F469492

General Info

Members Datasets Scaffolds Average Seq Length
615 333 615 109

Family's Representative Sequence

Representative Sequence 3300053117|Ga0500593_001653|Ga0500593_001653_4882_5292
Length 136
Sequence MTTYTSPLATPGASALMQAKQQVNQSLLAQMSPSASKYEAKAKATAQDFEAVFLNQMFQQMFTGINGEGPFGGGPGVGVWRSFLTDEYAKSFAKAGGVGIGDQVYRELIARQSAQTMKAMSAIASKAYAPTAGATP

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
321 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
322 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
323 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
324 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
325 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
326 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
327 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 0
Rhizoplane 5.85
Rhizosphere 85.2
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10176943 3300003320 Bacteria 1144
2 JGI25404J52841_10019331 3300003659 Bacteria 1476
3 Ga0070658_10191871 3300005327 Bacteria 1722
4 Ga0070683_100024294 3300005329 Bacteria 5426
5 Ga0070690_100015961 3300005330 Bacteria 4489
6 Ga0070670_100227913 3300005331 Bacteria 1621
7 Ga0068869_100177526 3300005334 Bacteria 1668
8 Ga0070666_10001845 3300005335 Bacteria 12909
9 Ga0070680_100057441 3300005336 Bacteria 3181
10 Ga0070680_100147989 3300005336 Bacteria 1971
11 Ga0070680_100481513 3300005336 Bacteria 1061
12 Ga0070680_100641908 3300005336 Bacteria 912
13 Ga0070682_100005374 3300005337 Bacteria 7128
14 Ga0070682_101300168 3300005337 Unclassified 618
15 Ga0068868_100062889 3300005338 Bacteria 2943
16 Ga0070660_100123815 3300005339 Bacteria 2065
17 Ga0070660_100134875 3300005339 Bacteria 1978
18 Ga0070660_101246996 3300005339 Bacteria 631
19 Ga0070689_100028158 3300005340 Bacteria 4245
20 Ga0070691_10030524 3300005341 Bacteria 2524
21 Ga0070691_10191087 3300005341 Bacteria 1071
22 Ga0070661_100029342 3300005344 Bacteria 3969
23 Ga0070661_100194517 3300005344 Bacteria 1548
24 Ga0070668_101345143 3300005347 Bacteria 650
25 Ga0070669_101683074 3300005353 Bacteria 553
26 Ga0070671_100012503 3300005355 Bacteria 6836
27 Ga0070671_100030107 3300005355 Bacteria 4479
28 Ga0070674_100312877 3300005356 Bacteria 1256
29 Ga0070674_100759777 3300005356 Bacteria 834
30 Ga0070674_100767620 3300005356 Unclassified 830
31 Ga0070673_100015672 3300005364 Bacteria 5333
32 Ga0070673_100423709 3300005364 Bacteria 1194
33 Ga0070688_100050062 3300005365 Bacteria 2602
34 Ga0070659_100125952 3300005366 Bacteria 2078
35 Ga0070659_101690328 3300005366 Bacteria 566
36 Ga0070667_100004611 3300005367 Bacteria 11574
37 Ga0070667_100422221 3300005367 Bacteria 1216
38 Ga0070709_10000798 3300005434 Bacteria 17596
39 Ga0070709_10833557 3300005434 Bacteria 726
40 Ga0070714_100012792 3300005435 Bacteria 6706
41 Ga0070713_100000542 3300005436 Bacteria 23949
42 Ga0070713_100647088 3300005436 Bacteria 1006
43 Ga0070710_10248491 3300005437 Bacteria 1142
44 Ga0070711_100006269 3300005439 Bacteria 7165
45 Ga0070705_100175597 3300005440 Bacteria 1446
46 Ga0070705_100965166 3300005440 Bacteria 690
47 Ga0070694_101688235 3300005444 Bacteria 539
48 Ga0070663_100001077 3300005455 Bacteria 14953
49 Ga0070663_100008134 3300005455 Bacteria 6433
50 Ga0070663_101602072 3300005455 Bacteria 581
51 Ga0070678_100003061 3300005456 Bacteria 9268
52 Ga0070678_100005803 3300005456 Bacteria 7184
53 Ga0070662_100085546 3300005457 Bacteria 2357
54 Ga0070662_100380281 3300005457 Bacteria 1162
55 Ga0070662_100425524 3300005457 Bacteria 1099
56 Ga0070681_10023237 3300005458 Bacteria 6233
57 Ga0070681_10030981 3300005458 Bacteria 5369
58 Ga0070681_10104130 3300005458 Bacteria 2780
59 Ga0070681_10290090 3300005458 Bacteria 1546
60 Ga0070681_10954326 3300005458 Bacteria 777
61 Ga0070681_11718537 3300005458 Bacteria 554
62 Ga0068867_100145840 3300005459 Bacteria 1855
63 Ga0070685_10062073 3300005466 Bacteria 2190
64 Ga0070685_10223530 3300005466 Bacteria 1235
65 Ga0070679_100007329 3300005530 Bacteria 10305
66 Ga0070679_100034212 3300005530 Bacteria 5035
67 Ga0070679_100228645 3300005530 Bacteria 1820
68 Ga0070679_100889898 3300005530 Bacteria 834
69 Ga0070684_100165058 3300005535 Bacteria 2010
70 Ga0070684_100440138 3300005535 Bacteria 1204
71 Ga0070697_100243808 3300005536 Bacteria 1535
72 Ga0070697_101478042 3300005536 Bacteria 607
73 Ga0068853_100446759 3300005539 Bacteria 1216
74 Ga0068853_101460441 3300005539 Bacteria 662
75 Ga0070686_100022150 3300005544 Bacteria 3782
76 Ga0070686_100498409 3300005544 Bacteria 945
77 Ga0070695_100086031 3300005545 Bacteria 2088
78 Ga0070696_100062647 3300005546 Bacteria 2604
79 Ga0070693_100074436 3300005547 Bacteria 2009
80 Ga0070693_100290881 3300005547 Bacteria 1097
81 Ga0070693_100444723 3300005547 Bacteria 908
82 Ga0070665_100058836 3300005548 Bacteria 3852
83 Ga0070665_100286928 3300005548 Bacteria 1648
84 Ga0070665_100508866 3300005548 Bacteria 1216
85 Ga0068855_100212502 3300005563 Bacteria 2173
86 Ga0070664_100059899 3300005564 Bacteria 3240
87 Ga0070664_100359794 3300005564 Bacteria 1325
88 Ga0070664_101196803 3300005564 Unclassified 717
89 Ga0068854_100907371 3300005578 Bacteria 775
90 Ga0068856_100230628 3300005614 Bacteria 1867
91 Ga0068856_100895798 3300005614 Bacteria 906
92 Ga0070702_100011277 3300005615 Bacteria 4439
93 Ga0070702_100328882 3300005615 Bacteria 1068
94 Ga0068852_101532930 3300005616 Bacteria 689
95 Ga0068859_100008370 3300005617 Bacteria 10482
96 Ga0068864_100001336 3300005618 Bacteria 20519
97 Ga0068866_10400484 3300005718 Bacteria 885
98 Ga0068866_10767941 3300005718 Bacteria 667
99 Ga0068861_100870147 3300005719 Bacteria 851
100 Ga0068861_101176745 3300005719 Bacteria 740
101 Ga0068863_100116063 3300005841 Bacteria 2551
102 Ga0068858_100015809 3300005842 Bacteria 7097
103 Ga0068858_100818922 3300005842 Bacteria 909
104 Ga0068860_100044761 3300005843 Bacteria 4217
105 Ga0081455_10568086 3300005937 Bacteria 746
106 Ga0081540_1000003 3300005983 Bacteria 233942
107 Ga0081540_1018027 3300005983 Bacteria 4346
108 Ga0070717_10000891 3300006028 Bacteria 19776
109 Ga0070717_10386848 3300006028 Bacteria 1255
110 Ga0075368_10019793 3300006042 Bacteria 2542
111 Ga0075368_10328764 3300006042 Bacteria 663
112 Ga0075363_100103151 3300006048 Bacteria 1580
113 Ga0075363_100134699 3300006048 Bacteria 1387
114 Ga0070715_10000188 3300006163 Bacteria 14371
115 Ga0070716_100000070 3300006173 Bacteria 39635
116 Ga0070712_100019782 3300006175 Bacteria 4397
117 Ga0070712_100139521 3300006175 Bacteria 1848
118 Ga0075367_10073816 3300006178 Bacteria 2056
119 Ga0075367_10177133 3300006178 Bacteria 1329
120 Ga0075369_10054146 3300006186 Bacteria 1742
121 Ga0075366_10082514 3300006195 Bacteria 1921
122 Ga0075366_10125959 3300006195 Bacteria 1545
123 Ga0097621_100006935 3300006237 Bacteria 8064
124 Ga0097621_100007158 3300006237 Bacteria 7953
125 Ga0097621_100796151 3300006237 Bacteria 876
126 Ga0097621_101014763 3300006237 Bacteria 776
127 Ga0075370_10139729 3300006353 Bacteria 1416
128 Ga0075370_10538698 3300006353 Bacteria 706
129 Ga0075370_10615018 3300006353 Bacteria 658
130 Ga0068871_100005085 3300006358 Bacteria 9186
131 Ga0068871_100165352 3300006358 Bacteria 1894
132 Ga0068871_100437986 3300006358 Bacteria 1170
133 Ga0075431_100246250 3300006847 Bacteria 1817
134 Ga0075431_100307907 3300006847 Bacteria 1599
135 Ga0075433_10418975 3300006852 Bacteria 1181
136 Ga0075434_100099484 3300006871 Bacteria 2914
137 Ga0075434_100159186 3300006871 Bacteria 2278
138 Ga0075434_101539846 3300006871 Bacteria 674
139 Ga0075429_101436094 3300006880 Bacteria 601
140 Ga0068865_100002800 3300006881 Bacteria 10366
141 Ga0068865_100197497 3300006881 Bacteria 1560
142 Ga0075436_101248250 3300006914 Bacteria 561
143 Ga0097620_100008370 3300006931 Bacteria 10482
144 Ga0075435_100133897 3300007076 Bacteria 2075
145 Ga0075435_100756761 3300007076 Bacteria 845
146 Ga0075435_101248181 3300007076 Bacteria 650
147 Ga0075435_101373399 3300007076 Bacteria 619
148 Ga0099795_10186762 3300007788 Bacteria 868
149 Ga0105251_10014272 3300009011 Bacteria 4404
150 Ga0105250_10293755 3300009092 Bacteria 701
151 Ga0105240_10631185 3300009093 Bacteria 1176
152 Ga0105240_11475007 3300009093 Bacteria 714
153 Ga0105245_10850549 3300009098 Bacteria 952
154 Ga0105245_10889542 3300009098 Bacteria 932
155 Ga0105245_11992105 3300009098 Bacteria 634
156 Ga0105245_12013683 3300009098 Bacteria 631
157 Ga0105247_10167680 3300009101 Bacteria 1458
158 Ga0105247_10257587 3300009101 Bacteria 1195
159 Ga0114129_10535068 3300009147 Bacteria 1526
160 Ga0105243_10064491 3300009148 Bacteria 2940
161 Ga0105243_10179160 3300009148 Bacteria 1842
162 Ga0105241_10173175 3300009174 Bacteria 1784
163 Ga0105241_10193833 3300009174 Bacteria 1693
164 Ga0105242_10009490 3300009176 Bacteria 7457
165 Ga0105242_10089852 3300009176 Bacteria 2582
166 Ga0105242_10667567 3300009176 Bacteria 1013
167 Ga0105248_10037690 3300009177 Bacteria 5409
168 Ga0105248_11055547 3300009177 Bacteria 918
169 Ga0105237_10064619 3300009545 Bacteria 3655
170 Ga0105238_10123111 3300009551 Bacteria 2573
171 Ga0105238_10695695 3300009551 Bacteria 1028
172 Ga0105238_11654328 3300009551 Bacteria 671
173 Ga0105249_10137916 3300009553 Bacteria 2336
174 Ga0105249_12301432 3300009553 Bacteria 612
175 Ga0105239_10507042 3300010375 Bacteria 1372
176 Ga0105239_12154885 3300010375 Bacteria 648
177 Ga0105246_10101648 3300011119 Bacteria 2094
178 Ga0157323_1000389 3300012495 Bacteria 1941
179 Ga0157370_10746637 3300013104 Bacteria 892
180 Ga0157369_10975958 3300013105 Bacteria 868
181 Ga0157374_10153623 3300013296 Bacteria 2239
182 Ga0157374_10320240 3300013296 Bacteria 1536
183 Ga0157378_10064887 3300013297 Bacteria 3267
184 Ga0157378_13039760 3300013297 Bacteria 521
185 Ga0163162_10082383 3300013306 Bacteria 3289
186 Ga0163162_12278961 3300013306 Bacteria 622
187 Ga0157372_13017437 3300013307 Unclassified 538
188 Ga0157375_10110412 3300013308 Bacteria 2847
189 Ga0157375_10632575 3300013308 Bacteria 1227
190 Ga0163163_10325815 3300014325 Bacteria 1590
191 Ga0157380_11091251 3300014326 Bacteria 837
192 Ga0157380_12905008 3300014326 Bacteria 545
193 Ga0182008_10529302 3300014497 Bacteria 652
194 Ga0157377_10298185 3300014745 Bacteria 1063
195 Ga0157379_10013763 3300014968 Bacteria 7091
196 Ga0157379_11388392 3300014968 Bacteria 680
197 Ga0157376_10031023 3300014969 Bacteria 4275
198 Ga0157376_10309177 3300014969 Bacteria 1499
199 Ga0157376_12510475 3300014969 Bacteria 555
200 Ga0163161_10888949 3300017792 Bacteria 754
201 Ga0213874_10158240 3300021377 Bacteria 794
202 Ga0213876_10042234 3300021384 Bacteria 2409
203 Ga0213876_10106412 3300021384 Bacteria 1488
204 Ga0213875_10000003 3300021388 Bacteria 719367
205 Ga0207713_1235890 3300025735 Unclassified 545
206 Ga0207692_10001836 3300025898 Bacteria 8067
207 Ga0207642_10249287 3300025899 Bacteria 1007
208 Ga0207710_10065884 3300025900 Bacteria 1652
209 Ga0207710_10078216 3300025900 Bacteria 1530
210 Ga0207680_10016289 3300025903 Bacteria 3899
211 Ga0207680_10704822 3300025903 Bacteria 723
212 Ga0207685_10036983 3300025905 Bacteria 1794
213 Ga0207685_10054294 3300025905 Bacteria 1560
214 Ga0207685_10364049 3300025905 Bacteria 732
215 Ga0207699_10002738 3300025906 Bacteria 8331
216 Ga0207699_10102763 3300025906 Bacteria 1817
217 Ga0207645_10152717 3300025907 Bacteria 1508
218 Ga0207705_10175824 3300025909 Bacteria 1614
219 Ga0207654_10168874 3300025911 Bacteria 1419
220 Ga0207654_11305850 3300025911 Bacteria 529
221 Ga0207707_10073903 3300025912 Bacteria 2973
222 Ga0207707_10234685 3300025912 Bacteria 1596
223 Ga0207707_10339172 3300025912 Bacteria 1296
224 Ga0207707_10680308 3300025912 Bacteria 865
225 Ga0207707_11615352 3300025912 Bacteria 510
226 Ga0207695_10438315 3300025913 Bacteria 1190
227 Ga0207693_10001091 3300025915 Bacteria 24395
228 Ga0207693_10058837 3300025915 Bacteria 3011
229 Ga0207663_10017295 3300025916 Bacteria 4014
230 Ga0207660_10033534 3300025917 Bacteria 3552
231 Ga0207660_10143887 3300025917 Bacteria 1825
232 Ga0207660_10820983 3300025917 Bacteria 759
233 Ga0207660_10953499 3300025917 Bacteria 700
234 Ga0207657_10032820 3300025919 Bacteria 4686
235 Ga0207657_10129524 3300025919 Bacteria 2069
236 Ga0207649_10036286 3300025920 Bacteria 2968
237 Ga0207652_10284953 3300025921 Bacteria 1490
238 Ga0207694_10443490 3300025924 Bacteria 1083
239 Ga0207694_10685254 3300025924 Bacteria 864
240 Ga0207694_10797339 3300025924 Bacteria 798
241 Ga0207650_10017784 3300025925 Bacteria 4979
242 Ga0207687_10004918 3300025927 Bacteria 8875
243 Ga0207687_10617694 3300025927 Bacteria 915
244 Ga0207700_10000314 3300025928 Bacteria 28445
245 Ga0207700_10637220 3300025928 Bacteria 950
246 Ga0207664_10046843 3300025929 Bacteria 3395
247 Ga0207664_10155592 3300025929 Bacteria 1946
248 Ga0207644_10003205 3300025931 Bacteria 10538
249 Ga0207644_10088588 3300025931 Bacteria 2302
250 Ga0207690_10242953 3300025932 Bacteria 1388
251 Ga0207706_10012582 3300025933 Bacteria 7703
252 Ga0207706_10322961 3300025933 Bacteria 1343
253 Ga0207686_10026756 3300025934 Bacteria 3369
254 Ga0207686_10263226 3300025934 Bacteria 1265
255 Ga0207709_10305998 3300025935 Bacteria 1184
256 Ga0207709_10556349 3300025935 Bacteria 903
257 Ga0207670_10002509 3300025936 Bacteria 9638
258 Ga0207669_10268392 3300025937 Bacteria 1280
259 Ga0207669_11118101 3300025937 Bacteria 665
260 Ga0207704_10036589 3300025938 Bacteria 2826
261 Ga0207704_10200876 3300025938 Bacteria 1459
262 Ga0207665_10001714 3300025939 Bacteria 14739
263 Ga0207665_10099467 3300025939 Bacteria 2028
264 Ga0207711_10005059 3300025941 Bacteria 11184
265 Ga0207711_10088567 3300025941 Bacteria 2718
266 Ga0207689_10071654 3300025942 Bacteria 2847
267 Ga0207661_10121150 3300025944 Bacteria 2227
268 Ga0207679_10080039 3300025945 Bacteria 2493
269 Ga0207667_10634180 3300025949 Bacteria 1075
270 Ga0207667_11858690 3300025949 Bacteria 565
271 Ga0207651_10403617 3300025960 Bacteria 1163
272 Ga0207651_10482261 3300025960 Bacteria 1069
273 Ga0207651_11248442 3300025960 Bacteria 667
274 Ga0207712_11561062 3300025961 Bacteria 591
275 Ga0207658_10514358 3300025986 Bacteria 1068
276 Ga0207677_10008719 3300026023 Bacteria 5679
277 Ga0207703_10018194 3300026035 Bacteria 5487
278 Ga0207639_10649741 3300026041 Bacteria 976
279 Ga0207639_11107793 3300026041 Bacteria 743
280 Ga0207639_12239151 3300026041 Bacteria 508
281 Ga0207678_10001936 3300026067 Bacteria 18897
282 Ga0207678_10077251 3300026067 Bacteria 2852
283 Ga0207678_10131012 3300026067 Bacteria 2139
284 Ga0207678_10184414 3300026067 Bacteria 1782
285 Ga0207702_10543384 3300026078 Bacteria 1136
286 Ga0207702_11973256 3300026078 Bacteria 574
287 Ga0207641_10036929 3300026088 Bacteria 4078
288 Ga0207676_10005005 3300026095 Bacteria 9385
289 Ga0207675_100169850 3300026118 Bacteria 2084
290 Ga0207675_101724260 3300026118 Bacteria 646
291 Ga0207683_10002621 3300026121 Bacteria 15708
292 Ga0207683_10115371 3300026121 Bacteria 2408
293 Ga0209813_10121472 3300027866 Bacteria 910
294 Ga0209813_10250694 3300027866 Bacteria 672
295 Ga0268266_10064928 3300028379 Bacteria 3154
296 Ga0268266_10356711 3300028379 Bacteria 1375
297 Ga0268266_10781507 3300028379 Bacteria 922
298 Ga0268264_10109244 3300028381 Bacteria 2419
299 Ga0265337_1015558 3300028556 Bacteria 2486
300 Ga0265337_1030134 3300028556 Bacteria 1618
301 Ga0265324_10134480 3300029957 Bacteria 840
302 Ga0265330_10023331 3300031235 Bacteria 2810
303 Ga0265332_10005829 3300031238 Bacteria 5646
304 Ga0265332_10098849 3300031238 Bacteria 1232
305 Ga0265328_10076993 3300031239 Bacteria 1228
306 Ga0265320_10071541 3300031240 Bacteria 1633
307 Ga0265320_10113594 3300031240 Bacteria 1239
308 Ga0265325_10002931 3300031241 Bacteria 11377
309 Ga0265325_10037879 3300031241 Bacteria 2547
310 Ga0265325_10052515 3300031241 Bacteria 2092
311 Ga0265325_10318279 3300031241 Bacteria 692
312 Ga0265329_10003992 3300031242 Bacteria 6289
313 Ga0265329_10142467 3300031242 Bacteria 775
314 Ga0265340_10005149 3300031247 Bacteria 7270
315 Ga0265340_10011956 3300031247 Bacteria 4594
316 Ga0265339_10002519 3300031249 Bacteria 13078
317 Ga0265339_10064067 3300031249 Bacteria 1972
318 Ga0265339_10086252 3300031249 Bacteria 1652
319 Ga0265339_10283001 3300031249 Bacteria 794
320 Ga0265331_10134110 3300031250 Bacteria 1128
321 Ga0265316_10017290 3300031344 Bacteria 6240
322 Ga0265316_10047614 3300031344 Bacteria 3390
323 Ga0265316_10051732 3300031344 Bacteria 3225
324 Ga0265316_10075468 3300031344 Bacteria 2592
325 Ga0265313_10001997 3300031595 Bacteria 18359
326 Ga0265313_10099701 3300031595 Bacteria 1290
327 Ga0265313_10112032 3300031595 Bacteria 1199
328 Ga0265314_10014930 3300031711 Bacteria 6186
329 Ga0265314_10019937 3300031711 Bacteria 5185
330 Ga0265314_10074056 3300031711 Bacteria 2269
331 Ga0265342_10006504 3300031712 Bacteria 8695
332 Ga0307412_12149219 3300031911 Bacteria 519
333 Ga0316583_10005292 3300032133 Bacteria 4627
334 Ga0373934_0024821 3300035086 Bacteria 2319
335 Ga0373934_0102650 3300035086 Bacteria 1156
336 Ga0373944_0072089 3300035089 Bacteria 1127
337 Ga0373923_0101355 3300035111 Bacteria 1270
338 Ga0373932_0080290 3300035112 Bacteria 1029
339 Ga0373932_0119090 3300035112 Bacteria 879
340 Ga0373932_0282086 3300035112 Bacteria 615
341 Ga0373936_0160207 3300035113 Bacteria 980
342 Ga0373939_0056975 3300035114 Bacteria 1232
343 Ga0373945_0010904 3300035116 Bacteria 2998
344 Ga0373945_0061192 3300035116 Bacteria 1406
345 Ga0373953_0026843 3300035117 Bacteria 2209
346 Ga0373954_0027925 3300035118 Bacteria 2593
347 Ga0373954_0305248 3300035118 Bacteria 785
348 Ga0373956_0032535 3300035119 Bacteria 2288
349 Ga0373956_0055566 3300035119 Bacteria 1786
350 Ga0373943_0075186 3300035170 Bacteria 1720
351 Ga0373946_0055982 3300035171 Bacteria 1664
352 Ga0373955_0128987 3300035172 Bacteria 1475
353 Ga0373955_0181984 3300035172 Bacteria 1247
354 Ga0373955_0242322 3300035172 Unclassified 1080
355 Ga0373942_0035132 3300035207 Bacteria 1344
356 Ga0373942_0055151 3300035207 Bacteria 1125
357 Ga0373942_0126734 3300035207 Bacteria 802
358 Ga0373961_0285708 3300035241 Bacteria 606
359 Ga0373961_0336204 3300035241 Bacteria 566
360 Ga0373924_0008269 3300035410 Bacteria 3776
361 Ga0373924_0146308 3300035410 Bacteria 1032
362 Ga0373924_0265116 3300035410 Bacteria 761
363 Ga0373935_0099566 3300035692 Bacteria 1914
364 Ga0373935_0497899 3300035692 Bacteria 884
365 Ga0373927_0232431 3300035695 Bacteria 1211
366 Ga0373927_0435975 3300035695 Bacteria 865
367 Ga0373933_0021842 3300035724 Bacteria 3640
368 Ga0373933_0282147 3300035724 Bacteria 1073
369 Ga0373933_0665966 3300035724 Bacteria 684
370 Ga0373947_0151815 3300035725 Bacteria 1492
371 Ga0373937_0055703 3300036401 Bacteria 3630
372 Ga0373937_0093558 3300036401 Unclassified 2787
373 Ga0373937_0465594 3300036401 Bacteria 1200
374 Ga0373937_0623609 3300036401 Bacteria 1023
375 Ga0373937_1892354 3300036401 Unclassified 543
376 Ga0373925_0310543 3300037068 Bacteria 1274
377 Ga0395899_0148014 3300037312 Bacteria 1666
378 Ga0395900_0008079 3300037418 Bacteria 10831
379 Ga0395900_0683643 3300037418 Bacteria 961
380 Ga0395898_0002839 3300037466 Bacteria 19824
381 Ga0395898_0191808 3300037466 Bacteria 1952
382 Ga0395898_0951807 3300037466 Bacteria 796
383 Ga0436364_0630498 3300037853 Bacteria 31334
384 Ga0395901_0612312 3300038443 Bacteria 1097
385 Ga0436365_0184640 3300039437 Bacteria 8493
386 Ga0436365_0565416 3300039437 Bacteria 1123
387 Ga0436365_0772801 3300039437 Bacteria 2792
388 Ga0436365_1570839 3300039437 Bacteria 1930
389 Ga0436363_0029285 3300039450 Bacteria 1396
390 Ga0436363_0375257 3300039450 Bacteria 1540
391 Ga0436362_0414516 3300039453 Bacteria 998
392 Ga0439453_0021475 3300041408 Bacteria 1164
393 Ga0439435_0232826 3300042436 Bacteria 616
394 Ga0495592_0013052 3300046454 Bacteria 6321
395 Ga0495592_0078040 3300046454 Bacteria 2399
396 Ga0495592_0400810 3300046454 Bacteria 869
397 Ga0495603_0153108 3300046455 Bacteria 1339
398 Ga0495629_0170224 3300046459 Bacteria 1512
399 Ga0495651_0205743 3300046462 Bacteria 1374
400 Ga0495653_0010489 3300046463 Bacteria 7582
401 Ga0495653_0158629 3300046463 Bacteria 1573
402 Ga0495580_0359205 3300046472 Bacteria 986
403 Ga0495639_0380036 3300046475 Bacteria 712
404 Ga0495662_0467258 3300046476 Bacteria 619
405 Ga0495662_0509396 3300046476 Bacteria 590
406 Ga0495664_0010463 3300046477 Bacteria 5207
407 Ga0495584_0189467 3300046491 Bacteria 1045
408 Ga0495608_0062219 3300046511 Bacteria 2453
409 Ga0495608_0295982 3300046511 Bacteria 1002
410 Ga0495618_0001624 3300046514 Bacteria 15030
411 Ga0495628_0051201 3300046516 Bacteria 3265
412 Ga0495628_1049998 3300046516 Bacteria 558
413 Ga0495628_1183126 3300046516 Bacteria 519
414 Ga0495630_0183198 3300046517 Bacteria 1597
415 Ga0495666_0074588 3300046526 Bacteria 1609
416 Ga0495586_0087988 3300046535 Bacteria 1713
417 Ga0495586_0439063 3300046535 Unclassified 752
418 Ga0495587_0220756 3300046536 Bacteria 1069
419 Ga0495645_0338934 3300046543 Bacteria 971
420 Ga0495622_0209802 3300046557 Bacteria 866
421 Ga0495667_0015315 3300046559 Bacteria 5179
422 Ga0495667_0059379 3300046559 Bacteria 2510
423 Ga0495667_0070675 3300046559 Bacteria 2277
424 Ga0495634_0034949 3300046642 Bacteria 3446
425 Ga0495634_0244036 3300046642 Unclassified 1101
426 Ga0495635_0092806 3300046663 Bacteria 2064
427 Ga0495635_0217969 3300046663 Bacteria 1291
428 Ga0495635_0599486 3300046663 Bacteria 719
429 Ga0495657_0015348 3300046675 Bacteria 5609
430 Ga0495657_0150852 3300046675 Bacteria 1443
431 Ga0495657_0192504 3300046675 Bacteria 1246
432 Ga0495599_0191968 3300046678 Bacteria 1256
433 Ga0495623_0077738 3300046679 Bacteria 2057
434 Ga0495646_0006600 3300046680 Bacteria 7362
435 Ga0495646_0315715 3300046680 Bacteria 824
436 Ga0495647_0021224 3300046681 Bacteria 2337
437 Ga0495658_0161036 3300046683 Bacteria 1384
438 Ga0495624_0029185 3300046690 Bacteria 3600
439 Ga0495600_0001316 3300046809 Bacteria 13706
440 Ga0495600_0047790 3300046809 Bacteria 2792
441 Ga0495600_0251436 3300046809 Bacteria 1124
442 Ga0495600_0263427 3300046809 Bacteria 1094
443 Ga0495604_0069099 3300047317 Bacteria 2678
444 Ga0495604_0188544 3300047317 Bacteria 1438
445 Ga0495604_0249604 3300047317 Bacteria 1210
446 Ga0495674_0182793 3300047319 Bacteria 1745
447 Ga0495674_0481780 3300047319 Bacteria 994
448 Ga0495674_0497824 3300047319 Bacteria 975
449 Ga0495674_0612573 3300047319 Unclassified 862
450 Ga0495676_0373812 3300047321 Bacteria 949
451 Ga0495676_0554001 3300047321 Bacteria 751
452 Ga0495680_0003716 3300047322 Bacteria 14886
453 Ga0495680_0024306 3300047322 Bacteria 5027
454 Ga0495680_0672165 3300047322 Bacteria 686
455 Ga0495675_0000825 3300047444 Bacteria 19007
456 Ga0495675_0195179 3300047444 Bacteria 1234
457 Ga0495684_0159506 3300047471 Bacteria 1683
458 Ga0495593_0042336 3300047673 Bacteria 2444
459 Ga0495593_0403932 3300047673 Bacteria 683
460 Ga0495602_0047335 3300048088 Bacteria 3875
461 Ga0495602_0173208 3300048088 Bacteria 1673
462 Ga0495602_0445207 3300048088 Bacteria 915
463 Ga0495602_0606782 3300048088 Bacteria 752
464 Ga0495602_0718906 3300048088 Unclassified 676
465 Ga0495614_0064643 3300048089 Bacteria 1574
466 Ga0496100_0062943 3300048903 Bacteria 2450
467 Ga0496100_0324919 3300048903 Bacteria 1156
468 Ga0496101_0022527 3300048904 Bacteria 4337
469 Ga0496101_0162093 3300048904 Bacteria 1715
470 Ga0496102_0002969 3300048905 Bacteria 14359
471 Ga0496102_0065885 3300048905 Bacteria 3320
472 Ga0496102_0869405 3300048905 Bacteria 823
473 Ga0496103_0013630 3300048906 Bacteria 4822
474 Ga0496103_0189205 3300048906 Bacteria 1323
475 Ga0496103_0869857 3300048906 Bacteria 566
476 Ga0496104_0018106 3300048907 Bacteria 6423
477 Ga0496104_0100591 3300048907 Bacteria 2767
478 Ga0496104_1679867 3300048907 Bacteria 537
479 Ga0496105_0009940 3300048908 Bacteria 7464
480 Ga0496105_0614218 3300048908 Bacteria 842
481 Ga0496106_0078833 3300048909 Bacteria 2528
482 Ga0496106_0134955 3300048909 Bacteria 1937
483 Ga0496106_0364752 3300048909 Bacteria 1160
484 Ga0496107_0023256 3300048910 Bacteria 4381
485 Ga0496107_0142662 3300048910 Bacteria 1770
486 Ga0496107_1214975 3300048910 Bacteria 541
487 Ga0496108_0136032 3300048911 Bacteria 2114
488 Ga0496108_0841044 3300048911 Bacteria 790
489 Ga0496109_0042909 3300048912 Bacteria 4099
490 Ga0496109_0257680 3300048912 Bacteria 1643
491 Ga0496110_0042096 3300048913 Bacteria 3986
492 Ga0496111_0181927 3300048914 Bacteria 1562
493 Ga0496112_0055254 3300048915 Bacteria 3903
494 Ga0496113_0892186 3300048916 Bacteria 703
495 Ga0496113_1506776 3300048916 Bacteria 519
496 Ga0496114_0006050 3300048917 Bacteria 9521
497 Ga0496114_0008678 3300048917 Bacteria 8054
498 Ga0496115_0122847 3300048918 Bacteria 2137
499 Ga0496115_0171803 3300048918 Bacteria 1792
500 Ga0496115_0257790 3300048918 Bacteria 1434
501 Ga0496115_0286968 3300048918 Bacteria 1350
502 Ga0496121_0101767 3300048924 Bacteria 2215
503 Ga0496125_0179316 3300048928 Bacteria 1414
504 Ga0496126_1036985 3300048929 Bacteria 613
505 Ga0501031_0026245 3300049568 Bacteria 3798
506 Ga0501032_0034439 3300049569 Bacteria 3467
507 Ga0501032_0699148 3300049569 Bacteria 643
508 Ga0501033_0006873 3300049570 Bacteria 8881
509 Ga0501034_0091081 3300049571 Bacteria 3047
510 Ga0501034_0171946 3300049571 Bacteria 2133
511 Ga0501034_0457122 3300049571 Bacteria 1194
512 Ga0501036_0030607 3300049572 Bacteria 4545
513 Ga0501036_0207363 3300049572 Bacteria 1647
514 Ga0501036_0436238 3300049572 Bacteria 1092
515 Ga0501036_0472060 3300049572 Bacteria 1045
516 Ga0501037_0111993 3300049573 Bacteria 1965
517 Ga0501038_0095544 3300049574 Bacteria 2482
518 Ga0501038_0096460 3300049574 Bacteria 2468
519 Ga0501038_1233362 3300049574 Bacteria 542
520 Ga0501039_0035196 3300049575 Bacteria 3864
521 Ga0501042_0549282 3300049578 Bacteria 840
522 Ga0501043_0156745 3300049579 Bacteria 1780
523 Ga0501046_0303910 3300049580 Bacteria 1165
524 Ga0501047_0179216 3300049581 Bacteria 1985
525 Ga0501047_0213973 3300049581 Bacteria 1785
526 Ga0501048_0209998 3300049582 Bacteria 1381
527 Ga0501069_0004220 3300049585 Bacteria 7423
528 Ga0501069_0278042 3300049585 Bacteria 979
529 Ga0501070_0004243 3300049586 Bacteria 12323
530 Ga0501070_0064277 3300049586 Bacteria 3039
531 Ga0501070_0067254 3300049586 Bacteria 2968
532 Ga0501070_0135004 3300049586 Bacteria 2037
533 Ga0501070_0146014 3300049586 Bacteria 1952
534 Ga0501070_0255992 3300049586 Bacteria 1431
535 Ga0501070_0257439 3300049586 Bacteria 1427
536 Ga0501070_0993124 3300049586 Bacteria 651
537 Ga0501071_0063694 3300049587 Bacteria 2674
538 Ga0501071_0159427 3300049587 Bacteria 1686
539 Ga0501071_0254878 3300049587 Bacteria 1325
540 Ga0501072_0023469 3300049588 Bacteria 4792
541 Ga0501072_0368233 3300049588 Bacteria 1141
542 Ga0501073_0255594 3300049589 Bacteria 1209
543 Ga0501073_1077045 3300049589 Bacteria 552
544 Ga0501074_0131869 3300049590 Bacteria 1787
545 Ga0501074_0580544 3300049590 Bacteria 793
546 Ga0501074_1013238 3300049590 Bacteria 584
547 Ga0501079_0133123 3300049741 Bacteria 1935
548 Ga0501079_0856519 3300049741 Bacteria 716
549 Ga0501079_0922833 3300049741 Bacteria 688
550 Ga0501080_0031252 3300049742 Bacteria 4962
551 Ga0501080_0053278 3300049742 Bacteria 3766
552 Ga0501080_0075358 3300049742 Bacteria 3138
553 Ga0501080_0276558 3300049742 Bacteria 1527
554 Ga0501081_0135643 3300049743 Bacteria 1762
555 Ga0501083_0076645 3300049744 Bacteria 2219
556 Ga0501083_0444504 3300049744 Bacteria 844
557 Ga0501083_0883259 3300049744 Bacteria 582
558 Ga0501083_0990206 3300049744 Bacteria 547
559 Ga0501035_0001590 3300049822 Bacteria 23012
560 Ga0501035_0340700 3300049822 Bacteria 1256
561 Ga0501044_0418618 3300049823 Bacteria 1250
562 Ga0501044_0527036 3300049823 Bacteria 1080
563 nmdc:mga03n38_741363_c1 3300050490 Bacteria 569
564 nmdc:mga03n38_805936_c1 3300050490 Bacteria 547
565 nmdc:mga03n38_927435_c1 3300050490 Bacteria 513
566 nmdc:mga00v17_142644_c1 3300050491 Bacteria 1536
567 nmdc:mga0yw44_462308_c1 3300050492 Bacteria 860
568 nmdc:mga0k408_127456_c1 3300050493 Bacteria 1510
569 nmdc:mga0k408_86042_c1 3300050493 Bacteria 1845
570 nmdc:mga06z11_246837_c1 3300050494 Bacteria 1050
571 nmdc:mga04h51_284574_c1 3300050495 Bacteria 670
572 nmdc:mga04h51_87303_c1 3300050495 Bacteria 1117
573 nmdc:mga07m45_100602_c1 3300050496 Bacteria 1660
574 nmdc:mga05p37_1066971_c1 3300050507 Bacteria 850
575 nmdc:mga09592_1322420_c1 3300050508 Bacteria 592
576 nmdc:mga06r32_404081_c1 3300050510 Bacteria 1348
577 nmdc:mga08y16_185617_c1 3300050511 Bacteria 2158
578 nmdc:mga0n895_107131_c1 3300050512 Bacteria 2808
579 nmdc:mga0n895_347184_c1 3300050512 Bacteria 1503
580 nmdc:mga0n895_935902_c1 3300050512 Bacteria 850
581 nmdc:mga0rr50_1430558_c1 3300050513 Bacteria 585
582 nmdc:mga0rr50_558984_c1 3300050513 Bacteria 974
583 nmdc:mga08x19_1300533_c1 3300050514 Bacteria 515
584 nmdc:mga0a205_202102_c1 3300050515 Bacteria 1877
585 Ga0495601_0007672 3300053077 Bacteria 6342
586 Ga0495601_0019305 3300053077 Bacteria 4157
587 Ga0495601_0020464 3300053077 Bacteria 4043
588 Ga0495601_0079803 3300053077 Bacteria 2098
589 Ga0495612_0016931 3300053078 Bacteria 2919
590 Ga0495612_0098824 3300053078 Bacteria 1241
591 Ga0495595_0003291 3300053084 Bacteria 6418
592 Ga0495595_0008792 3300053084 Bacteria 4159
593 Ga0495595_0090233 3300053084 Bacteria 1469
594 Ga0495595_0305633 3300053084 Bacteria 800
595 Ga0495619_0000468 3300053085 Bacteria 27254
596 Ga0495619_0074226 3300053085 Bacteria 2280
597 Ga0495619_0087447 3300053085 Bacteria 2107
598 Ga0500578_0152274 3300053086 Bacteria 1440
599 Ga0500643_009268 3300053087 Bacteria 3770
600 Ga0500644_0000587 3300053088 Bacteria 13932
601 Ga0500646_0027538 3300053090 Bacteria 1547
602 Ga0500646_0312298 3300053090 Bacteria 566
603 Ga0500566_0089080 3300053094 Bacteria 1707
604 Ga0500593_001653 3300053117 Bacteria 8038
605 Ga0500595_000083 3300053119 Bacteria 66474
606 Ga0500642_0220330 3300053130 Bacteria 879
607 Ga0500652_027162 3300053131 Bacteria 2211
608 Ga0500655_057967 3300053133 Bacteria 777
609 Ga0500568_0179002 3300053139 Bacteria 780
610 Ga0500577_0093864 3300053142 Bacteria 1217
611 Ga0500616_0000006 3300053153 Bacteria 944738
612 Ga0500645_000680 3300053730 Bacteria 21248
613 Ga0501084_0055173 3300054114 Bacteria 3325
614 Ga0501084_0789052 3300054114 Bacteria 800
615 Ga0501082_1207487 3300060353 Unclassified 661

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100508866 Ga0070665_1005088661 86
2 3300026067 Ga0207678_10131012 Ga0207678_101310123 90
3 3300049587 Ga0501071_0159427 Ga0501071_0159427_1151_1486 91
4 3300049741 Ga0501079_0133123 Ga0501079_0133123_1191_1526 91
5 3300005356 Ga0070674_100767620 Ga0070674_1007676202 95
6 3300005337 Ga0070682_101300168 Ga0070682_1013001681 96
7 3300005458 Ga0070681_10954326 Ga0070681_109543261 96
8 3300025912 Ga0207707_11615352 Ga0207707_116153521 96
9 3300026078 Ga0207702_11973256 Ga0207702_119732562 96
10 3300035116 Ga0373945_0061192 Ga0373945_0061192_432_770 97
11 3300035170 Ga0373943_0075186 Ga0373943_0075186_141_479 97
12 3300035172 Ga0373955_0128987 Ga0373955_0128987_789_1127 97
13 3300035410 Ga0373924_0265116 Ga0373924_0265116_184_522 97
14 3300035692 Ga0373935_0099566 Ga0373935_0099566_1017_1355 97
15 3300035695 Ga0373927_0435975 Ga0373927_0435975_409_747 97
16 3300035724 Ga0373933_0282147 Ga0373933_0282147_679_1017 97
17 3300036401 Ga0373937_0623609 Ga0373937_0623609_83_421 97
18 3300046454 Ga0495592_0078040 Ga0495592_0078040_1195_1533 97
19 3300046463 Ga0495653_0158629 Ga0495653_0158629_841_1179 97
20 3300046475 Ga0495639_0380036 Ga0495639_0380036_343_681 97
21 3300046516 Ga0495628_0051201 Ga0495628_0051201_373_711 97
22 3300046678 Ga0495599_0191968 Ga0495599_0191968_456_794 97
23 3300046809 Ga0495600_0263427 Ga0495600_0263427_150_488 97
24 3300047317 Ga0495604_0249604 Ga0495604_0249604_792_1130 97
25 3300047319 Ga0495674_0497824 Ga0495674_0497824_616_954 97
26 3300047444 Ga0495675_0195179 Ga0495675_0195179_637_975 97
27 3300048088 Ga0495602_0173208 Ga0495602_0173208_1318_1656 97
28 3300053077 Ga0495601_0019305 Ga0495601_0019305_125_463 97
29 3300053078 Ga0495612_0098824 Ga0495612_0098824_192_530 97
30 3300053084 Ga0495595_0305633 Ga0495595_0305633_285_623 97
31 3300053085 Ga0495619_0087447 Ga0495619_0087447_1739_2077 97
32 3300006847 Ga0075431_100307907 Ga0075431_1003079071 98
33 3300006880 Ga0075429_101436094 Ga0075429_1014360942 98
34 3300007788 Ga0099795_10186762 Ga0099795_101867622 98
35 3300049569 Ga0501032_0699148 Ga0501032_0699148_220_582 98
36 3300049572 Ga0501036_0436238 Ga0501036_0436238_183_545 98
37 3300049578 Ga0501042_0549282 Ga0501042_0549282_100_462 98
38 3300049580 Ga0501046_0303910 Ga0501046_0303910_781_1143 98
39 3300049587 Ga0501071_0254878 Ga0501071_0254878_782_1144 98
40 3300049588 Ga0501072_0368233 Ga0501072_0368233_745_1107 98
41 3300049590 Ga0501074_1013238 Ga0501074_1013238_136_498 98
42 3300049741 Ga0501079_0856519 Ga0501079_0856519_314_676 98
43 3300049743 Ga0501081_0135643 Ga0501081_0135643_1164_1526 98
44 3300005615 Ga0070702_100328882 Ga0070702_1003288821 99
45 3300031235 Ga0265330_10023331 Ga0265330_100233312 99
46 3300031238 Ga0265332_10005829 Ga0265332_100058294 99
47 3300031239 Ga0265328_10076993 Ga0265328_100769932 99
48 3300031240 Ga0265320_10071541 Ga0265320_100715412 99
49 3300031240 Ga0265320_10113594 Ga0265320_101135942 99
50 3300031241 Ga0265325_10037879 Ga0265325_100378793 99
51 3300031241 Ga0265325_10052515 Ga0265325_100525153 99
52 3300031242 Ga0265329_10003992 Ga0265329_100039925 99
53 3300031242 Ga0265329_10142467 Ga0265329_101424672 99
54 3300031247 Ga0265340_10005149 Ga0265340_100051495 99
55 3300031247 Ga0265340_10011956 Ga0265340_100119565 99
56 3300031249 Ga0265339_10064067 Ga0265339_100640673 99
57 3300031249 Ga0265339_10086252 Ga0265339_100862524 99
58 3300031250 Ga0265331_10134110 Ga0265331_101341102 99
59 3300031344 Ga0265316_10047614 Ga0265316_100476142 99
60 3300031344 Ga0265316_10051732 Ga0265316_100517323 99
61 3300031595 Ga0265313_10099701 Ga0265313_100997013 99
62 3300031711 Ga0265314_10019937 Ga0265314_100199375 99
63 3300031711 Ga0265314_10074056 Ga0265314_100740562 99
64 3300031712 Ga0265342_10006504 Ga0265342_100065045 99
65 3300035207 Ga0373942_0035132 Ga0373942_0035132_117_416 99
66 3300035241 Ga0373961_0336204 Ga0373961_0336204_255_554 99
67 3300046491 Ga0495584_0189467 Ga0495584_0189467_100_429 99
68 3300050495 nmdc:mga04h51_284574_c1 nmdc:mga04h51_284574_c1_328_630 99
69 3300006847 Ga0075431_100246250 Ga0075431_1002462502 100
70 3300006852 Ga0075433_10418975 Ga0075433_104189752 100
71 3300006871 Ga0075434_100159186 Ga0075434_1001591862 100
72 3300007076 Ga0075435_101248181 Ga0075435_1012481812 100
73 3300009098 Ga0105245_12013683 Ga0105245_120136832 100
74 3300009553 Ga0105249_12301432 Ga0105249_123014322 100
75 3300014326 Ga0157380_12905008 Ga0157380_129050082 100
76 3300025960 Ga0207651_11248442 Ga0207651_112484422 100
77 3300025961 Ga0207712_11561062 Ga0207712_115610622 100
78 3300026118 Ga0207675_101724260 Ga0207675_1017242602 100
79 3300035241 Ga0373961_0285708 Ga0373961_0285708_283_591 100
80 3300050511 nmdc:mga08y16_185617_c1 nmdc:mga08y16_185617_c1_317_646 100
81 3300050512 nmdc:mga0n895_347184_c1 nmdc:mga0n895_347184_c1_308_637 100
82 3300050513 nmdc:mga0rr50_1430558_c1 nmdc:mga0rr50_1430558_c1_191_520 100
83 3300050515 nmdc:mga0a205_202102_c1 nmdc:mga0a205_202102_c1_1093_1422 100
84 3300013306 Ga0163162_12278961 Ga0163162_122789612 101
85 3300053090 Ga0500646_0312298 Ga0500646_0312298_26_364 101
86 3300005327 Ga0070658_10191871 Ga0070658_101918712 102
87 3300005336 Ga0070680_100057441 Ga0070680_1000574412 102
88 3300005339 Ga0070660_100123815 Ga0070660_1001238152 102
89 3300005458 Ga0070681_10030981 Ga0070681_100309814 102
90 3300005530 Ga0070679_100007329 Ga0070679_1000073299 102
91 3300005539 Ga0068853_101460441 Ga0068853_1014604412 102
92 3300025909 Ga0207705_10175824 Ga0207705_101758243 102
93 3300025912 Ga0207707_10073903 Ga0207707_100739034 102
94 3300025917 Ga0207660_10033534 Ga0207660_100335344 102
95 3300025921 Ga0207652_10284953 Ga0207652_102849532 102
96 3300026041 Ga0207639_11107793 Ga0207639_111077932 102
97 3300060353 Ga0501082_1207487 Ga0501082_1207487_280_615 103
98 3300003659 JGI25404J52841_10019331 JGI25404J52841_100193312 104
99 3300005547 Ga0070693_100074436 Ga0070693_1000744364 104
100 3300005564 Ga0070664_101196803 Ga0070664_1011968032 104
101 3300005578 Ga0068854_100907371 Ga0068854_1009073712 104
102 3300005616 Ga0068852_101532930 Ga0068852_1015329302 104
103 3300005719 Ga0068861_100870147 Ga0068861_1008701472 104
104 3300005937 Ga0081455_10568086 Ga0081455_105680862 104
105 3300005983 Ga0081540_1000003 Ga0081540_10000031 104
106 3300006358 Ga0068871_100437986 Ga0068871_1004379862 104
107 3300009098 Ga0105245_10889542 Ga0105245_108895422 104
108 3300009551 Ga0105238_10695695 Ga0105238_106956952 104
109 3300010375 Ga0105239_12154885 Ga0105239_121548852 104
110 3300021384 Ga0213876_10106412 Ga0213876_101064122 104
111 3300021388 Ga0213875_10000003 Ga0213875_1000000332 104
112 3300025924 Ga0207694_10443490 Ga0207694_104434903 104
113 3300035112 Ga0373932_0119090 Ga0373932_0119090_84_401 104
114 3300035114 Ga0373939_0056975 Ga0373939_0056975_761_1078 104
115 3300035207 Ga0373942_0055151 Ga0373942_0055151_788_1105 104
116 3300037853 Ga0436364_0630498 Ga0436364_0630498_12814_13158 104
117 3300039437 Ga0436365_0565416 Ga0436365_0565416_249_590 104
118 3300039437 Ga0436365_0772801 Ga0436365_0772801_2019_2360 104
119 3300039437 Ga0436365_1570839 Ga0436365_1570839_1537_1881 104
120 3300039450 Ga0436363_0029285 Ga0436363_0029285_71_412 104
121 3300005466 Ga0070685_10223530 Ga0070685_102235303 105
122 3300006042 Ga0075368_10328764 Ga0075368_103287642 105
123 3300006048 Ga0075363_100103151 Ga0075363_1001031512 105
124 3300006178 Ga0075367_10177133 Ga0075367_101771332 105
125 3300006195 Ga0075366_10125959 Ga0075366_101259592 105
126 3300006237 Ga0097621_101014763 Ga0097621_1010147632 105
127 3300006353 Ga0075370_10538698 Ga0075370_105386982 105
128 3300006353 Ga0075370_10615018 Ga0075370_106150182 105
129 3300009098 Ga0105245_11992105 Ga0105245_119921052 105
130 3300021377 Ga0213874_10158240 Ga0213874_101582402 105
131 3300027866 Ga0209813_10250694 Ga0209813_102506941 105
132 3300028379 Ga0268266_10356711 Ga0268266_103567113 105
133 3300039450 Ga0436363_0375257 Ga0436363_0375257_278_607 105
134 3300041408 Ga0439453_0021475 Ga0439453_0021475_733_1053 105
135 3300042436 Ga0439435_0232826 Ga0439435_0232826_25_345 105
136 3300050491 nmdc:mga00v17_142644_c1 nmdc:mga00v17_142644_c1_192_533 105
137 3300050493 nmdc:mga0k408_86042_c1 nmdc:mga0k408_86042_c1_459_779 105
138 3300050494 nmdc:mga06z11_246837_c1 nmdc:mga06z11_246837_c1_224_544 105
139 3300005336 Ga0070680_100147989 Ga0070680_1001479893 106
140 3300005341 Ga0070691_10191087 Ga0070691_101910872 106
141 3300005458 Ga0070681_10104130 Ga0070681_101041302 106
142 3300005530 Ga0070679_100228645 Ga0070679_1002286454 106
143 3300006042 Ga0075368_10019793 Ga0075368_100197932 106
144 3300006048 Ga0075363_100134699 Ga0075363_1001346992 106
145 3300006178 Ga0075367_10073816 Ga0075367_100738162 106
146 3300006186 Ga0075369_10054146 Ga0075369_100541462 106
147 3300006195 Ga0075366_10082514 Ga0075366_100825144 106
148 3300006353 Ga0075370_10139729 Ga0075370_101397292 106
149 3300025912 Ga0207707_10234685 Ga0207707_102346852 106
150 3300025917 Ga0207660_10143887 Ga0207660_101438873 106
151 3300025949 Ga0207667_11858690 Ga0207667_118586902 106
152 3300027866 Ga0209813_10121472 Ga0209813_101214722 106
153 3300049571 Ga0501034_0457122 Ga0501034_0457122_642_971 106
154 3300049572 Ga0501036_0472060 Ga0501036_0472060_119_448 106
155 3300049574 Ga0501038_1233362 Ga0501038_1233362_74_403 106
156 3300049581 Ga0501047_0213973 Ga0501047_0213973_1346_1675 106
157 3300049585 Ga0501069_0278042 Ga0501069_0278042_444_773 106
158 3300049586 Ga0501070_0064277 Ga0501070_0064277_2395_2733 106
159 3300049586 Ga0501070_0067254 Ga0501070_0067254_1112_1462 106
160 3300049586 Ga0501070_0255992 Ga0501070_0255992_1029_1358 106
161 3300049588 Ga0501072_0023469 Ga0501072_0023469_214_543 106
162 3300049589 Ga0501073_0255594 Ga0501073_0255594_645_986 106
163 3300049589 Ga0501073_1077045 Ga0501073_1077045_13_342 106
164 3300049590 Ga0501074_0131869 Ga0501074_0131869_626_955 106
165 3300049590 Ga0501074_0580544 Ga0501074_0580544_357_707 106
166 3300049741 Ga0501079_0922833 Ga0501079_0922833_74_403 106
167 3300049742 Ga0501080_0031252 Ga0501080_0031252_2435_2773 106
168 3300049742 Ga0501080_0053278 Ga0501080_0053278_843_1193 106
169 3300049742 Ga0501080_0075358 Ga0501080_0075358_1026_1355 106
170 3300049744 Ga0501083_0076645 Ga0501083_0076645_1121_1459 106
171 3300049823 Ga0501044_0418618 Ga0501044_0418618_797_1126 106
172 3300050490 nmdc:mga03n38_741363_c1 nmdc:mga03n38_741363_c1_201_548 106
173 3300050490 nmdc:mga03n38_805936_c1 nmdc:mga03n38_805936_c1_152_532 106
174 3300050492 nmdc:mga0yw44_462308_c1 nmdc:mga0yw44_462308_c1_354_701 106
175 3300050493 nmdc:mga0k408_127456_c1 nmdc:mga0k408_127456_c1_730_1077 106
176 3300050495 nmdc:mga04h51_87303_c1 nmdc:mga04h51_87303_c1_396_743 106
177 3300050496 nmdc:mga07m45_100602_c1 nmdc:mga07m45_100602_c1_710_1057 106
178 3300054114 Ga0501084_0055173 Ga0501084_0055173_1752_2102 106
179 3300054114 Ga0501084_0789052 Ga0501084_0789052_322_651 106
180 3300005329 Ga0070683_100024294 Ga0070683_1000242945 107
181 3300005330 Ga0070690_100015961 Ga0070690_1000159614 107
182 3300005331 Ga0070670_100227913 Ga0070670_1002279133 107
183 3300005334 Ga0068869_100177526 Ga0068869_1001775262 107
184 3300005335 Ga0070666_10001845 Ga0070666_1000184514 107
185 3300005336 Ga0070680_100481513 Ga0070680_1004815132 107
186 3300005337 Ga0070682_100005374 Ga0070682_1000053747 107
187 3300005338 Ga0068868_100062889 Ga0068868_1000628892 107
188 3300005339 Ga0070660_100134875 Ga0070660_1001348752 107
189 3300005339 Ga0070660_101246996 Ga0070660_1012469961 107
190 3300005340 Ga0070689_100028158 Ga0070689_1000281583 107
191 3300005341 Ga0070691_10030524 Ga0070691_100305242 107
192 3300005344 Ga0070661_100029342 Ga0070661_1000293423 107
193 3300005344 Ga0070661_100194517 Ga0070661_1001945172 107
194 3300005347 Ga0070668_101345143 Ga0070668_1013451432 107
195 3300005353 Ga0070669_101683074 Ga0070669_1016830741 107
196 3300005355 Ga0070671_100012503 Ga0070671_1000125039 107
197 3300005355 Ga0070671_100030107 Ga0070671_1000301072 107
198 3300005356 Ga0070674_100312877 Ga0070674_1003128771 107
199 3300005356 Ga0070674_100759777 Ga0070674_1007597771 107
200 3300005364 Ga0070673_100015672 Ga0070673_1000156726 107
201 3300005364 Ga0070673_100423709 Ga0070673_1004237092 107
202 3300005365 Ga0070688_100050062 Ga0070688_1000500623 107
203 3300005366 Ga0070659_100125952 Ga0070659_1001259522 107
204 3300005366 Ga0070659_101690328 Ga0070659_1016903282 107
205 3300005367 Ga0070667_100004611 Ga0070667_10000461114 107
206 3300005367 Ga0070667_100422221 Ga0070667_1004222212 107
207 3300005434 Ga0070709_10000798 Ga0070709_1000079816 107
208 3300005434 Ga0070709_10833557 Ga0070709_108335572 107
209 3300005435 Ga0070714_100012792 Ga0070714_1000127929 107
210 3300005436 Ga0070713_100000542 Ga0070713_10000054214 107
211 3300005436 Ga0070713_100647088 Ga0070713_1006470882 107
212 3300005437 Ga0070710_10248491 Ga0070710_102484912 107
213 3300005439 Ga0070711_100006269 Ga0070711_1000062699 107
214 3300005440 Ga0070705_100175597 Ga0070705_1001755972 107
215 3300005440 Ga0070705_100965166 Ga0070705_1009651662 107
216 3300005444 Ga0070694_101688235 Ga0070694_1016882351 107
217 3300005455 Ga0070663_100001077 Ga0070663_10000107711 107
218 3300005455 Ga0070663_100008134 Ga0070663_1000081347 107
219 3300005455 Ga0070663_101602072 Ga0070663_1016020721 107
220 3300005456 Ga0070678_100003061 Ga0070678_1000030617 107
221 3300005456 Ga0070678_100005803 Ga0070678_1000058032 107
222 3300005457 Ga0070662_100085546 Ga0070662_1000855462 107
223 3300005457 Ga0070662_100425524 Ga0070662_1004255242 107
224 3300005458 Ga0070681_10023237 Ga0070681_100232377 107
225 3300005458 Ga0070681_10290090 Ga0070681_102900902 107
226 3300005459 Ga0068867_100145840 Ga0068867_1001458402 107
227 3300005466 Ga0070685_10062073 Ga0070685_100620732 107
228 3300005530 Ga0070679_100034212 Ga0070679_1000342122 107
229 3300005535 Ga0070684_100165058 Ga0070684_1001650583 107
230 3300005535 Ga0070684_100440138 Ga0070684_1004401382 107
231 3300005536 Ga0070697_100243808 Ga0070697_1002438083 107
232 3300005536 Ga0070697_101478042 Ga0070697_1014780421 107
233 3300005539 Ga0068853_100446759 Ga0068853_1004467592 107
234 3300005544 Ga0070686_100022150 Ga0070686_1000221503 107
235 3300005544 Ga0070686_100498409 Ga0070686_1004984091 107
236 3300005545 Ga0070695_100086031 Ga0070695_1000860313 107
237 3300005546 Ga0070696_100062647 Ga0070696_1000626474 107
238 3300005547 Ga0070693_100290881 Ga0070693_1002908812 107
239 3300005547 Ga0070693_100444723 Ga0070693_1004447231 107
240 3300005548 Ga0070665_100058836 Ga0070665_1000588365 107
241 3300005548 Ga0070665_100286928 Ga0070665_1002869282 107
242 3300005563 Ga0068855_100212502 Ga0068855_1002125023 107
243 3300005564 Ga0070664_100059899 Ga0070664_1000598993 107
244 3300005614 Ga0068856_100230628 Ga0068856_1002306282 107
245 3300005615 Ga0070702_100011277 Ga0070702_1000112777 107
246 3300005617 Ga0068859_100008370 Ga0068859_1000083702 107
247 3300005618 Ga0068864_100001336 Ga0068864_10000133612 107
248 3300005718 Ga0068866_10400484 Ga0068866_104004842 107
249 3300005718 Ga0068866_10767941 Ga0068866_107679412 107
250 3300005719 Ga0068861_101176745 Ga0068861_1011767452 107
251 3300005841 Ga0068863_100116063 Ga0068863_1001160633 107
252 3300005842 Ga0068858_100015809 Ga0068858_1000158099 107
253 3300005842 Ga0068858_100818922 Ga0068858_1008189222 107
254 3300005843 Ga0068860_100044761 Ga0068860_1000447613 107
255 3300005983 Ga0081540_1018027 Ga0081540_10180273 107
256 3300006028 Ga0070717_10000891 Ga0070717_1000089117 107
257 3300006028 Ga0070717_10386848 Ga0070717_103868482 107
258 3300006163 Ga0070715_10000188 Ga0070715_1000018811 107
259 3300006173 Ga0070716_100000070 Ga0070716_10000007024 107
260 3300006175 Ga0070712_100019782 Ga0070712_1000197827 107
261 3300006175 Ga0070712_100139521 Ga0070712_1001395213 107
262 3300006237 Ga0097621_100006935 Ga0097621_1000069353 107
263 3300006237 Ga0097621_100007158 Ga0097621_10000715812 107
264 3300006237 Ga0097621_100796151 Ga0097621_1007961512 107
265 3300006358 Ga0068871_100005085 Ga0068871_1000050853 107
266 3300006358 Ga0068871_100165352 Ga0068871_1001653522 107
267 3300006871 Ga0075434_100099484 Ga0075434_1000994844 107
268 3300006871 Ga0075434_101539846 Ga0075434_1015398462 107
269 3300006881 Ga0068865_100002800 Ga0068865_1000028009 107
270 3300006881 Ga0068865_100197497 Ga0068865_1001974972 107
271 3300006914 Ga0075436_101248250 Ga0075436_1012482502 107
272 3300006931 Ga0097620_100008370 Ga0097620_1000083702 107
273 3300007076 Ga0075435_100133897 Ga0075435_1001338973 107
274 3300007076 Ga0075435_100756761 Ga0075435_1007567612 107
275 3300007076 Ga0075435_101373399 Ga0075435_1013733992 107
276 3300009011 Ga0105251_10014272 Ga0105251_100142722 107
277 3300009092 Ga0105250_10293755 Ga0105250_102937552 107
278 3300009093 Ga0105240_10631185 Ga0105240_106311852 107
279 3300009093 Ga0105240_11475007 Ga0105240_114750072 107
280 3300009098 Ga0105245_10850549 Ga0105245_108505493 107
281 3300009101 Ga0105247_10167680 Ga0105247_101676802 107
282 3300009101 Ga0105247_10257587 Ga0105247_102575872 107
283 3300009148 Ga0105243_10064491 Ga0105243_100644914 107
284 3300009148 Ga0105243_10179160 Ga0105243_101791602 107
285 3300009174 Ga0105241_10173175 Ga0105241_101731752 107
286 3300009174 Ga0105241_10193833 Ga0105241_101938333 107
287 3300009176 Ga0105242_10009490 Ga0105242_100094908 107
288 3300009176 Ga0105242_10089852 Ga0105242_100898524 107
289 3300009176 Ga0105242_10667567 Ga0105242_106675672 107
290 3300009177 Ga0105248_10037690 Ga0105248_100376907 107
291 3300009177 Ga0105248_11055547 Ga0105248_110555472 107
292 3300009545 Ga0105237_10064619 Ga0105237_100646193 107
293 3300009551 Ga0105238_10123111 Ga0105238_101231112 107
294 3300009551 Ga0105238_11654328 Ga0105238_116543282 107
295 3300009553 Ga0105249_10137916 Ga0105249_101379163 107
296 3300010375 Ga0105239_10507042 Ga0105239_105070422 107
297 3300011119 Ga0105246_10101648 Ga0105246_101016483 107
298 3300012495 Ga0157323_1000389 Ga0157323_10003891 107
299 3300013104 Ga0157370_10746637 Ga0157370_107466372 107
300 3300013105 Ga0157369_10975958 Ga0157369_109759582 107
301 3300013296 Ga0157374_10153623 Ga0157374_101536233 107
302 3300013296 Ga0157374_10320240 Ga0157374_103202402 107
303 3300013297 Ga0157378_10064887 Ga0157378_100648873 107
304 3300013297 Ga0157378_13039760 Ga0157378_130397602 107
305 3300013306 Ga0163162_10082383 Ga0163162_100823833 107
306 3300013307 Ga0157372_13017437 Ga0157372_130174371 107
307 3300013308 Ga0157375_10110412 Ga0157375_101104122 107
308 3300013308 Ga0157375_10632575 Ga0157375_106325752 107
309 3300014325 Ga0163163_10325815 Ga0163163_103258152 107
310 3300014326 Ga0157380_11091251 Ga0157380_110912512 107
311 3300014497 Ga0182008_10529302 Ga0182008_105293022 107
312 3300014745 Ga0157377_10298185 Ga0157377_102981852 107
313 3300014968 Ga0157379_10013763 Ga0157379_100137636 107
314 3300014968 Ga0157379_11388392 Ga0157379_113883922 107
315 3300014969 Ga0157376_10031023 Ga0157376_100310234 107
316 3300014969 Ga0157376_10309177 Ga0157376_103091772 107
317 3300014969 Ga0157376_12510475 Ga0157376_125104752 107
318 3300017792 Ga0163161_10888949 Ga0163161_108889492 107
319 3300025735 Ga0207713_1235890 Ga0207713_12358902 107
320 3300025898 Ga0207692_10001836 Ga0207692_100018365 107
321 3300025899 Ga0207642_10249287 Ga0207642_102492872 107
322 3300025900 Ga0207710_10065884 Ga0207710_100658844 107
323 3300025900 Ga0207710_10078216 Ga0207710_100782163 107
324 3300025903 Ga0207680_10016289 Ga0207680_100162894 107
325 3300025903 Ga0207680_10704822 Ga0207680_107048221 107
326 3300025905 Ga0207685_10036983 Ga0207685_100369833 107
327 3300025905 Ga0207685_10054294 Ga0207685_100542942 107
328 3300025905 Ga0207685_10364049 Ga0207685_103640492 107
329 3300025906 Ga0207699_10002738 Ga0207699_1000273810 107
330 3300025906 Ga0207699_10102763 Ga0207699_101027632 107
331 3300025907 Ga0207645_10152717 Ga0207645_101527173 107
332 3300025911 Ga0207654_10168874 Ga0207654_101688742 107
333 3300025911 Ga0207654_11305850 Ga0207654_113058501 107
334 3300025912 Ga0207707_10339172 Ga0207707_103391723 107
335 3300025912 Ga0207707_10680308 Ga0207707_106803081 107
336 3300025913 Ga0207695_10438315 Ga0207695_104383152 107
337 3300025915 Ga0207693_10001091 Ga0207693_1000109114 107
338 3300025915 Ga0207693_10058837 Ga0207693_100588373 107
339 3300025916 Ga0207663_10017295 Ga0207663_100172953 107
340 3300025917 Ga0207660_10820983 Ga0207660_108209832 107
341 3300025917 Ga0207660_10953499 Ga0207660_109534992 107
342 3300025919 Ga0207657_10032820 Ga0207657_100328203 107
343 3300025919 Ga0207657_10129524 Ga0207657_101295242 107
344 3300025920 Ga0207649_10036286 Ga0207649_100362864 107
345 3300025924 Ga0207694_10685254 Ga0207694_106852542 107
346 3300025924 Ga0207694_10797339 Ga0207694_107973392 107
347 3300025925 Ga0207650_10017784 Ga0207650_100177847 107
348 3300025927 Ga0207687_10004918 Ga0207687_100049188 107
349 3300025927 Ga0207687_10617694 Ga0207687_106176942 107
350 3300025928 Ga0207700_10000314 Ga0207700_1000031427 107
351 3300025928 Ga0207700_10637220 Ga0207700_106372202 107
352 3300025929 Ga0207664_10046843 Ga0207664_100468434 107
353 3300025929 Ga0207664_10155592 Ga0207664_101555923 107
354 3300025931 Ga0207644_10003205 Ga0207644_100032053 107
355 3300025931 Ga0207644_10088588 Ga0207644_100885884 107
356 3300025932 Ga0207690_10242953 Ga0207690_102429533 107
357 3300025933 Ga0207706_10012582 Ga0207706_100125822 107
358 3300025933 Ga0207706_10322961 Ga0207706_103229611 107
359 3300025934 Ga0207686_10026756 Ga0207686_100267563 107
360 3300025934 Ga0207686_10263226 Ga0207686_102632262 107
361 3300025935 Ga0207709_10305998 Ga0207709_103059982 107
362 3300025935 Ga0207709_10556349 Ga0207709_105563492 107
363 3300025936 Ga0207670_10002509 Ga0207670_100025093 107
364 3300025937 Ga0207669_10268392 Ga0207669_102683922 107
365 3300025937 Ga0207669_11118101 Ga0207669_111181012 107
366 3300025938 Ga0207704_10036589 Ga0207704_100365892 107
367 3300025938 Ga0207704_10200876 Ga0207704_102008761 107
368 3300025939 Ga0207665_10001714 Ga0207665_1000171410 107
369 3300025939 Ga0207665_10099467 Ga0207665_100994672 107
370 3300025941 Ga0207711_10005059 Ga0207711_1000505910 107
371 3300025941 Ga0207711_10088567 Ga0207711_100885672 107
372 3300025942 Ga0207689_10071654 Ga0207689_100716543 107
373 3300025944 Ga0207661_10121150 Ga0207661_101211502 107
374 3300025945 Ga0207679_10080039 Ga0207679_100800392 107
375 3300025949 Ga0207667_10634180 Ga0207667_106341802 107
376 3300025960 Ga0207651_10403617 Ga0207651_104036172 107
377 3300025960 Ga0207651_10482261 Ga0207651_104822612 107
378 3300025986 Ga0207658_10514358 Ga0207658_105143582 107
379 3300026023 Ga0207677_10008719 Ga0207677_100087194 107
380 3300026035 Ga0207703_10018194 Ga0207703_100181942 107
381 3300026041 Ga0207639_10649741 Ga0207639_106497411 107
382 3300026041 Ga0207639_12239151 Ga0207639_122391512 107
383 3300026067 Ga0207678_10001936 Ga0207678_1000193618 107
384 3300026067 Ga0207678_10077251 Ga0207678_100772514 107
385 3300026067 Ga0207678_10184414 Ga0207678_101844143 107
386 3300026088 Ga0207641_10036929 Ga0207641_100369297 107
387 3300026095 Ga0207676_10005005 Ga0207676_100050058 107
388 3300026118 Ga0207675_100169850 Ga0207675_1001698502 107
389 3300026121 Ga0207683_10002621 Ga0207683_100026218 107
390 3300026121 Ga0207683_10115371 Ga0207683_101153712 107
391 3300028379 Ga0268266_10064928 Ga0268266_100649283 107
392 3300028379 Ga0268266_10781507 Ga0268266_107815072 107
393 3300028381 Ga0268264_10109244 Ga0268264_101092442 107
394 3300028556 Ga0265337_1030134 Ga0265337_10301342 107
395 3300029957 Ga0265324_10134480 Ga0265324_101344802 107
396 3300031241 Ga0265325_10002931 Ga0265325_100029318 107
397 3300031241 Ga0265325_10318279 Ga0265325_103182792 107
398 3300031249 Ga0265339_10002519 Ga0265339_100025198 107
399 3300031344 Ga0265316_10075468 Ga0265316_100754683 107
400 3300031595 Ga0265313_10001997 Ga0265313_1000199718 107
401 3300031711 Ga0265314_10014930 Ga0265314_100149303 107
402 3300032133 Ga0316583_10005292 Ga0316583_100052925 107
403 3300035086 Ga0373934_0102650 Ga0373934_0102650_707_1036 107
404 3300035089 Ga0373944_0072089 Ga0373944_0072089_593_922 107
405 3300035111 Ga0373923_0101355 Ga0373923_0101355_380_709 107
406 3300035112 Ga0373932_0080290 Ga0373932_0080290_32_361 107
407 3300035112 Ga0373932_0282086 Ga0373932_0282086_18_347 107
408 3300035113 Ga0373936_0160207 Ga0373936_0160207_240_569 107
409 3300035116 Ga0373945_0010904 Ga0373945_0010904_463_792 107
410 3300035117 Ga0373953_0026843 Ga0373953_0026843_1484_1813 107
411 3300035118 Ga0373954_0305248 Ga0373954_0305248_253_582 107
412 3300035119 Ga0373956_0032535 Ga0373956_0032535_377_706 107
413 3300035171 Ga0373946_0055982 Ga0373946_0055982_269_598 107
414 3300035172 Ga0373955_0181984 Ga0373955_0181984_360_689 107
415 3300035172 Ga0373955_0242322 Ga0373955_0242322_203_532 107
416 3300035207 Ga0373942_0126734 Ga0373942_0126734_55_384 107
417 3300035410 Ga0373924_0008269 Ga0373924_0008269_3287_3616 107
418 3300035692 Ga0373935_0497899 Ga0373935_0497899_354_683 107
419 3300035695 Ga0373927_0232431 Ga0373927_0232431_643_972 107
420 3300035724 Ga0373933_0665966 Ga0373933_0665966_103_432 107
421 3300035725 Ga0373947_0151815 Ga0373947_0151815_215_544 107
422 3300036401 Ga0373937_0093558 Ga0373937_0093558_1610_1939 107
423 3300036401 Ga0373937_0465594 Ga0373937_0465594_426_755 107
424 3300036401 Ga0373937_1892354 Ga0373937_1892354_114_443 107
425 3300037068 Ga0373925_0310543 Ga0373925_0310543_384_713 107
426 3300037312 Ga0395899_0148014 Ga0395899_0148014_1010_1339 107
427 3300037418 Ga0395900_0008079 Ga0395900_0008079_9408_9737 107
428 3300037418 Ga0395900_0683643 Ga0395900_0683643_346_675 107
429 3300037466 Ga0395898_0002839 Ga0395898_0002839_15135_15464 107
430 3300037466 Ga0395898_0191808 Ga0395898_0191808_686_1015 107
431 3300037466 Ga0395898_0951807 Ga0395898_0951807_334_663 107
432 3300038443 Ga0395901_0612312 Ga0395901_0612312_534_863 107
433 3300046454 Ga0495592_0013052 Ga0495592_0013052_4607_4936 107
434 3300046454 Ga0495592_0400810 Ga0495592_0400810_167_496 107
435 3300046455 Ga0495603_0153108 Ga0495603_0153108_64_393 107
436 3300046459 Ga0495629_0170224 Ga0495629_0170224_535_864 107
437 3300046463 Ga0495653_0010489 Ga0495653_0010489_287_616 107
438 3300046472 Ga0495580_0359205 Ga0495580_0359205_499_828 107
439 3300046476 Ga0495662_0467258 Ga0495662_0467258_219_548 107
440 3300046476 Ga0495662_0509396 Ga0495662_0509396_140_469 107
441 3300046477 Ga0495664_0010463 Ga0495664_0010463_1047_1376 107
442 3300046511 Ga0495608_0295982 Ga0495608_0295982_238_567 107
443 3300046514 Ga0495618_0001624 Ga0495618_0001624_14438_14767 107
444 3300046516 Ga0495628_1049998 Ga0495628_1049998_126_455 107
445 3300046517 Ga0495630_0183198 Ga0495630_0183198_758_1087 107
446 3300046526 Ga0495666_0074588 Ga0495666_0074588_394_723 107
447 3300046535 Ga0495586_0087988 Ga0495586_0087988_540_869 107
448 3300046535 Ga0495586_0439063 Ga0495586_0439063_82_411 107
449 3300046536 Ga0495587_0220756 Ga0495587_0220756_184_513 107
450 3300046543 Ga0495645_0338934 Ga0495645_0338934_104_433 107
451 3300046557 Ga0495622_0209802 Ga0495622_0209802_64_393 107
452 3300046559 Ga0495667_0015315 Ga0495667_0015315_282_611 107
453 3300046559 Ga0495667_0059379 Ga0495667_0059379_724_1053 107
454 3300046642 Ga0495634_0034949 Ga0495634_0034949_1484_1813 107
455 3300046642 Ga0495634_0244036 Ga0495634_0244036_188_517 107
456 3300046663 Ga0495635_0092806 Ga0495635_0092806_423_752 107
457 3300046663 Ga0495635_0217969 Ga0495635_0217969_189_518 107
458 3300046675 Ga0495657_0015348 Ga0495657_0015348_4235_4564 107
459 3300046675 Ga0495657_0192504 Ga0495657_0192504_599_928 107
460 3300046679 Ga0495623_0077738 Ga0495623_0077738_1028_1357 107
461 3300046680 Ga0495646_0006600 Ga0495646_0006600_1027_1356 107
462 3300046680 Ga0495646_0315715 Ga0495646_0315715_399_728 107
463 3300046681 Ga0495647_0021224 Ga0495647_0021224_1499_1828 107
464 3300046683 Ga0495658_0161036 Ga0495658_0161036_366_695 107
465 3300046690 Ga0495624_0029185 Ga0495624_0029185_798_1127 107
466 3300046809 Ga0495600_0001316 Ga0495600_0001316_10298_10627 107
467 3300046809 Ga0495600_0251436 Ga0495600_0251436_274_603 107
468 3300047317 Ga0495604_0069099 Ga0495604_0069099_1428_1757 107
469 3300047317 Ga0495604_0188544 Ga0495604_0188544_674_1003 107
470 3300047319 Ga0495674_0182793 Ga0495674_0182793_1386_1715 107
471 3300047319 Ga0495674_0481780 Ga0495674_0481780_180_509 107
472 3300047319 Ga0495674_0612573 Ga0495674_0612573_319_648 107
473 3300047321 Ga0495676_0373812 Ga0495676_0373812_520_849 107
474 3300047321 Ga0495676_0554001 Ga0495676_0554001_326_655 107
475 3300047322 Ga0495680_0003716 Ga0495680_0003716_254_583 107
476 3300047322 Ga0495680_0024306 Ga0495680_0024306_2475_2804 107
477 3300047444 Ga0495675_0000825 Ga0495675_0000825_6008_6337 107
478 3300047471 Ga0495684_0159506 Ga0495684_0159506_105_434 107
479 3300047673 Ga0495593_0042336 Ga0495593_0042336_1715_2044 107
480 3300047673 Ga0495593_0403932 Ga0495593_0403932_312_641 107
481 3300048088 Ga0495602_0047335 Ga0495602_0047335_3115_3444 107
482 3300048088 Ga0495602_0445207 Ga0495602_0445207_85_414 107
483 3300048088 Ga0495602_0718906 Ga0495602_0718906_118_447 107
484 3300048089 Ga0495614_0064643 Ga0495614_0064643_320_649 107
485 3300048903 Ga0496100_0062943 Ga0496100_0062943_479_808 107
486 3300048903 Ga0496100_0324919 Ga0496100_0324919_427_756 107
487 3300048904 Ga0496101_0022527 Ga0496101_0022527_1031_1360 107
488 3300048904 Ga0496101_0162093 Ga0496101_0162093_1038_1367 107
489 3300048905 Ga0496102_0002969 Ga0496102_0002969_2529_2858 107
490 3300048905 Ga0496102_0065885 Ga0496102_0065885_903_1232 107
491 3300048905 Ga0496102_0869405 Ga0496102_0869405_280_609 107
492 3300048906 Ga0496103_0013630 Ga0496103_0013630_4067_4396 107
493 3300048906 Ga0496103_0189205 Ga0496103_0189205_768_1097 107
494 3300048906 Ga0496103_0869857 Ga0496103_0869857_144_473 107
495 3300048907 Ga0496104_0018106 Ga0496104_0018106_4267_4596 107
496 3300048907 Ga0496104_0100591 Ga0496104_0100591_427_756 107
497 3300048907 Ga0496104_1679867 Ga0496104_1679867_80_409 107
498 3300048908 Ga0496105_0009940 Ga0496105_0009940_4075_4404 107
499 3300048908 Ga0496105_0614218 Ga0496105_0614218_87_416 107
500 3300048909 Ga0496106_0078833 Ga0496106_0078833_425_754 107
501 3300048909 Ga0496106_0134955 Ga0496106_0134955_1537_1866 107
502 3300048909 Ga0496106_0364752 Ga0496106_0364752_17_346 107
503 3300048910 Ga0496107_0023256 Ga0496107_0023256_874_1203 107
504 3300048910 Ga0496107_0142662 Ga0496107_0142662_205_534 107
505 3300048910 Ga0496107_1214975 Ga0496107_1214975_141_470 107
506 3300048911 Ga0496108_0136032 Ga0496108_0136032_449_778 107
507 3300048911 Ga0496108_0841044 Ga0496108_0841044_390_719 107
508 3300048912 Ga0496109_0042909 Ga0496109_0042909_3699_4028 107
509 3300048912 Ga0496109_0257680 Ga0496109_0257680_1198_1527 107
510 3300048913 Ga0496110_0042096 Ga0496110_0042096_2663_2992 107
511 3300048914 Ga0496111_0181927 Ga0496111_0181927_785_1114 107
512 3300048915 Ga0496112_0055254 Ga0496112_0055254_1796_2125 107
513 3300048916 Ga0496113_0892186 Ga0496113_0892186_234_563 107
514 3300048916 Ga0496113_1506776 Ga0496113_1506776_109_438 107
515 3300048917 Ga0496114_0006050 Ga0496114_0006050_8162_8491 107
516 3300048917 Ga0496114_0008678 Ga0496114_0008678_7336_7665 107
517 3300048918 Ga0496115_0122847 Ga0496115_0122847_1785_2114 107
518 3300048918 Ga0496115_0171803 Ga0496115_0171803_277_606 107
519 3300048918 Ga0496115_0257790 Ga0496115_0257790_657_986 107
520 3300048918 Ga0496115_0286968 Ga0496115_0286968_341_670 107
521 3300048924 Ga0496121_0101767 Ga0496121_0101767_1788_2117 107
522 3300048928 Ga0496125_0179316 Ga0496125_0179316_528_857 107
523 3300048929 Ga0496126_1036985 Ga0496126_1036985_167_496 107
524 3300049744 Ga0501083_0990206 Ga0501083_0990206_19_348 107
525 3300050490 nmdc:mga03n38_927435_c1 nmdc:mga03n38_927435_c1_121_450 107
526 3300050512 nmdc:mga0n895_107131_c1 nmdc:mga0n895_107131_c1_2285_2614 107
527 3300050512 nmdc:mga0n895_935902_c1 nmdc:mga0n895_935902_c1_233_562 107
528 3300050513 nmdc:mga0rr50_558984_c1 nmdc:mga0rr50_558984_c1_588_917 107
529 3300050514 nmdc:mga08x19_1300533_c1 nmdc:mga08x19_1300533_c1_16_345 107
530 3300053077 Ga0495601_0007672 Ga0495601_0007672_2667_2996 107
531 3300053077 Ga0495601_0079803 Ga0495601_0079803_1666_1995 107
532 3300053078 Ga0495612_0016931 Ga0495612_0016931_2155_2484 107
533 3300053084 Ga0495595_0003291 Ga0495595_0003291_3249_3578 107
534 3300053084 Ga0495595_0008792 Ga0495595_0008792_3727_4056 107
535 3300053085 Ga0495619_0000468 Ga0495619_0000468_14196_14525 107
536 3300003320 rootH2_10176943 rootH2_101769433 108
537 3300005336 Ga0070680_100641908 Ga0070680_1006419081 108
538 3300005457 Ga0070662_100380281 Ga0070662_1003802812 108
539 3300005458 Ga0070681_11718537 Ga0070681_117185372 108
540 3300005530 Ga0070679_100889898 Ga0070679_1008898981 108
541 3300005564 Ga0070664_100359794 Ga0070664_1003597942 108
542 3300005614 Ga0068856_100895798 Ga0068856_1008957982 108
543 3300009147 Ga0114129_10535068 Ga0114129_105350682 108
544 3300021384 Ga0213876_10042234 Ga0213876_100422343 108
545 3300026078 Ga0207702_10543384 Ga0207702_105433842 108
546 3300028556 Ga0265337_1015558 Ga0265337_10155584 108
547 3300031238 Ga0265332_10098849 Ga0265332_100988491 108
548 3300031249 Ga0265339_10283001 Ga0265339_102830012 108
549 3300031344 Ga0265316_10017290 Ga0265316_100172903 108
550 3300031595 Ga0265313_10112032 Ga0265313_101120322 108
551 3300031911 Ga0307412_12149219 Ga0307412_121492192 108
552 3300035086 Ga0373934_0024821 Ga0373934_0024821_166_501 108
553 3300035118 Ga0373954_0027925 Ga0373954_0027925_1307_1642 108
554 3300035119 Ga0373956_0055566 Ga0373956_0055566_1108_1443 108
555 3300035410 Ga0373924_0146308 Ga0373924_0146308_114_449 108
556 3300035724 Ga0373933_0021842 Ga0373933_0021842_1449_1784 108
557 3300036401 Ga0373937_0055703 Ga0373937_0055703_1789_2124 108
558 3300039437 Ga0436365_0184640 Ga0436365_0184640_1589_1939 108
559 3300039453 Ga0436362_0414516 Ga0436362_0414516_68_418 108
560 3300046462 Ga0495651_0205743 Ga0495651_0205743_1023_1358 108
561 3300046511 Ga0495608_0062219 Ga0495608_0062219_620_955 108
562 3300046516 Ga0495628_1183126 Ga0495628_1183126_107_442 108
563 3300046559 Ga0495667_0070675 Ga0495667_0070675_1357_1692 108
564 3300046663 Ga0495635_0599486 Ga0495635_0599486_177_512 108
565 3300046675 Ga0495657_0150852 Ga0495657_0150852_1043_1378 108
566 3300046809 Ga0495600_0047790 Ga0495600_0047790_1565_1900 108
567 3300047322 Ga0495680_0672165 Ga0495680_0672165_251_586 108
568 3300048088 Ga0495602_0606782 Ga0495602_0606782_22_357 108
569 3300049568 Ga0501031_0026245 Ga0501031_0026245_3010_3348 108
570 3300049569 Ga0501032_0034439 Ga0501032_0034439_951_1289 108
571 3300049570 Ga0501033_0006873 Ga0501033_0006873_133_471 108
572 3300049571 Ga0501034_0091081 Ga0501034_0091081_2441_2776 108
573 3300049571 Ga0501034_0171946 Ga0501034_0171946_1115_1453 108
574 3300049572 Ga0501036_0030607 Ga0501036_0030607_1774_2109 108
575 3300049572 Ga0501036_0207363 Ga0501036_0207363_1006_1344 108
576 3300049573 Ga0501037_0111993 Ga0501037_0111993_559_897 108
577 3300049574 Ga0501038_0095544 Ga0501038_0095544_2100_2438 108
578 3300049574 Ga0501038_0096460 Ga0501038_0096460_158_493 108
579 3300049575 Ga0501039_0035196 Ga0501039_0035196_1844_2182 108
580 3300049579 Ga0501043_0156745 Ga0501043_0156745_1360_1707 108
581 3300049581 Ga0501047_0179216 Ga0501047_0179216_922_1260 108
582 3300049582 Ga0501048_0209998 Ga0501048_0209998_619_954 108
583 3300049585 Ga0501069_0004220 Ga0501069_0004220_6258_6593 108
584 3300049586 Ga0501070_0004243 Ga0501070_0004243_1337_1672 108
585 3300049586 Ga0501070_0135004 Ga0501070_0135004_966_1304 108
586 3300049586 Ga0501070_0146014 Ga0501070_0146014_1491_1826 108
587 3300049586 Ga0501070_0257439 Ga0501070_0257439_462_809 108
588 3300049586 Ga0501070_0993124 Ga0501070_0993124_187_519 108
589 3300049587 Ga0501071_0063694 Ga0501071_0063694_1917_2252 108
590 3300049742 Ga0501080_0276558 Ga0501080_0276558_519_854 108
591 3300049744 Ga0501083_0444504 Ga0501083_0444504_336_689 108
592 3300049744 Ga0501083_0883259 Ga0501083_0883259_73_420 108
593 3300049822 Ga0501035_0001590 Ga0501035_0001590_15158_15493 108
594 3300049822 Ga0501035_0340700 Ga0501035_0340700_270_617 108
595 3300049823 Ga0501044_0527036 Ga0501044_0527036_46_384 108
596 3300050507 nmdc:mga05p37_1066971_c1 nmdc:mga05p37_1066971_c1_360_710 108
597 3300050508 nmdc:mga09592_1322420_c1 nmdc:mga09592_1322420_c1_201_551 108
598 3300050510 nmdc:mga06r32_404081_c1 nmdc:mga06r32_404081_c1_667_1017 108
599 3300053077 Ga0495601_0020464 Ga0495601_0020464_939_1274 108
600 3300053084 Ga0495595_0090233 Ga0495595_0090233_923_1258 108
601 3300053085 Ga0495619_0074226 Ga0495619_0074226_1838_2173 108
602 3300053086 Ga0500578_0152274 Ga0500578_0152274_592_924 108
603 3300053087 Ga0500643_009268 Ga0500643_009268_2670_3002 108
604 3300053088 Ga0500644_0000587 Ga0500644_0000587_9274_9606 108
605 3300053090 Ga0500646_0027538 Ga0500646_0027538_252_584 108
606 3300053094 Ga0500566_0089080 Ga0500566_0089080_151_483 108
607 3300053117 Ga0500593_001653 Ga0500593_001653_4882_5292 108
608 3300053119 Ga0500595_000083 Ga0500595_000083_2798_3130 108
609 3300053130 Ga0500642_0220330 Ga0500642_0220330_376_708 108
610 3300053131 Ga0500652_027162 Ga0500652_027162_379_711 108
611 3300053133 Ga0500655_057967 Ga0500655_057967_376_708 108
612 3300053139 Ga0500568_0179002 Ga0500568_0179002_391_723 108
613 3300053142 Ga0500577_0093864 Ga0500577_0093864_644_976 108
614 3300053153 Ga0500616_0000006 Ga0500616_0000006_307987_308319 108
615 3300053730 Ga0500645_000680 Ga0500645_000680_3046_3378 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10135

Rod-binding

Rod binding protein

56

107

0.88

Feature Viewer

pLDDT pTM Quality
60.46 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map