ga0207664_10046843 | Ga0207664_100468434 | 107 |
| 353 | 3300025929 | Ga0207664_10155592 | Ga0207664_101555923 | 107 |
| 354 | 3300025931 | Ga0207644_10003205 | Ga0207644_100032053 | 107 |
| 355 | 3300025931 | Ga0207644_10088588 | Ga0207644_100885884 | 107 |
| 356 | 3300025932 | Ga0207690_10242953 | Ga0207690_102429533 | 107 |
| 357 | 3300025933 | Ga0207706_10012582 | Ga0207706_100125822 | 107 |
| 358 | 3300025933 | Ga0207706_10322961 | Ga0207706_103229611 | 107 |
| 359 | 3300025934 | Ga0207686_10026756 | Ga0207686_100267563 | 107 |
| 360 | 3300025934 | Ga0207686_10263226 | Ga0207686_102632262 | 107 |
| 361 | 3300025935 | Ga0207709_10305998 | Ga0207709_103059982 | 107 |
| 362 | 3300025935 | Ga0207709_10556349 | Ga0207709_105563492 | 107 |
| 363 | 3300025936 | Ga0207670_10002509 | Ga0207670_100025093 | 107 |
| 364 | 3300025937 | Ga0207669_10268392 | Ga0207669_102683922 | 107 |
| 365 | 3300025937 | Ga0207669_11118101 | Ga0207669_111181012 | 107 |
| 366 | 3300025938 | Ga0207704_10036589 | Ga0207704_100365892 | 107 |
| 367 | 3300025938 | Ga0207704_10200876 | Ga0207704_102008761 | 107 |
| 368 | 3300025939 | Ga0207665_10001714 | Ga0207665_1000171410 | 107 |
| 369 | 3300025939 | Ga0207665_10099467 | Ga0207665_100994672 | 107 |
| 370 | 3300025941 | Ga0207711_10005059 | Ga0207711_1000505910 | 107 |
| 371 | 3300025941 | Ga0207711_10088567 | Ga0207711_100885672 | 107 |
| 372 | 3300025942 | Ga0207689_10071654 | Ga0207689_100716543 | 107 |
| 373 | 3300025944 | Ga0207661_10121150 | Ga0207661_101211502 | 107 |
| 374 | 3300025945 | Ga0207679_10080039 | Ga0207679_100800392 | 107 |
| 375 | 3300025949 | Ga0207667_10634180 | Ga0207667_106341802 | 107 |
| 376 | 3300025960 | Ga0207651_10403617 | Ga0207651_104036172 | 107 |
| 377 | 3300025960 | Ga0207651_10482261 | Ga0207651_104822612 | 107 |
| 378 | 3300025986 | Ga0207658_10514358 | Ga0207658_105143582 | 107 |
| 379 | 3300026023 | Ga0207677_10008719 | Ga0207677_100087194 | 107 |
| 380 | 3300026035 | Ga0207703_10018194 | Ga0207703_100181942 | 107 |
| 381 | 3300026041 | Ga0207639_10649741 | Ga0207639_106497411 | 107 |
| 382 | 3300026041 | Ga0207639_12239151 | Ga0207639_122391512 | 107 |
| 383 | 3300026067 | Ga0207678_10001936 | Ga0207678_1000193618 | 107 |
| 384 | 3300026067 | Ga0207678_10077251 | Ga0207678_100772514 | 107 |
| 385 | 3300026067 | Ga0207678_10184414 | Ga0207678_101844143 | 107 |
| 386 | 3300026088 | Ga0207641_10036929 | Ga0207641_100369297 | 107 |
| 387 | 3300026095 | Ga0207676_10005005 | Ga0207676_100050058 | 107 |
| 388 | 3300026118 | Ga0207675_100169850 | Ga0207675_1001698502 | 107 |
| 389 | 3300026121 | Ga0207683_10002621 | Ga0207683_100026218 | 107 |
| 390 | 3300026121 | Ga0207683_10115371 | Ga0207683_101153712 | 107 |
| 391 | 3300028379 | Ga0268266_10064928 | Ga0268266_100649283 | 107 |
| 392 | 3300028379 | Ga0268266_10781507 | Ga0268266_107815072 | 107 |
| 393 | 3300028381 | Ga0268264_10109244 | Ga0268264_101092442 | 107 |
| 394 | 3300028556 | Ga0265337_1030134 | Ga0265337_10301342 | 107 |
| 395 | 3300029957 | Ga0265324_10134480 | Ga0265324_101344802 | 107 |
| 396 | 3300031241 | Ga0265325_10002931 | Ga0265325_100029318 | 107 |
| 397 | 3300031241 | Ga0265325_10318279 | Ga0265325_103182792 | 107 |
| 398 | 3300031249 | Ga0265339_10002519 | Ga0265339_100025198 | 107 |
| 399 | 3300031344 | Ga0265316_10075468 | Ga0265316_100754683 | 107 |
| 400 | 3300031595 | Ga0265313_10001997 | Ga0265313_1000199718 | 107 |
| 401 | 3300031711 | Ga0265314_10014930 | Ga0265314_100149303 | 107 |
| 402 | 3300032133 | Ga0316583_10005292 | Ga0316583_100052925 | 107 |
| 403 | 3300035086 | Ga0373934_0102650 | Ga0373934_0102650_707_1036 | 107 |
| 404 | 3300035089 | Ga0373944_0072089 | Ga0373944_0072089_593_922 | 107 |
| 405 | 3300035111 | Ga0373923_0101355 | Ga0373923_0101355_380_709 | 107 |
| 406 | 3300035112 | Ga0373932_0080290 | Ga0373932_0080290_32_361 | 107 |
| 407 | 3300035112 | Ga0373932_0282086 | Ga0373932_0282086_18_347 | 107 |
| 408 | 3300035113 | Ga0373936_0160207 | Ga0373936_0160207_240_569 | 107 |
| 409 | 3300035116 | Ga0373945_0010904 | Ga0373945_0010904_463_792 | 107 |
| 410 | 3300035117 | Ga0373953_0026843 | Ga0373953_0026843_1484_1813 | 107 |
| 411 | 3300035118 | Ga0373954_0305248 | Ga0373954_0305248_253_582 | 107 |
| 412 | 3300035119 | Ga0373956_0032535 | Ga0373956_0032535_377_706 | 107 |
| 413 | 3300035171 | Ga0373946_0055982 | Ga0373946_0055982_269_598 | 107 |
| 414 | 3300035172 | Ga0373955_0181984 | Ga0373955_0181984_360_689 | 107 |
| 415 | 3300035172 | Ga0373955_0242322 | Ga0373955_0242322_203_532 | 107 |
| 416 | 3300035207 | Ga0373942_0126734 | Ga0373942_0126734_55_384 | 107 |
| 417 | 3300035410 | Ga0373924_0008269 | Ga0373924_0008269_3287_3616 | 107 |
| 418 | 3300035692 | Ga0373935_0497899 | Ga0373935_0497899_354_683 | 107 |
| 419 | 3300035695 | Ga0373927_0232431 | Ga0373927_0232431_643_972 | 107 |
| 420 | 3300035724 | Ga0373933_0665966 | Ga0373933_0665966_103_432 | 107 |
| 421 | 3300035725 | Ga0373947_0151815 | Ga0373947_0151815_215_544 | 107 |
| 422 | 3300036401 | Ga0373937_0093558 | Ga0373937_0093558_1610_1939 | 107 |
| 423 | 3300036401 | Ga0373937_0465594 | Ga0373937_0465594_426_755 | 107 |
| 424 | 3300036401 | Ga0373937_1892354 | Ga0373937_1892354_114_443 | 107 |
| 425 | 3300037068 | Ga0373925_0310543 | Ga0373925_0310543_384_713 | 107 |
| 426 | 3300037312 | Ga0395899_0148014 | Ga0395899_0148014_1010_1339 | 107 |
| 427 | 3300037418 | Ga0395900_0008079 | Ga0395900_0008079_9408_9737 | 107 |
| 428 | 3300037418 | Ga0395900_0683643 | Ga0395900_0683643_346_675 | 107 |
| 429 | 3300037466 | Ga0395898_0002839 | Ga0395898_0002839_15135_15464 | 107 |
| 430 | 3300037466 | Ga0395898_0191808 | Ga0395898_0191808_686_1015 | 107 |
| 431 | 3300037466 | Ga0395898_0951807 | Ga0395898_0951807_334_663 | 107 |
| 432 | 3300038443 | Ga0395901_0612312 | Ga0395901_0612312_534_863 | 107 |
| 433 | 3300046454 | Ga0495592_0013052 | Ga0495592_0013052_4607_4936 | 107 |
| 434 | 3300046454 | Ga0495592_0400810 | Ga0495592_0400810_167_496 | 107 |
| 435 | 3300046455 | Ga0495603_0153108 | Ga0495603_0153108_64_393 | 107 |
| 436 | 3300046459 | Ga0495629_0170224 | Ga0495629_0170224_535_864 | 107 |
| 437 | 3300046463 | Ga0495653_0010489 | Ga0495653_0010489_287_616 | 107 |
| 438 | 3300046472 | Ga0495580_0359205 | Ga0495580_0359205_499_828 | 107 |
| 439 | 3300046476 | Ga0495662_0467258 | Ga0495662_0467258_219_548 | 107 |
| 440 | 3300046476 | Ga0495662_0509396 | Ga0495662_0509396_140_469 | 107 |
| 441 | 3300046477 | Ga0495664_0010463 | Ga0495664_0010463_1047_1376 | 107 |
| 442 | 3300046511 | Ga0495608_0295982 | Ga0495608_0295982_238_567 | 107 |
| 443 | 3300046514 | Ga0495618_0001624 | Ga0495618_0001624_14438_14767 | 107 |
| 444 | 3300046516 | Ga0495628_1049998 | Ga0495628_1049998_126_455 | 107 |
| 445 | 3300046517 | Ga0495630_0183198 | Ga0495630_0183198_758_1087 | 107 |
| 446 | 3300046526 | Ga0495666_0074588 | Ga0495666_0074588_394_723 | 107 |
| 447 | 3300046535 | Ga0495586_0087988 | Ga0495586_0087988_540_869 | 107 |
| 448 | 3300046535 | Ga0495586_0439063 | Ga0495586_0439063_82_411 | 107 |
| 449 | 3300046536 | Ga0495587_0220756 | Ga0495587_0220756_184_513 | 107 |
| 450 | 3300046543 | Ga0495645_0338934 | Ga0495645_0338934_104_433 | 107 |
| 451 | 3300046557 | Ga0495622_0209802 | Ga0495622_0209802_64_393 | 107 |
| 452 | 3300046559 | Ga0495667_0015315 | Ga0495667_0015315_282_611 | 107 |
| 453 | 3300046559 | Ga0495667_0059379 | Ga0495667_0059379_724_1053 | 107 |
| 454 | 3300046642 | Ga0495634_0034949 | Ga0495634_0034949_1484_1813 | 107 |
| 455 | 3300046642 | Ga0495634_0244036 | Ga0495634_0244036_188_517 | 107 |
| 456 | 3300046663 | Ga0495635_0092806 | Ga0495635_0092806_423_752 | 107 |
| 457 | 3300046663 | Ga0495635_0217969 | Ga0495635_0217969_189_518 | 107 |
| 458 | 3300046675 | Ga0495657_0015348 | Ga0495657_0015348_4235_4564 | 107 |
| 459 | 3300046675 | Ga0495657_0192504 | Ga0495657_0192504_599_928 | 107 |
| 460 | 3300046679 | Ga0495623_0077738 | Ga0495623_0077738_1028_1357 | 107 |
| 461 | 3300046680 | Ga0495646_0006600 | Ga0495646_0006600_1027_1356 | 107 |
| 462 | 3300046680 | Ga0495646_0315715 | Ga0495646_0315715_399_728 | 107 |
| 463 | 3300046681 | Ga0495647_0021224 | Ga0495647_0021224_1499_1828 | 107 |
| 464 | 3300046683 | Ga0495658_0161036 | Ga0495658_0161036_366_695 | 107 |
| 465 | 3300046690 | Ga0495624_0029185 | Ga0495624_0029185_798_1127 | 107 |
| 466 | 3300046809 | Ga0495600_0001316 | Ga0495600_0001316_10298_10627 | 107 |
| 467 | 3300046809 | Ga0495600_0251436 | Ga0495600_0251436_274_603 | 107 |
| 468 | 3300047317 | Ga0495604_0069099 | Ga0495604_0069099_1428_1757 | 107 |
| 469 | 3300047317 | Ga0495604_0188544 | Ga0495604_0188544_674_1003 | 107 |
| 470 | 3300047319 | Ga0495674_0182793 | Ga0495674_0182793_1386_1715 | 107 |
| 471 | 3300047319 | Ga0495674_0481780 | Ga0495674_0481780_180_509 | 107 |
| 472 | 3300047319 | Ga0495674_0612573 | Ga0495674_0612573_319_648 | 107 |
| 473 | 3300047321 | Ga0495676_0373812 | Ga0495676_0373812_520_849 | 107 |
| 474 | 3300047321 | Ga0495676_0554001 | Ga0495676_0554001_326_655 | 107 |
| 475 | 3300047322 | Ga0495680_0003716 | Ga0495680_0003716_254_583 | 107 |
| 476 | 3300047322 | Ga0495680_0024306 | Ga0495680_0024306_2475_2804 | 107 |
| 477 | 3300047444 | Ga0495675_0000825 | Ga0495675_0000825_6008_6337 | 107 |
| 478 | 3300047471 | Ga0495684_0159506 | Ga0495684_0159506_105_434 | 107 |
| 479 | 3300047673 | Ga0495593_0042336 | Ga0495593_0042336_1715_2044 | 107 |
| 480 | 3300047673 | Ga0495593_0403932 | Ga0495593_0403932_312_641 | 107 |
| 481 | 3300048088 | Ga0495602_0047335 | Ga0495602_0047335_3115_3444 | 107 |
| 482 | 3300048088 | Ga0495602_0445207 | Ga0495602_0445207_85_414 | 107 |
| 483 | 3300048088 | Ga0495602_0718906 | Ga0495602_0718906_118_447 | 107 |
| 484 | 3300048089 | Ga0495614_0064643 | Ga0495614_0064643_320_649 | 107 |
| 485 | 3300048903 | Ga0496100_0062943 | Ga0496100_0062943_479_808 | 107 |
| 486 | 3300048903 | Ga0496100_0324919 | Ga0496100_0324919_427_756 | 107 |
| 487 | 3300048904 | Ga0496101_0022527 | Ga0496101_0022527_1031_1360 | 107 |
| 488 | 3300048904 | Ga0496101_0162093 | Ga0496101_0162093_1038_1367 | 107 |
| 489 | 3300048905 | Ga0496102_0002969 | Ga0496102_0002969_2529_2858 | 107 |
| 490 | 3300048905 | Ga0496102_0065885 | Ga0496102_0065885_903_1232 | 107 |
| 491 | 3300048905 | Ga0496102_0869405 | Ga0496102_0869405_280_609 | 107 |
| 492 | 3300048906 | Ga0496103_0013630 | Ga0496103_0013630_4067_4396 | 107 |
| 493 | 3300048906 | Ga0496103_0189205 | Ga0496103_0189205_768_1097 | 107 |
| 494 | 3300048906 | Ga0496103_0869857 | Ga0496103_0869857_144_473 | 107 |
| 495 | 3300048907 | Ga0496104_0018106 | Ga0496104_0018106_4267_4596 | 107 |
| 496 | 3300048907 | Ga0496104_0100591 | Ga0496104_0100591_427_756 | 107 |
| 497 | 3300048907 | Ga0496104_1679867 | Ga0496104_1679867_80_409 | 107 |
| 498 | 3300048908 | Ga0496105_0009940 | Ga0496105_0009940_4075_4404 | 107 |
| 499 | 3300048908 | Ga0496105_0614218 | Ga0496105_0614218_87_416 | 107 |
| 500 | 3300048909 | Ga0496106_0078833 | Ga0496106_0078833_425_754 | 107 |
| 501 | 3300048909 | Ga0496106_0134955 | Ga0496106_0134955_1537_1866 | 107 |
| 502 | 3300048909 | Ga0496106_0364752 | Ga0496106_0364752_17_346 | 107 |
| 503 | 3300048910 | Ga0496107_0023256 | Ga0496107_0023256_874_1203 | 107 |
| 504 | 3300048910 | Ga0496107_0142662 | Ga0496107_0142662_205_534 | 107 |
| 505 | 3300048910 | Ga0496107_1214975 | Ga0496107_1214975_141_470 | 107 |
| 506 | 3300048911 | Ga0496108_0136032 | Ga0496108_0136032_449_778 | 107 |
| 507 | 3300048911 | Ga0496108_0841044 | Ga0496108_0841044_390_719 | 107 |
| 508 | 3300048912 | Ga0496109_0042909 | Ga0496109_0042909_3699_4028 | 107 |
| 509 | 3300048912 | Ga0496109_0257680 | Ga0496109_0257680_1198_1527 | 107 |
| 510 | 3300048913 | Ga0496110_0042096 | Ga0496110_0042096_2663_2992 | 107 |
| 511 | 3300048914 | Ga0496111_0181927 | Ga0496111_0181927_785_1114 | 107 |
| 512 | 3300048915 | Ga0496112_0055254 | Ga0496112_0055254_1796_2125 | 107 |
| 513 | 3300048916 | Ga0496113_0892186 | Ga0496113_0892186_234_563 | 107 |
| 514 | 3300048916 | Ga0496113_1506776 | Ga0496113_1506776_109_438 | 107 |
| 515 | 3300048917 | Ga0496114_0006050 | Ga0496114_0006050_8162_8491 | 107 |
| 516 | 3300048917 | Ga0496114_0008678 | Ga0496114_0008678_7336_7665 | 107 |
| 517 | 3300048918 | Ga0496115_0122847 | Ga0496115_0122847_1785_2114 | 107 |
| 518 | 3300048918 | Ga0496115_0171803 | Ga0496115_0171803_277_606 | 107 |
| 519 | 3300048918 | Ga0496115_0257790 | Ga0496115_0257790_657_986 | 107 |
| 520 | 3300048918 | Ga0496115_0286968 | Ga0496115_0286968_341_670 | 107 |
| 521 | 3300048924 | Ga0496121_0101767 | Ga0496121_0101767_1788_2117 | 107 |
| 522 | 3300048928 | Ga0496125_0179316 | Ga0496125_0179316_528_857 | 107 |
| 523 | 3300048929 | Ga0496126_1036985 | Ga0496126_1036985_167_496 | 107 |
| 524 | 3300049744 | Ga0501083_0990206 | Ga0501083_0990206_19_348 | 107 |
| 525 | 3300050490 | nmdc:mga03n38_927435_c1 | nmdc:mga03n38_927435_c1_121_450 | 107 |
| 526 | 3300050512 | nmdc:mga0n895_107131_c1 | nmdc:mga0n895_107131_c1_2285_2614 | 107 |
| 527 | 3300050512 | nmdc:mga0n895_935902_c1 | nmdc:mga0n895_935902_c1_233_562 | 107 |
| 528 | 3300050513 | nmdc:mga0rr50_558984_c1 | nmdc:mga0rr50_558984_c1_588_917 | 107 |
| 529 | 3300050514 | nmdc:mga08x19_1300533_c1 | nmdc:mga08x19_1300533_c1_16_345 | 107 |
| 530 | 3300053077 | Ga0495601_0007672 | Ga0495601_0007672_2667_2996 | 107 |
| 531 | 3300053077 | Ga0495601_0079803 | Ga0495601_0079803_1666_1995 | 107 |
| 532 | 3300053078 | Ga0495612_0016931 | Ga0495612_0016931_2155_2484 | 107 |
| 533 | 3300053084 | Ga0495595_0003291 | Ga0495595_0003291_3249_3578 | 107 |
| 534 | 3300053084 | Ga0495595_0008792 | Ga0495595_0008792_3727_4056 | 107 |
| 535 | 3300053085 | Ga0495619_0000468 | Ga0495619_0000468_14196_14525 | 107 |
| 536 | 3300003320 | rootH2_10176943 | rootH2_101769433 | 108 |
| 537 | 3300005336 | Ga0070680_100641908 | Ga0070680_1006419081 | 108 |
| 538 | 3300005457 | Ga0070662_100380281 | Ga0070662_1003802812 | 108 |
| 539 | 3300005458 | Ga0070681_11718537 | Ga0070681_117185372 | 108 |
| 540 | 3300005530 | Ga0070679_100889898 | Ga0070679_1008898981 | 108 |
| 541 | 3300005564 | Ga0070664_100359794 | Ga0070664_1003597942 | 108 |
| 542 | 3300005614 | Ga0068856_100895798 | Ga0068856_1008957982 | 108 |
| 543 | 3300009147 | Ga0114129_10535068 | Ga0114129_105350682 | 108 |
| 544 | 3300021384 | Ga0213876_10042234 | Ga0213876_100422343 | 108 |
| 545 | 3300026078 | Ga0207702_10543384 | Ga0207702_105433842 | 108 |
| 546 | 3300028556 | Ga0265337_1015558 | Ga0265337_10155584 | 108 |
| 547 | 3300031238 | Ga0265332_10098849 | Ga0265332_100988491 | 108 |
| 548 | 3300031249 | Ga0265339_10283001 | Ga0265339_102830012 | 108 |
| 549 | 3300031344 | Ga0265316_10017290 | Ga0265316_100172903 | 108 |
| 550 | 3300031595 | Ga0265313_10112032 | Ga0265313_101120322 | 108 |
| 551 | 3300031911 | Ga0307412_12149219 | Ga0307412_121492192 | 108 |
| 552 | 3300035086 | Ga0373934_0024821 | Ga0373934_0024821_166_501 | 108 |
| 553 | 3300035118 | Ga0373954_0027925 | Ga0373954_0027925_1307_1642 | 108 |
| 554 | 3300035119 | Ga0373956_0055566 | Ga0373956_0055566_1108_1443 | 108 |
| 555 | 3300035410 | Ga0373924_0146308 | Ga0373924_0146308_114_449 | 108 |
| 556 | 3300035724 | Ga0373933_0021842 | Ga0373933_0021842_1449_1784 | 108 |
| 557 | 3300036401 | Ga0373937_0055703 | Ga0373937_0055703_1789_2124 | 108 |
| 558 | 3300039437 | Ga0436365_0184640 | Ga0436365_0184640_1589_1939 | 108 |
| 559 | 3300039453 | Ga0436362_0414516 | Ga0436362_0414516_68_418 | 108 |
| 560 | 3300046462 | Ga0495651_0205743 | Ga0495651_0205743_1023_1358 | 108 |
| 561 | 3300046511 | Ga0495608_0062219 | Ga0495608_0062219_620_955 | 108 |
| 562 | 3300046516 | Ga0495628_1183126 | Ga0495628_1183126_107_442 | 108 |
| 563 | 3300046559 | Ga0495667_0070675 | Ga0495667_0070675_1357_1692 | 108 |
| 564 | 3300046663 | Ga0495635_0599486 | Ga0495635_0599486_177_512 | 108 |
| 565 | 3300046675 | Ga0495657_0150852 | Ga0495657_0150852_1043_1378 | 108 |
| 566 | 3300046809 | Ga0495600_0047790 | Ga0495600_0047790_1565_1900 | 108 |
| 567 | 3300047322 | Ga0495680_0672165 | Ga0495680_0672165_251_586 | 108 |
| 568 | 3300048088 | Ga0495602_0606782 | Ga0495602_0606782_22_357 | 108 |
| 569 | 3300049568 | Ga0501031_0026245 | Ga0501031_0026245_3010_3348 | 108 |
| 570 | 3300049569 | Ga0501032_0034439 | Ga0501032_0034439_951_1289 | 108 |
| 571 | 3300049570 | Ga0501033_0006873 | Ga0501033_0006873_133_471 | 108 |
| 572 | 3300049571 | Ga0501034_0091081 | Ga0501034_0091081_2441_2776 | 108 |
| 573 | 3300049571 | Ga0501034_0171946 | Ga0501034_0171946_1115_1453 | 108 |
| 574 | 3300049572 | Ga0501036_0030607 | Ga0501036_0030607_1774_2109 | 108 |
| 575 | 3300049572 | Ga0501036_0207363 | Ga0501036_0207363_1006_1344 | 108 |
| 576 | 3300049573 | Ga0501037_0111993 | Ga0501037_0111993_559_897 | 108 |
| 577 | 3300049574 | Ga0501038_0095544 | Ga0501038_0095544_2100_2438 | 108 |
| 578 | 3300049574 | Ga0501038_0096460 | Ga0501038_0096460_158_493 | 108 |
| 579 | 3300049575 | Ga0501039_0035196 | Ga0501039_0035196_1844_2182 | 108 |
| 580 | 3300049579 | Ga0501043_0156745 | Ga0501043_0156745_1360_1707 | 108 |
| 581 | 3300049581 | Ga0501047_0179216 | Ga0501047_0179216_922_1260 | 108 |
| 582 | 3300049582 | Ga0501048_0209998 | Ga0501048_0209998_619_954 | 108 |
| 583 | 3300049585 | Ga0501069_0004220 | Ga0501069_0004220_6258_6593 | 108 |
| 584 | 3300049586 | Ga0501070_0004243 | Ga0501070_0004243_1337_1672 | 108 |
| 585 | 3300049586 | Ga0501070_0135004 | Ga0501070_0135004_966_1304 | 108 |
| 586 | 3300049586 | Ga0501070_0146014 | Ga0501070_0146014_1491_1826 | 108 |
| 587 | 3300049586 | Ga0501070_0257439 | Ga0501070_0257439_462_809 | 108 |
| 588 | 3300049586 | Ga0501070_0993124 | Ga0501070_0993124_187_519 | 108 |
| 589 | 3300049587 | Ga0501071_0063694 | Ga0501071_0063694_1917_2252 | 108 |
| 590 | 3300049742 | Ga0501080_0276558 | Ga0501080_0276558_519_854 | 108 |
| 591 | 3300049744 | Ga0501083_0444504 | Ga0501083_0444504_336_689 | 108 |
| 592 | 3300049744 | Ga0501083_0883259 | Ga0501083_0883259_73_420 | 108 |
| 593 | 3300049822 | Ga0501035_0001590 | Ga0501035_0001590_15158_15493 | 108 |
| 594 | 3300049822 | Ga0501035_0340700 | Ga0501035_0340700_270_617 | 108 |
| 595 | 3300049823 | Ga0501044_0527036 | Ga0501044_0527036_46_384 | 108 |
| 596 | 3300050507 | nmdc:mga05p37_1066971_c1 | nmdc:mga05p37_1066971_c1_360_710 | 108 |
| 597 | 3300050508 | nmdc:mga09592_1322420_c1 | nmdc:mga09592_1322420_c1_201_551 | 108 |
| 598 | 3300050510 | nmdc:mga06r32_404081_c1 | nmdc:mga06r32_404081_c1_667_1017 | 108 |
| 599 | 3300053077 | Ga0495601_0020464 | Ga0495601_0020464_939_1274 | 108 |
| 600 | 3300053084 | Ga0495595_0090233 | Ga0495595_0090233_923_1258 | 108 |
| 601 | 3300053085 | Ga0495619_0074226 | Ga0495619_0074226_1838_2173 | 108 |
| 602 | 3300053086 | Ga0500578_0152274 | Ga0500578_0152274_592_924 | 108 |
| 603 | 3300053087 | Ga0500643_009268 | Ga0500643_009268_2670_3002 | 108 |
| 604 | 3300053088 | Ga0500644_0000587 | Ga0500644_0000587_9274_9606 | 108 |
| 605 | 3300053090 | Ga0500646_0027538 | Ga0500646_0027538_252_584 | 108 |
| 606 | 3300053094 | Ga0500566_0089080 | Ga0500566_0089080_151_483 | 108 |
| 607 | 3300053117 | Ga0500593_001653 | Ga0500593_001653_4882_5292 | 108 |
| 608 | 3300053119 | Ga0500595_000083 | Ga0500595_000083_2798_3130 | 108 |
| 609 | 3300053130 | Ga0500642_0220330 | Ga0500642_0220330_376_708 | 108 |
| 610 | 3300053131 | Ga0500652_027162 | Ga0500652_027162_379_711 | 108 |
| 611 | 3300053133 | Ga0500655_057967 | Ga0500655_057967_376_708 | 108 |
| 612 | 3300053139 | Ga0500568_0179002 | Ga0500568_0179002_391_723 | 108 |
| 613 | 3300053142 | Ga0500577_0093864 | Ga0500577_0093864_644_976 | 108 |
| 614 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_307987_308319 | 108 |
| 615 | 3300053730 | Ga0500645_000680 | Ga0500645_000680_3046_3378 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar