F469455

General Info

Members Datasets Scaffolds Average Seq Length
615 301 1230 371

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0079102|Ga0373934_0079102_106_1296
Length 396
Sequence LLERAPAHERLQGGAEVDVAIVGVGLHPFGRFGDRTGIDMGAIAIRRALADAGVEWRDIQFAFAGSYEIDNPDAVVGLLGLTGIPFTNVYNGCATAASVLALAADTIRLGEYELGLAVGMDKHLPGAFSADPRLYACPSWYGELGHFLTPKFFGMKINKYMHDHGISATTLARVAAKNYRNGARNPNAFRRKPLSEEEILGSRMLNYPLTQYMFCSPDEGAAAVVLCRADRAHRYTDKPIYLRASVVRTRRLGAFEVHSPWLPIEETVGPTVDASRAAFEKAGIGPEDVDVIQLQDTDAGAEVIHLAENGFCADGDQEALVAGGELEIGGRLPVNTDGGLIANGEPIGASGLRQVHEVVLQLRGRAGDRQVPGEPKVGYTQLYGAPGVAGVSILSL

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
176 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 2508501039 Frankia saprophytica CN3 Isolate Nodule
287 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
288 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
289 2671180195 Frankia sp. CcI49 Isolate Nodule
290 2687453737 Frankia sp. BMG5.36 Isolate Nodule
291 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
292 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
293 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
294 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
295 2773857922 Frankia sp. CcI49 Isolate Nodule
296 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
297 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
298 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
299 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
300 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
301 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 1.46
Rhizoplane 11.06
Rhizosphere 72.85
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0079102 3300035086 Bacteria 1320
2 JGI24744J21845_10001450 3300002077 Bacteria 4710
3 JGI24742J22300_10004787 3300002244 Bacteria 2222
4 Ga0070676_10008986 3300005328 Bacteria 5405
5 Ga0070690_100104259 3300005330 Bacteria 1884
6 Ga0068869_100103160 3300005334 Bacteria 2160
7 Ga0070666_10020468 3300005335 Bacteria 4276
8 Ga0070666_10025542 3300005335 Bacteria 3852
9 Ga0070666_10188765 3300005335 Bacteria 1448
10 Ga0070680_100035113 3300005336 Bacteria 4046
11 Ga0068868_100025344 3300005338 Bacteria 4510
12 Ga0068868_100078358 3300005338 Bacteria 2645
13 Ga0070660_100038056 3300005339 Bacteria 3650
14 Ga0070661_100023576 3300005344 Bacteria 4412
15 Ga0070668_100012178 3300005347 Bacteria 6405
16 Ga0070668_100058745 3300005347 Bacteria 2976
17 Ga0070668_100139831 3300005347 Bacteria 1950
18 Ga0070669_100002044 3300005353 Bacteria 14599
19 Ga0070669_100025984 3300005353 Bacteria 4211
20 Ga0070671_100153890 3300005355 Bacteria 1942
21 Ga0070674_100067527 3300005356 Bacteria 2515
22 Ga0070673_100219729 3300005364 Bacteria 1644
23 Ga0070659_100006032 3300005366 Bacteria 8739
24 Ga0070659_100013788 3300005366 Bacteria 6028
25 Ga0070667_100000087 3300005367 Bacteria 114528
26 Ga0070667_100009215 3300005367 Bacteria 8175
27 Ga0070709_10002093 3300005434 Bacteria 10807
28 Ga0070710_10028003 3300005437 Bacteria 3010
29 Ga0070701_10010636 3300005438 Bacteria 4078
30 Ga0070711_100001182 3300005439 Bacteria 14074
31 Ga0070711_100135516 3300005439 Bacteria 1840
32 Ga0070705_100075588 3300005440 Bacteria 2051
33 Ga0070700_100005234 3300005441 Bacteria 6859
34 Ga0070708_100064898 3300005445 Bacteria 3273
35 Ga0070678_100000500 3300005456 Bacteria 18858
36 Ga0070678_100006205 3300005456 Bacteria 6991
37 Ga0070662_100106134 3300005457 Bacteria 2133
38 Ga0070681_10002125 3300005458 Bacteria 18000
39 Ga0068867_100002343 3300005459 Bacteria 13335
40 Ga0068867_100169717 3300005459 Bacteria 1727
41 Ga0070706_100004945 3300005467 Bacteria 12758
42 Ga0070706_100053435 3300005467 Bacteria 3729
43 Ga0070706_100127806 3300005467 Bacteria 2371
44 Ga0070707_100096907 3300005468 Bacteria 2857
45 Ga0070698_100126626 3300005471 Bacteria 2511
46 Ga0070679_100013562 3300005530 Bacteria 7809
47 Ga0070697_100015065 3300005536 Bacteria 6068
48 Ga0068853_100004321 3300005539 Bacteria 10990
49 Ga0068853_100019629 3300005539 Bacteria 5609
50 Ga0068853_100594600 3300005539 Bacteria 1050
51 Ga0070686_100055246 3300005544 Bacteria 2543
52 Ga0070686_100120598 3300005544 Bacteria 1800
53 Ga0070695_100039160 3300005545 Bacteria 2995
54 Ga0070696_100005683 3300005546 Bacteria 8330
55 Ga0070696_100086311 3300005546 Bacteria 2228
56 Ga0070665_100004632 3300005548 Bacteria 14375
57 Ga0070665_100008710 3300005548 Bacteria 10265
58 Ga0070665_100036330 3300005548 Bacteria 4956
59 Ga0070704_100022332 3300005549 Bacteria 4116
60 Ga0068855_100013728 3300005563 Bacteria 9765
61 Ga0068857_100000182 3300005577 Bacteria 40235
62 Ga0068854_100005400 3300005578 Bacteria 8068
63 Ga0068852_100130720 3300005616 Bacteria 2312
64 Ga0068859_100001028 3300005617 Bacteria 28595
65 Ga0068859_100008906 3300005617 Bacteria 10133
66 Ga0068859_100128881 3300005617 Bacteria 2601
67 Ga0068859_100301423 3300005617 Bacteria 1696
68 Ga0068864_100050625 3300005618 Bacteria 3576
69 Ga0068866_10007334 3300005718 Bacteria 4617
70 Ga0068866_10087964 3300005718 Bacteria 1685
71 Ga0068861_100000802 3300005719 Bacteria 18966
72 Ga0068863_100000179 3300005841 Bacteria 67666
73 Ga0068863_100061251 3300005841 Bacteria 3558
74 Ga0068863_100104365 3300005841 Bacteria 2696
75 Ga0068858_100000362 3300005842 Bacteria 47914
76 Ga0068858_100002057 3300005842 Bacteria 20489
77 Ga0068858_100021520 3300005842 Bacteria 6026
78 Ga0068858_100050448 3300005842 Bacteria 3851
79 Ga0068860_100000020 3300005843 Bacteria 283324
80 Ga0068860_100001507 3300005843 Bacteria 25102
81 Ga0068860_100015476 3300005843 Bacteria 7448
82 Ga0068860_100022194 3300005843 Bacteria 6145
83 Ga0068860_100154165 3300005843 Bacteria 2214
84 Ga0068862_100000013 3300005844 Bacteria 263115
85 Ga0068862_100001972 3300005844 Bacteria 18617
86 Ga0068862_100025118 3300005844 Bacteria 5001
87 Ga0068862_100044923 3300005844 Bacteria 3768
88 Ga0081455_10062381 3300005937 Bacteria 3133
89 Ga0081455_10101635 3300005937 Bacteria 2307
90 Ga0081538_10006021 3300005981 Bacteria 10778
91 Ga0081539_10062663 3300005985 Bacteria 2032
92 Ga0075365_10002572 3300006038 Bacteria 8961
93 Ga0075365_10005505 3300006038 Bacteria 6838
94 Ga0075365_10016651 3300006038 Bacteria 4476
95 Ga0075365_10064448 3300006038 Bacteria 2455
96 Ga0075365_10136279 3300006038 Bacteria 1702
97 Ga0075363_100000251 3300006048 Bacteria 15253
98 Ga0075363_100003925 3300006048 Bacteria 6416
99 Ga0075363_100007956 3300006048 Bacteria 4910
100 Ga0075363_100061778 3300006048 Bacteria 2019
101 Ga0075364_10000251 3300006051 Bacteria 25860
102 Ga0075364_10013826 3300006051 Bacteria 4973
103 Ga0075364_10097537 3300006051 Bacteria 1955
104 Ga0075364_10103518 3300006051 Bacteria 1896
105 Ga0070716_100005152 3300006173 Bacteria 6317
106 Ga0070716_100005522 3300006173 Bacteria 6131
107 Ga0070712_100002123 3300006175 Bacteria 12192
108 Ga0070712_100096059 3300006175 Bacteria 2181
109 Ga0075367_10060547 3300006178 Bacteria 2258
110 Ga0075369_10000014 3300006186 Bacteria 63974
111 Ga0075369_10015154 3300006186 Bacteria 3090
112 Ga0075369_10020642 3300006186 Bacteria 2699
113 Ga0075369_10098748 3300006186 Bacteria 1308
114 Ga0075370_10008121 3300006353 Bacteria 5389
115 Ga0075370_10025088 3300006353 Bacteria 3296
116 Ga0068871_100045682 3300006358 Bacteria 3526
117 Ga0075428_100000955 3300006844 Bacteria 30623
118 Ga0075428_100017380 3300006844 Bacteria 7949
119 Ga0075428_100179690 3300006844 Bacteria 2291
120 Ga0075428_100267455 3300006844 Bacteria 1840
121 Ga0075428_100365868 3300006844 Bacteria 1547
122 Ga0075430_100002600 3300006846 Bacteria 15070
123 Ga0075430_100006032 3300006846 Bacteria 10218
124 Ga0075430_100043956 3300006846 Bacteria 3778
125 Ga0075430_100058794 3300006846 Bacteria 3232
126 Ga0075430_100120304 3300006846 Bacteria 2189
127 Ga0075430_100147915 3300006846 Bacteria 1956
128 Ga0075431_100000463 3300006847 Bacteria 33500
129 Ga0075431_100052419 3300006847 Bacteria 4207
130 Ga0075431_100081748 3300006847 Bacteria 3335
131 Ga0075429_100000747 3300006880 Bacteria 25547
132 Ga0068865_100014751 3300006881 Bacteria 4972
133 Ga0068865_100016525 3300006881 Bacteria 4725
134 Ga0068865_100098077 3300006881 Bacteria 2140
135 Ga0097620_100001028 3300006931 Bacteria 28595
136 Ga0097620_100008906 3300006931 Bacteria 10133
137 Ga0097620_100128886 3300006931 Bacteria 2601
138 Ga0097620_100301452 3300006931 Bacteria 1696
139 Ga0111539_10015515 3300009094 Bacteria 9472
140 Ga0105245_10025795 3300009098 Bacteria 5169
141 Ga0105245_10119320 3300009098 Bacteria 2462
142 Ga0105245_10198990 3300009098 Bacteria 1923
143 Ga0105247_10000009 3300009101 Bacteria 385991
144 Ga0105247_10000567 3300009101 Bacteria 30080
145 Ga0105247_10002169 3300009101 Bacteria 13546
146 Ga0105247_10006631 3300009101 Bacteria 7152
147 Ga0105247_10079562 3300009101 Bacteria 2063
148 Ga0105247_10125252 3300009101 Bacteria 1669
149 Ga0114129_10000160 3300009147 Bacteria 72462
150 Ga0114129_10043001 3300009147 Bacteria 6359
151 Ga0114129_10254176 3300009147 Bacteria 2358
152 Ga0105242_10005246 3300009176 Bacteria 10000
153 Ga0105248_10000149 3300009177 Bacteria 81262
154 Ga0105248_10000207 3300009177 Bacteria 67863
155 Ga0105248_10011233 3300009177 Bacteria 9875
156 Ga0105248_10031749 3300009177 Bacteria 5901
157 Ga0105248_10250612 3300009177 Bacteria 1993
158 Ga0105248_10299155 3300009177 Bacteria 1812
159 Ga0105248_10422200 3300009177 Bacteria 1502
160 Ga0105237_10009576 3300009545 Bacteria 10372
161 Ga0105237_10035151 3300009545 Bacteria 5072
162 Ga0105237_10076897 3300009545 Bacteria 3328
163 Ga0105249_10000057 3300009553 Bacteria 159358
164 Ga0105249_10039234 3300009553 Bacteria 4299
165 Ga0105249_10072957 3300009553 Bacteria 3174
166 Ga0105249_10316739 3300009553 Bacteria 1570
167 Ga0099796_10053710 3300010159 Bacteria 1406
168 Ga0105239_10016100 3300010375 Bacteria 8273
169 Ga0105239_10618639 3300010375 Bacteria 1236
170 Ga0157378_10007174 3300013297 Bacteria 9732
171 Ga0157378_10034495 3300013297 Bacteria 4475
172 Ga0163162_10020009 3300013306 Bacteria 6574
173 Ga0163162_10023109 3300013306 Bacteria 6134
174 Ga0163162_10090573 3300013306 Bacteria 3140
175 Ga0163162_10200567 3300013306 Bacteria 2124
176 Ga0157372_10069368 3300013307 Bacteria 3965
177 Ga0157375_10002051 3300013308 Bacteria 17385
178 Ga0157375_10033752 3300013308 Bacteria 4867
179 Ga0157375_10244117 3300013308 Bacteria 1956
180 Ga0157375_10419938 3300013308 Bacteria 1503
181 Ga0163163_10078857 3300014325 Bacteria 3291
182 Ga0163163_10080741 3300014325 Bacteria 3253
183 Ga0163163_10190891 3300014325 Bacteria 2097
184 Ga0157380_10000197 3300014326 Bacteria 35381
185 Ga0182008_10099420 3300014497 Bacteria 1437
186 Ga0157377_10008025 3300014745 Bacteria 5131
187 Ga0157379_10012717 3300014968 Bacteria 7357
188 Ga0157379_10014574 3300014968 Bacteria 6895
189 Ga0157379_10041898 3300014968 Bacteria 4087
190 Ga0163161_10002525 3300017792 Bacteria 13055
191 Ga0163161_10166811 3300017792 Bacteria 1682
192 Ga0213876_10008455 3300021384 Bacteria 5572
193 Ga0209051_1000011 3300025303 Bacteria 610828
194 Ga0207692_10019358 3300025898 Bacteria 3075
195 Ga0207642_10004258 3300025899 Bacteria 4606
196 Ga0207710_10000014 3300025900 Bacteria 408072
197 Ga0207710_10000385 3300025900 Bacteria 30161
198 Ga0207710_10010683 3300025900 Bacteria 3865
199 Ga0207688_10004049 3300025901 Bacteria 7982
200 Ga0207680_10004292 3300025903 Bacteria 6754
201 Ga0207680_10096491 3300025903 Bacteria 1891
202 Ga0207699_10098385 3300025906 Bacteria 1851
203 Ga0207684_10028404 3300025910 Bacteria 4766
204 Ga0207684_10203829 3300025910 Bacteria 1706
205 Ga0207654_10072301 3300025911 Bacteria 2053
206 Ga0207707_10002131 3300025912 Bacteria 17924
207 Ga0207671_10165783 3300025914 Bacteria 1713
208 Ga0207671_10203168 3300025914 Bacteria 1548
209 Ga0207693_10022276 3300025915 Bacteria 5035
210 Ga0207693_10086636 3300025915 Bacteria 2454
211 Ga0207693_10160620 3300025915 Bacteria 1768
212 Ga0207663_10251430 3300025916 Bacteria 1301
213 Ga0207660_10024879 3300025917 Bacteria 4057
214 Ga0207660_10145750 3300025917 Bacteria 1815
215 Ga0207657_10048079 3300025919 Bacteria 3726
216 Ga0207652_10015162 3300025921 Bacteria 6254
217 Ga0207681_10003465 3300025923 Bacteria 9831
218 Ga0207681_10006423 3300025923 Bacteria 7218
219 Ga0207687_10118206 3300025927 Bacteria 1978
220 Ga0207644_10199936 3300025931 Bacteria 1576
221 Ga0207690_10006389 3300025932 Bacteria 6985
222 Ga0207706_10040456 3300025933 Bacteria 4131
223 Ga0207706_10148167 3300025933 Bacteria 2065
224 Ga0207686_10011997 3300025934 Bacteria 4757
225 Ga0207709_10056934 3300025935 Bacteria 2422
226 Ga0207670_10095827 3300025936 Bacteria 2109
227 Ga0207669_10006072 3300025937 Bacteria 5482
228 Ga0207669_10017724 3300025937 Bacteria 3661
229 Ga0207704_10010332 3300025938 Bacteria 4549
230 Ga0207704_10025135 3300025938 Bacteria 3245
231 Ga0207665_10001010 3300025939 Bacteria 19000
232 Ga0207665_10008406 3300025939 Bacteria 6809
233 Ga0207711_10000186 3300025941 Bacteria 66552
234 Ga0207711_10000242 3300025941 Bacteria 58458
235 Ga0207711_10013914 3300025941 Bacteria 6683
236 Ga0207711_10017815 3300025941 Bacteria 5901
237 Ga0207711_10171014 3300025941 Bacteria 1971
238 Ga0207711_10290246 3300025941 Bacteria 1507
239 Ga0207711_10296127 3300025941 Bacteria 1492
240 Ga0207689_10097579 3300025942 Bacteria 2414
241 Ga0207679_10002442 3300025945 Bacteria 11442
242 Ga0207667_10003569 3300025949 Bacteria 19224
243 Ga0207712_10000050 3300025961 Bacteria 159469
244 Ga0207712_10000125 3300025961 Bacteria 82077
245 Ga0207712_10022484 3300025961 Bacteria 4153
246 Ga0207712_10340107 3300025961 Bacteria 1244
247 Ga0207668_10020454 3300025972 Bacteria 4205
248 Ga0207668_10038795 3300025972 Bacteria 3200
249 Ga0207668_10106383 3300025972 Bacteria 2095
250 Ga0207640_10216421 3300025981 Bacteria 1463
251 Ga0207658_10000065 3300025986 Bacteria 117079
252 Ga0207658_10063304 3300025986 Bacteria 2771
253 Ga0207658_10090262 3300025986 Bacteria 2374
254 Ga0207677_10091360 3300026023 Bacteria 2214
255 Ga0207677_10244264 3300026023 Bacteria 1454
256 Ga0207703_10023779 3300026035 Bacteria 4820
257 Ga0207703_10058340 3300026035 Bacteria 3150
258 Ga0207703_10058981 3300026035 Bacteria 3135
259 Ga0207703_10108631 3300026035 Bacteria 2363
260 Ga0207639_10006398 3300026041 Bacteria 8001
261 Ga0207639_10045750 3300026041 Bacteria 3298
262 Ga0207708_10010564 3300026075 Bacteria 6855
263 Ga0207641_10000682 3300026088 Bacteria 36701
264 Ga0207641_10001037 3300026088 Bacteria 28179
265 Ga0207648_10004710 3300026089 Bacteria 13951
266 Ga0207648_10167979 3300026089 Bacteria 1939
267 Ga0207648_10379508 3300026089 Bacteria 1278
268 Ga0207676_10008397 3300026095 Bacteria 7341
269 Ga0207674_10000124 3300026116 Bacteria 89220
270 Ga0207675_100002573 3300026118 Bacteria 17967
271 Ga0207683_10001516 3300026121 Bacteria 20909
272 Ga0207683_10042518 3300026121 Bacteria 3969
273 Ga0207698_10064722 3300026142 Bacteria 2867
274 Ga0207698_10415024 3300026142 Bacteria 1290
275 Ga0207428_10005918 3300027907 Bacteria 11324
276 Ga0268266_10002104 3300028379 Bacteria 21995
277 Ga0268266_10017884 3300028379 Bacteria 6041
278 Ga0268266_10031723 3300028379 Bacteria 4489
279 Ga0268266_10111071 3300028379 Bacteria 2429
280 Ga0268266_10228455 3300028379 Bacteria 1713
281 Ga0268265_10000004 3300028380 Bacteria 648376
282 Ga0268265_10000274 3300028380 Bacteria 58577
283 Ga0268265_10024437 3300028380 Bacteria 4275
284 Ga0268265_10056615 3300028380 Bacteria 2984
285 Ga0268264_10000024 3300028381 Bacteria 470081
286 Ga0268264_10000216 3300028381 Bacteria 113846
287 Ga0268264_10036050 3300028381 Bacteria 4072
288 Ga0268264_10298690 3300028381 Bacteria 1515
289 Ga0265338_10000221 3300028800 Bacteria 105982
290 Ga0265325_10001081 3300031241 Bacteria 19617
291 Ga0265339_10001830 3300031249 Bacteria 15599
292 Ga0265327_10001233 3300031251 Bacteria 34340
293 Ga0265327_10002298 3300031251 Bacteria 20489
294 Ga0265327_10002710 3300031251 Bacteria 18144
295 Ga0265327_10012720 3300031251 Bacteria 5653
296 Ga0265327_10043456 3300031251 Bacteria 2404
297 Ga0265316_10046648 3300031344 Bacteria 3432
298 Ga0316575_10054581 3300031665 Bacteria 1591
299 Ga0265314_10052246 3300031711 Bacteria 2842
300 Ga0316576_10014696 3300031727 Bacteria 5235
301 Ga0307516_10000380 3300031730 Bacteria 58225
302 Ga0316577_10020380 3300031733 Unclassified 3675
303 Ga0307413_10027857 3300031824 Bacteria 3138
304 Ga0307410_10002012 3300031852 Bacteria 9588
305 Ga0307410_10013018 3300031852 Bacteria 4836
306 Ga0307407_10028431 3300031903 Bacteria 2989
307 Ga0307409_100019528 3300031995 Bacteria 4592
308 Ga0307409_100057237 3300031995 Bacteria 3020
309 Ga0307416_100226064 3300032002 Bacteria 1800
310 Ga0373928_0000694 3300035084 Bacteria 6604
311 Ga0373929_0000577 3300035085 Bacteria 7071
312 Ga0373929_0001206 3300035085 Bacteria 5002
313 Ga0373929_0001419 3300035085 Bacteria 4596
314 Ga0373932_0000065 3300035112 Bacteria 26199
315 Ga0373932_0000834 3300035112 Bacteria 9113
316 Ga0373932_0001362 3300035112 Bacteria 6848
317 Ga0373954_0042578 3300035118 Bacteria 2117
318 Ga0373956_0019704 3300035119 Bacteria 2863
319 Ga0373955_0026848 3300035172 Bacteria 2971
320 Ga0316574_0010153 3300035398 Bacteria 5307
321 Ga0316574_0030538 3300035398 Bacteria 3264
322 Ga0316574_0058732 3300035398 Bacteria 2410
323 Ga0373924_0013307 3300035410 Bacteria 3089
324 Ga0373931_0000010 3300035691 Bacteria 334069
325 Ga0373931_0000021 3300035691 Bacteria 142586
326 Ga0373931_0000032 3300035691 Bacteria 96498
327 Ga0373931_0000099 3300035691 Bacteria 40052
328 Ga0373931_0020193 3300035691 Bacteria 3331
329 Ga0373931_0103059 3300035691 Bacteria 1608
330 Ga0373935_0132374 3300035692 Bacteria 1677
331 Ga0373947_0114632 3300035725 Bacteria 1707
332 Ga0373937_0026182 3300036401 Bacteria 5270
333 Ga0373937_0135830 3300036401 Bacteria 2299
334 Ga0316584_0025851 3300036712 Bacteria 4309
335 Ga0316584_0045072 3300036712 Bacteria 3291
336 Ga0316584_0153236 3300036712 Bacteria 1715
337 Ga0373925_0138305 3300037068 Bacteria 1905
338 Ga0373925_0366626 3300037068 Bacteria 1171
339 Ga0395898_0034832 3300037466 Bacteria 5012
340 Ga0395901_0020120 3300038443 Bacteria 6830
341 Ga0436365_0263873 3300039437 Bacteria 3132
342 Ga0436365_0772403 3300039437 Bacteria 19656
343 Ga0436365_1680197 3300039437 Bacteria 4135
344 Ga0436362_0314905 3300039453 Bacteria 2446
345 Ga0439461_0003325 3300041410 Bacteria 2637
346 Ga0439466_0010614 3300041411 Bacteria 3423
347 Ga0439466_0035619 3300041411 Bacteria 1683
348 Ga0439465_0010588 3300041413 Bacteria 2895
349 Ga0451843_1685753 3300041509 Bacteria 1453
350 Ga0439445_0019890 3300042004 Bacteria 1677
351 Ga0439448_0010136 3300042005 Bacteria 2787
352 Ga0439450_003248 3300042008 Bacteria 2664
353 Ga0439446_0053664 3300042156 Bacteria 1208
354 Ga0439434_0010677 3300042435 Bacteria 2709
355 Ga0439435_0012355 3300042436 Bacteria 2068
356 Ga0439464_0004187 3300042439 Bacteria 3677
357 Ga0466972_0053197 3300044658 Bacteria 1950
358 Ga0466972_0072740 3300044658 Bacteria 1639
359 Ga0466972_0108642 3300044658 Bacteria 1311
360 Ga0466965_0013555 3300044683 Bacteria 3848
361 Ga0466966_0010550 3300044684 Bacteria 6141
362 Ga0466963_0040154 3300044694 Bacteria 3067
363 Ga0466957_0087700 3300044842 Bacteria 1946
364 Ga0466960_0000275 3300044901 Bacteria 17862
365 Ga0466967_0031796 3300045976 Bacteria 4449
366 Ga0466967_0088962 3300045976 Bacteria 2803
367 Ga0495603_0024387 3300046455 Bacteria 3658
368 Ga0495629_0046465 3300046459 Bacteria 3045
369 Ga0495638_0000482 3300046460 Bacteria 47851
370 Ga0495638_0036177 3300046460 Bacteria 3146
371 Ga0495641_0024306 3300046461 Bacteria 2993
372 Ga0495653_0106604 3300046463 Bacteria 2021
373 Ga0495618_0014172 3300046514 Bacteria 4854
374 Ga0495618_0045768 3300046514 Bacteria 2761
375 Ga0495628_0001164 3300046516 Bacteria 23988
376 Ga0495630_0008045 3300046517 Bacteria 7580
377 Ga0495630_0010386 3300046517 Bacteria 6720
378 Ga0495630_0182710 3300046517 Bacteria 1599
379 Ga0495630_0184975 3300046517 Bacteria 1589
380 Ga0495666_0056421 3300046526 Bacteria 1881
381 Ga0495665_0014826 3300046531 Bacteria 4199
382 Ga0495640_0023851 3300046533 Bacteria 4451
383 Ga0495640_0027387 3300046533 Bacteria 4111
384 Ga0495586_0023419 3300046535 Bacteria 3298
385 Ga0495586_0063109 3300046535 Bacteria 2018
386 Ga0495622_0054933 3300046557 Bacteria 1847
387 Ga0495668_0114843 3300046616 Bacteria 1473
388 Ga0495634_0004081 3300046642 Bacteria 11565
389 Ga0495625_0026047 3300046660 Bacteria 4423
390 Ga0495657_0079855 3300046675 Bacteria 2118
391 Ga0495658_0011420 3300046683 Bacteria 4467
392 Ga0495658_0041078 3300046683 Bacteria 2574
393 Ga0495658_0087000 3300046683 Bacteria 1845
394 Ga0495658_0147453 3300046683 Bacteria 1443
395 Ga0495613_0000311 3300046689 Bacteria 44152
396 Ga0495613_0006477 3300046689 Bacteria 8751
397 Ga0495674_0005723 3300047319 Bacteria 11910
398 Ga0495672_0003401 3300047320 Bacteria 13659
399 Ga0495672_0015063 3300047320 Bacteria 5263
400 Ga0495680_0103766 3300047322 Bacteria 2116
401 Ga0495680_0164324 3300047322 Bacteria 1610
402 Ga0495680_0218412 3300047322 Bacteria 1362
403 Ga0495684_0006064 3300047471 Bacteria 9396
404 Ga0495593_0014031 3300047673 Bacteria 4562
405 Ga0495602_0224174 3300048088 Bacteria 1417
406 Ga0496100_0006932 3300048903 Bacteria 6211
407 Ga0496100_0016625 3300048903 Bacteria 4325
408 Ga0496100_0088972 3300048903 Bacteria 2103
409 Ga0496101_0000340 3300048904 Bacteria 31505
410 Ga0496101_0004400 3300048904 Bacteria 8854
411 Ga0496101_0010120 3300048904 Bacteria 6218
412 Ga0496101_0025060 3300048904 Bacteria 4135
413 Ga0496101_0150165 3300048904 Bacteria 1782
414 Ga0496101_0168648 3300048904 Bacteria 1682
415 Ga0496102_0000388 3300048905 Bacteria 51859
416 Ga0496102_0000845 3300048905 Bacteria 29432
417 Ga0496102_0023926 3300048905 Bacteria 5429
418 Ga0496102_0040648 3300048905 Bacteria 4207
419 Ga0496102_0043566 3300048905 Bacteria 4070
420 Ga0496102_0099009 3300048905 Bacteria 2706
421 Ga0496102_0277210 3300048905 Bacteria 1581
422 Ga0496102_0287019 3300048905 Bacteria 1551
423 Ga0496103_0000818 3300048906 Bacteria 22805
424 Ga0496103_0003914 3300048906 Bacteria 9056
425 Ga0496103_0011471 3300048906 Bacteria 5252
426 Ga0496103_0012445 3300048906 Bacteria 5047
427 Ga0496104_0000946 3300048907 Bacteria 24980
428 Ga0496104_0016843 3300048907 Bacteria 6644
429 Ga0496104_0076378 3300048907 Bacteria 3191
430 Ga0496105_0024106 3300048908 Bacteria 4942
431 Ga0496105_0089072 3300048908 Bacteria 2549
432 Ga0496106_0000748 3300048909 Bacteria 23456
433 Ga0496106_0001694 3300048909 Bacteria 16483
434 Ga0496106_0008941 3300048909 Bacteria 7403
435 Ga0496106_0060311 3300048909 Bacteria 2875
436 Ga0496107_0003264 3300048910 Bacteria 10807
437 Ga0496107_0005846 3300048910 Bacteria 8420
438 Ga0496107_0011797 3300048910 Bacteria 6101
439 Ga0496107_0020721 3300048910 Bacteria 4646
440 Ga0496107_0150805 3300048910 Bacteria 1720
441 Ga0496108_0014457 3300048911 Bacteria 6444
442 Ga0496108_0023250 3300048911 Bacteria 5098
443 Ga0496108_0025201 3300048911 Bacteria 4901
444 Ga0496109_0002296 3300048912 Bacteria 15903
445 Ga0496109_0008781 3300048912 Bacteria 8606
446 Ga0496109_0029667 3300048912 Bacteria 4900
447 Ga0496109_0046408 3300048912 Bacteria 3946
448 Ga0496109_0239200 3300048912 Bacteria 1708
449 Ga0496109_0243202 3300048912 Bacteria 1694
450 Ga0496110_0031941 3300048913 Bacteria 4544
451 Ga0496111_0041310 3300048914 Bacteria 3309
452 Ga0496111_0105497 3300048914 Bacteria 2074
453 Ga0496111_0187256 3300048914 Bacteria 1539
454 Ga0496112_0000758 3300048915 Bacteria 22643
455 Ga0496112_0031876 3300048915 Bacteria 5115
456 Ga0496112_0065106 3300048915 Bacteria 3597
457 Ga0496112_0073884 3300048915 Bacteria 3370
458 Ga0496113_0011350 3300048916 Bacteria 5937
459 Ga0496113_0025081 3300048916 Bacteria 4246
460 Ga0496114_0000231 3300048917 Bacteria 40742
461 Ga0496114_0007956 3300048917 Bacteria 8389
462 Ga0496114_0017850 3300048917 Bacteria 5735
463 Ga0496114_0060137 3300048917 Bacteria 3175
464 Ga0496114_0091488 3300048917 Bacteria 2584
465 Ga0496114_0137669 3300048917 Bacteria 2112
466 Ga0496114_0196227 3300048917 Bacteria 1767
467 Ga0496114_0237097 3300048917 Bacteria 1603
468 Ga0496115_0000317 3300048918 Bacteria 41021
469 Ga0496115_0002011 3300048918 Bacteria 14531
470 Ga0496115_0015425 3300048918 Bacteria 5795
471 Ga0496115_0036793 3300048918 Bacteria 3877
472 Ga0496115_0077318 3300048918 Bacteria 2706
473 Ga0496115_0187333 3300048918 Bacteria 1710
474 Ga0496116_0020421 3300048919 Bacteria 5030
475 Ga0496117_0001931 3300048920 Bacteria 27661
476 Ga0496117_0003589 3300048920 Bacteria 17902
477 Ga0496117_0012203 3300048920 Bacteria 7602
478 Ga0496118_0000514 3300048921 Bacteria 63548
479 Ga0496118_0000849 3300048921 Bacteria 48523
480 Ga0496118_0011323 3300048921 Bacteria 8719
481 Ga0496118_0011623 3300048921 Bacteria 8562
482 Ga0496118_0040269 3300048921 Bacteria 3717
483 Ga0496119_0001677 3300048922 Bacteria 25898
484 Ga0496119_0034366 3300048922 Bacteria 3341
485 Ga0496120_0027335 3300048923 Bacteria 3511
486 Ga0496120_0028931 3300048923 Bacteria 3389
487 Ga0496121_0000499 3300048924 Bacteria 74965
488 Ga0496121_0000969 3300048924 Bacteria 51507
489 Ga0496121_0063949 3300048924 Bacteria 3002
490 Ga0496122_0001146 3300048925 Bacteria 45483
491 Ga0496123_0006691 3300048926 Bacteria 11106
492 Ga0496124_0000429 3300048927 Bacteria 74954
493 Ga0496124_0014655 3300048927 Bacteria 7568
494 Ga0496125_0000448 3300048928 Bacteria 74965
495 Ga0496125_0009543 3300048928 Bacteria 9953
496 Ga0496125_0134505 3300048928 Bacteria 1732
497 Ga0496126_0000037 3300048929 Bacteria 353425
498 Ga0496126_0000520 3300048929 Bacteria 74965
499 Ga0496126_0001363 3300048929 Bacteria 38686
500 Ga0496126_0006601 3300048929 Bacteria 12915
501 Ga0496126_0013632 3300048929 Bacteria 8250
502 Ga0496126_0024847 3300048929 Bacteria 5777
503 Ga0501033_0122895 3300049570 Bacteria 1883
504 Ga0501034_0002643 3300049571 Bacteria 21229
505 Ga0501034_0019515 3300049571 Bacteria 6933
506 Ga0501034_0096637 3300049571 Bacteria 2950
507 Ga0501034_0219132 3300049571 Bacteria 1856
508 Ga0501036_0138387 3300049572 Bacteria 2055
509 Ga0501036_0256690 3300049572 Bacteria 1464
510 Ga0501037_0001055 3300049573 Bacteria 20404
511 Ga0501039_0000342 3300049575 Bacteria 33472
512 Ga0501039_0117167 3300049575 Bacteria 2086
513 Ga0501040_0072848 3300049576 Bacteria 2373
514 Ga0501042_0204796 3300049578 Bacteria 1423
515 Ga0501043_0000206 3300049579 Bacteria 54177
516 Ga0501043_0195403 3300049579 Bacteria 1572
517 Ga0501047_0011184 3300049581 Bacteria 8493
518 Ga0501047_0158714 3300049581 Bacteria 2134
519 Ga0501047_0240530 3300049581 Bacteria 1661
520 Ga0501047_0380762 3300049581 Bacteria 1245
521 Ga0501069_0000043 3300049585 Bacteria 77795
522 Ga0501069_0000044 3300049585 Bacteria 75705
523 Ga0501070_0000001 3300049586 Bacteria 519187
524 Ga0501070_0000298 3300049586 Bacteria 46144
525 Ga0501070_0001435 3300049586 Bacteria 21323
526 Ga0501070_0002796 3300049586 Bacteria 15235
527 Ga0501070_0009605 3300049586 Bacteria 8172
528 Ga0501070_0078901 3300049586 Bacteria 2724
529 Ga0501071_0003348 3300049587 Bacteria 10017
530 Ga0501071_0146945 3300049587 Bacteria 1757
531 Ga0501071_0211869 3300049587 Bacteria 1457
532 Ga0501072_0005902 3300049588 Bacteria 9327
533 Ga0501072_0083300 3300049588 Bacteria 2535
534 Ga0501073_0039350 3300049589 Bacteria 3350
535 Ga0501079_0021620 3300049741 Bacteria 4922
536 Ga0501080_0011102 3300049742 Bacteria 8243
537 Ga0501044_0346623 3300049823 Bacteria 1406
538 Ga0501045_0065014 3300049824 Bacteria 2678
539 nmdc:mga03683_17709_c1 3300050489 Bacteria 2700
540 nmdc:mga03683_76803_c1 3300050489 Bacteria 1436
541 nmdc:mga03n38_11449_c1 3300050490 Bacteria 3306
542 nmdc:mga03n38_5437_c1 3300050490 Bacteria 4339
543 nmdc:mga03n38_57587_c1 3300050490 Bacteria 1758
544 nmdc:mga00v17_11206_c1 3300050491 Bacteria 4923
545 nmdc:mga00v17_11847_c1 3300050491 Bacteria 4798
546 nmdc:mga00v17_128306_c1 3300050491 Bacteria 1619
547 nmdc:mga00v17_41204_c1 3300050491 Bacteria 2773
548 nmdc:mga00v17_41320_c1 3300050491 Bacteria 2769
549 nmdc:mga00v17_47242_c1 3300050491 Bacteria 2607
550 nmdc:mga0yw44_238_c1 3300050492 Bacteria 18843
551 nmdc:mga0yw44_30480_c1 3300050492 Bacteria 3126
552 nmdc:mga0yw44_370_c1 3300050492 Bacteria 15687
553 nmdc:mga06z11_145863_c1 3300050494 Bacteria 1341
554 nmdc:mga06z11_25007_c1 3300050494 Bacteria 2824
555 nmdc:mga07m45_31165_c1 3300050496 Bacteria 2954
556 nmdc:mga07m45_31448_c1 3300050496 Bacteria 2942
557 nmdc:mga05p37_103632_c1 3300050507 Bacteria 3501
558 nmdc:mga05p37_3605_c1 3300050507 Bacteria 18090
559 nmdc:mga05p37_564334_c1 3300050507 Bacteria 1293
560 nmdc:mga05p37_77935_c1 3300050507 Bacteria 4080
561 nmdc:mga09592_1137_c1 3300050508 Bacteria 21197
562 nmdc:mga09592_197491_c1 3300050508 Bacteria 1742
563 nmdc:mga09592_47719_c1 3300050508 Bacteria 3610
564 nmdc:mga0qj67_118037_c1 3300050509 Bacteria 2144
565 nmdc:mga0qj67_121160_c1 3300050509 Bacteria 2116
566 nmdc:mga0qj67_126563_c1 3300050509 Bacteria 2067
567 nmdc:mga0qj67_18056_c1 3300050509 Bacteria 5374
568 nmdc:mga0qj67_1880_c1 3300050509 Bacteria 14892
569 nmdc:mga0qj67_55546_c1 3300050509 Bacteria 3137
570 nmdc:mga0qj67_61153_c1 3300050509 Bacteria 2990
571 nmdc:mga0qj67_62405_c1 3300050509 Bacteria 2961
572 nmdc:mga0qj67_73897_c1 3300050509 Bacteria 2724
573 nmdc:mga06r32_152896_c1 3300050510 Bacteria 2287
574 nmdc:mga06r32_58210_c1 3300050510 Bacteria 3714
575 nmdc:mga06r32_6827_c1 3300050510 Bacteria 10259
576 nmdc:mga08y16_29479_c1 3300050511 Bacteria 5782
577 nmdc:mga08y16_5749_c1 3300050511 Bacteria 12990
578 nmdc:mga0rr50_155626_c1 3300050513 Bacteria 1851
579 nmdc:mga0sz30_30212_c1 3300050516 Bacteria 2238
580 nmdc:mga0sz30_492_c1 3300050516 Bacteria 14711
581 nmdc:mga0sz30_7637_c1 3300050516 Bacteria 4060
582 Ga0495601_0021250 3300053077 Bacteria 3973
583 Ga0495601_0126306 3300053077 Bacteria 1664
584 Ga0500610_0125985 3300053079 Bacteria 1306
585 Ga0495619_0029814 3300053085 Bacteria 3528
586 Ga0500643_001012 3300053087 Bacteria 17174
587 Ga0500652_000173 3300053131 Bacteria 24995
588 Ga0500652_000994 3300053131 Bacteria 9288
589 Ga0500616_0013120 3300053153 Bacteria 4823
590 Ga0500616_0036367 3300053153 Bacteria 2672
591 Ga0500645_000123 3300053730 Bacteria 61404
592 Ga0501084_0000304 3300054114 Bacteria 37258
593 Ga0501084_0219473 3300054114 Bacteria 1604
594 Ga0466962_0004573 3300061719 Bacteria 6642
595 Ga0530510_0007512 3300061734 Bacteria 7593
596 Ga0530510_0013123 3300061734 Bacteria 5828
597 Ga0530510_0176328 3300061734 Bacteria 1584
598 2508673188 2508501039 Bacteria 9978592
599 2523382885 2523231044 Bacteria 6434991
600 2644636025 2643221715 Bacteria 6671032
601 2671833209 2671180195 Bacteria 9757215
602 2671838352 2671180195 Bacteria 9757215
603 2689963092 2687453737 Bacteria 11203906
604 2738666999 2738541264 Bacteria 5935393
605 2739145843 2738541356 Bacteria 5935017
606 2744955868 2744054611 Bacteria 5611514
607 2774845144 2773857921 Bacteria 9435764
608 2774851365 2773857922 Bacteria 9757215
609 2774856508 2773857922 Bacteria 9757215
610 2809193512 2808606439 Bacteria 5952208
611 2842138671 2842134933 Bacteria 5847019
612 2902815539 2902810491 Bacteria 6794147
613 2929214598 2929212328 Bacteria 7708288
614 2939586472 2939582691 Bacteria 7088898
615 8055161831 8055157932 Bacteria 6429399
616 Ga0373934_0079102
617 JGI24744J21845_10001450
618 JGI24742J22300_10004787
619 Ga0070676_10008986
620 Ga0070690_100104259
621 Ga0068869_100103160
622 Ga0070666_10020468
623 Ga0070666_10025542
624 Ga0070666_10188765
625 Ga0070680_100035113
626 Ga0068868_100025344
627 Ga0068868_100078358
628 Ga0070660_100038056
629 Ga0070661_100023576
630 Ga0070668_100012178
631 Ga0070668_100058745
632 Ga0070668_100139831
633 Ga0070669_100002044
634 Ga0070669_100025984
635 Ga0070671_100153890
636 Ga0070674_100067527
637 Ga0070673_100219729
638 Ga0070659_100006032
639 Ga0070659_100013788
640 Ga0070667_100000087
641 Ga0070667_100009215
642 Ga0070709_10002093
643 Ga0070710_10028003
644 Ga0070701_10010636
645 Ga0070711_100001182
646 Ga0070711_100135516
647 Ga0070705_100075588
648 Ga0070700_100005234
649 Ga0070708_100064898
650 Ga0070678_100000500
651 Ga0070678_100006205
652 Ga0070662_100106134
653 Ga0070681_10002125
654 Ga0068867_100002343
655 Ga0068867_100169717
656 Ga0070706_100004945
657 Ga0070706_100053435
658 Ga0070706_100127806
659 Ga0070707_100096907
660 Ga0070698_100126626
661 Ga0070679_100013562
662 Ga0070697_100015065
663 Ga0068853_100004321
664 Ga0068853_100019629
665 Ga0068853_100594600
666 Ga0070686_100055246
667 Ga0070686_100120598
668 Ga0070695_100039160
669 Ga0070696_100005683
670 Ga0070696_100086311
671 Ga0070665_100004632
672 Ga0070665_100008710
673 Ga0070665_100036330
674 Ga0070704_100022332
675 Ga0068855_100013728
676 Ga0068857_100000182
677 Ga0068854_100005400
678 Ga0068852_100130720
679 Ga0068859_100001028
680 Ga0068859_100008906
681 Ga0068859_100128881
682 Ga0068859_100301423
683 Ga0068864_100050625
684 Ga0068866_10007334
685 Ga0068866_10087964
686 Ga0068861_100000802
687 Ga0068863_100000179
688 Ga0068863_100061251
689 Ga0068863_100104365
690 Ga0068858_100000362
691 Ga0068858_100002057
692 Ga0068858_100021520
693 Ga0068858_100050448
694 Ga0068860_100000020
695 Ga0068860_100001507
696 Ga0068860_100015476
697 Ga0068860_100022194
698 Ga0068860_100154165
699 Ga0068862_100000013
700 Ga0068862_100001972
701 Ga0068862_100025118
702 Ga0068862_100044923
703 Ga0081455_10062381
704 Ga0081455_10101635
705 Ga0081538_10006021
706 Ga0081539_10062663
707 Ga0075365_10002572
708 Ga0075365_10005505
709 Ga0075365_10016651
710 Ga0075365_10064448
711 Ga0075365_10136279
712 Ga0075363_100000251
713 Ga0075363_100003925
714 Ga0075363_100007956
715 Ga0075363_100061778
716 Ga0075364_10000251
717 Ga0075364_10013826
718 Ga0075364_10097537
719 Ga0075364_10103518
720 Ga0070716_100005152
721 Ga0070716_100005522
722 Ga0070712_100002123
723 Ga0070712_100096059
724 Ga0075367_10060547
725 Ga0075369_10000014
726 Ga0075369_10015154
727 Ga0075369_10020642
728 Ga0075369_10098748
729 Ga0075370_10008121
730 Ga0075370_10025088
731 Ga0068871_100045682
732 Ga0075428_100000955
733 Ga0075428_100017380
734 Ga0075428_100179690
735 Ga0075428_100267455
736 Ga0075428_100365868
737 Ga0075430_100002600
738 Ga0075430_100006032
739 Ga0075430_100043956
740 Ga0075430_100058794
741 Ga0075430_100120304
742 Ga0075430_100147915
743 Ga0075431_100000463
744 Ga0075431_100052419
745 Ga0075431_100081748
746 Ga0075429_100000747
747 Ga0068865_100014751
748 Ga0068865_100016525
749 Ga0068865_100098077
750 Ga0097620_100001028
751 Ga0097620_100008906
752 Ga0097620_100128886
753 Ga0097620_100301452
754 Ga0111539_10015515
755 Ga0105245_10025795
756 Ga0105245_10119320
757 Ga0105245_10198990
758 Ga0105247_10000009
759 Ga0105247_10000567
760 Ga0105247_10002169
761 Ga0105247_10006631
762 Ga0105247_10079562
763 Ga0105247_10125252
764 Ga0114129_10000160
765 Ga0114129_10043001
766 Ga0114129_10254176
767 Ga0105242_10005246
768 Ga0105248_10000149
769 Ga0105248_10000207
770 Ga0105248_10011233
771 Ga0105248_10031749
772 Ga0105248_10250612
773 Ga0105248_10299155
774 Ga0105248_10422200
775 Ga0105237_10009576
776 Ga0105237_10035151
777 Ga0105237_10076897
778 Ga0105249_10000057
779 Ga0105249_10039234
780 Ga0105249_10072957
781 Ga0105249_10316739
782 Ga0099796_10053710
783 Ga0105239_10016100
784 Ga0105239_10618639
785 Ga0157378_10007174
786 Ga0157378_10034495
787 Ga0163162_10020009
788 Ga0163162_10023109
789 Ga0163162_10090573
790 Ga0163162_10200567
791 Ga0157372_10069368
792 Ga0157375_10002051
793 Ga0157375_10033752
794 Ga0157375_10244117
795 Ga0157375_10419938
796 Ga0163163_10078857
797 Ga0163163_10080741
798 Ga0163163_10190891
799 Ga0157380_10000197
800 Ga0182008_10099420
801 Ga0157377_10008025
802 Ga0157379_10012717
803 Ga0157379_10014574
804 Ga0157379_10041898
805 Ga0163161_10002525
806 Ga0163161_10166811
807 Ga0213876_10008455
808 Ga0209051_1000011
809 Ga0207692_10019358
810 Ga0207642_10004258
811 Ga0207710_10000014
812 Ga0207710_10000385
813 Ga0207710_10010683
814 Ga0207688_10004049
815 Ga0207680_10004292
816 Ga0207680_10096491
817 Ga0207699_10098385
818 Ga0207684_10028404
819 Ga0207684_10203829
820 Ga0207654_10072301
821 Ga0207707_10002131
822 Ga0207671_10165783
823 Ga0207671_10203168
824 Ga0207693_10022276
825 Ga0207693_10086636
826 Ga0207693_10160620
827 Ga0207663_10251430
828 Ga0207660_10024879
829 Ga0207660_10145750
830 Ga0207657_10048079
831 Ga0207652_10015162
832 Ga0207681_10003465
833 Ga0207681_10006423
834 Ga0207687_10118206
835 Ga0207644_10199936
836 Ga0207690_10006389
837 Ga0207706_10040456
838 Ga0207706_10148167
839 Ga0207686_10011997
840 Ga0207709_10056934
841 Ga0207670_10095827
842 Ga0207669_10006072
843 Ga0207669_10017724
844 Ga0207704_10010332
845 Ga0207704_10025135
846 Ga0207665_10001010
847 Ga0207665_10008406
848 Ga0207711_10000186
849 Ga0207711_10000242
850 Ga0207711_10013914
851 Ga0207711_10017815
852 Ga0207711_10171014
853 Ga0207711_10290246
854 Ga0207711_10296127
855 Ga0207689_10097579
856 Ga0207679_10002442
857 Ga0207667_10003569
858 Ga0207712_10000050
859 Ga0207712_10000125
860 Ga0207712_10022484
861 Ga0207712_10340107
862 Ga0207668_10020454
863 Ga0207668_10038795
864 Ga0207668_10106383
865 Ga0207640_10216421
866 Ga0207658_10000065
867 Ga0207658_10063304
868 Ga0207658_10090262
869 Ga0207677_10091360
870 Ga0207677_10244264
871 Ga0207703_10023779
872 Ga0207703_10058340
873 Ga0207703_10058981
874 Ga0207703_10108631
875 Ga0207639_10006398
876 Ga0207639_10045750
877 Ga0207708_10010564
878 Ga0207641_10000682
879 Ga0207641_10001037
880 Ga0207648_10004710
881 Ga0207648_10167979
882 Ga0207648_10379508
883 Ga0207676_10008397
884 Ga0207674_10000124
885 Ga0207675_100002573
886 Ga0207683_10001516
887 Ga0207683_10042518
888 Ga0207698_10064722
889 Ga0207698_10415024
890 Ga0207428_10005918
891 Ga0268266_10002104
892 Ga0268266_10017884
893 Ga0268266_10031723
894 Ga0268266_10111071
895 Ga0268266_10228455
896 Ga0268265_10000004
897 Ga0268265_10000274
898 Ga0268265_10024437
899 Ga0268265_10056615
900 Ga0268264_10000024
901 Ga0268264_10000216
902 Ga0268264_10036050
903 Ga0268264_10298690
904 Ga0265338_10000221
905 Ga0265325_10001081
906 Ga0265339_10001830
907 Ga0265327_10001233
908 Ga0265327_10002298
909 Ga0265327_10002710
910 Ga0265327_10012720
911 Ga0265327_10043456
912 Ga0265316_10046648
913 Ga0316575_10054581
914 Ga0265314_10052246
915 Ga0316576_10014696
916 Ga0307516_10000380
917 Ga0316577_10020380
918 Ga0307413_10027857
919 Ga0307410_10002012
920 Ga0307410_10013018
921 Ga0307407_10028431
922 Ga0307409_100019528
923 Ga0307409_100057237
924 Ga0307416_100226064
925 Ga0373928_0000694
926 Ga0373929_0000577
927 Ga0373929_0001206
928 Ga0373929_0001419
929 Ga0373932_0000065
930 Ga0373932_0000834
931 Ga0373932_0001362
932 Ga0373954_0042578
933 Ga0373956_0019704
934 Ga0373955_0026848
935 Ga0316574_0010153
936 Ga0316574_0030538
937 Ga0316574_0058732
938 Ga0373924_0013307
939 Ga0373931_0000010
940 Ga0373931_0000021
941 Ga0373931_0000032
942 Ga0373931_0000099
943 Ga0373931_0020193
944 Ga0373931_0103059
945 Ga0373935_0132374
946 Ga0373947_0114632
947 Ga0373937_0026182
948 Ga0373937_0135830
949 Ga0316584_0025851
950 Ga0316584_0045072
951 Ga0316584_0153236
952 Ga0373925_0138305
953 Ga0373925_0366626
954 Ga0395898_0034832
955 Ga0395901_0020120
956 Ga0436365_0263873
957 Ga0436365_0772403
958 Ga0436365_1680197
959 Ga0436362_0314905
960 Ga0439461_0003325
961 Ga0439466_0010614
962 Ga0439466_0035619
963 Ga0439465_0010588
964 Ga0451843_1685753
965 Ga0439445_0019890
966 Ga0439448_0010136
967 Ga0439450_003248
968 Ga0439446_0053664
969 Ga0439434_0010677
970 Ga0439435_0012355
971 Ga0439464_0004187
972 Ga0466972_0053197
973 Ga0466972_0072740
974 Ga0466972_0108642
975 Ga0466965_0013555
976 Ga0466966_0010550
977 Ga0466963_0040154
978 Ga0466957_0087700
979 Ga0466960_0000275
980 Ga0466967_0031796
981 Ga0466967_0088962
982 Ga0495603_0024387
983 Ga0495629_0046465
984 Ga0495638_0000482
985 Ga0495638_0036177
986 Ga0495641_0024306
987 Ga0495653_0106604
988 Ga0495618_0014172
989 Ga0495618_0045768
990 Ga0495628_0001164
991 Ga0495630_0008045
992 Ga0495630_0010386
993 Ga0495630_0182710
994 Ga0495630_0184975
995 Ga0495666_0056421
996 Ga0495665_0014826
997 Ga0495640_0023851
998 Ga0495640_0027387
999 Ga0495586_0023419
1000 Ga0495586_0063109
1001 Ga0495622_0054933
1002 Ga0495668_0114843
1003 Ga0495634_0004081
1004 Ga0495625_0026047
1005 Ga0495657_0079855
1006 Ga0495658_0011420
1007 Ga0495658_0041078
1008 Ga0495658_0087000
1009 Ga0495658_0147453
1010 Ga0495613_0000311
1011 Ga0495613_0006477
1012 Ga0495674_0005723
1013 Ga0495672_0003401
1014 Ga0495672_0015063
1015 Ga0495680_0103766
1016 Ga0495680_0164324
1017 Ga0495680_0218412
1018 Ga0495684_0006064
1019 Ga0495593_0014031
1020 Ga0495602_0224174
1021 Ga0496100_0006932
1022 Ga0496100_0016625
1023 Ga0496100_0088972
1024 Ga0496101_0000340
1025 Ga0496101_0004400
1026 Ga0496101_0010120
1027 Ga0496101_0025060
1028 Ga0496101_0150165
1029 Ga0496101_0168648
1030 Ga0496102_0000388
1031 Ga0496102_0000845
1032 Ga0496102_0023926
1033 Ga0496102_0040648
1034 Ga0496102_0043566
1035 Ga0496102_0099009
1036 Ga0496102_0277210
1037 Ga0496102_0287019
1038 Ga0496103_0000818
1039 Ga0496103_0003914
1040 Ga0496103_0011471
1041 Ga0496103_0012445
1042 Ga0496104_0000946
1043 Ga0496104_0016843
1044 Ga0496104_0076378
1045 Ga0496105_0024106
1046 Ga0496105_0089072
1047 Ga0496106_0000748
1048 Ga0496106_0001694
1049 Ga0496106_0008941
1050 Ga0496106_0060311
1051 Ga0496107_0003264
1052 Ga0496107_0005846
1053 Ga0496107_0011797
1054 Ga0496107_0020721
1055 Ga0496107_0150805
1056 Ga0496108_0014457
1057 Ga0496108_0023250
1058 Ga0496108_0025201
1059 Ga0496109_0002296
1060 Ga0496109_0008781
1061 Ga0496109_0029667
1062 Ga0496109_0046408
1063 Ga0496109_0239200
1064 Ga0496109_0243202
1065 Ga0496110_0031941
1066 Ga0496111_0041310
1067 Ga0496111_0105497
1068 Ga0496111_0187256
1069 Ga0496112_0000758
1070 Ga0496112_0031876
1071 Ga0496112_0065106
1072 Ga0496112_0073884
1073 Ga0496113_0011350
1074 Ga0496113_0025081
1075 Ga0496114_0000231
1076 Ga0496114_0007956
1077 Ga0496114_0017850
1078 Ga0496114_0060137
1079 Ga0496114_0091488
1080 Ga0496114_0137669
1081 Ga0496114_0196227
1082 Ga0496114_0237097
1083 Ga0496115_0000317
1084 Ga0496115_0002011
1085 Ga0496115_0015425
1086 Ga0496115_0036793
1087 Ga0496115_0077318
1088 Ga0496115_0187333
1089 Ga0496116_0020421
1090 Ga0496117_0001931
1091 Ga0496117_0003589
1092 Ga0496117_0012203
1093 Ga0496118_0000514
1094 Ga0496118_0000849
1095 Ga0496118_0011323
1096 Ga0496118_0011623
1097 Ga0496118_0040269
1098 Ga0496119_0001677
1099 Ga0496119_0034366
1100 Ga0496120_0027335
1101 Ga0496120_0028931
1102 Ga0496121_0000499
1103 Ga0496121_0000969
1104 Ga0496121_0063949
1105 Ga0496122_0001146
1106 Ga0496123_0006691
1107 Ga0496124_0000429
1108 Ga0496124_0014655
1109 Ga0496125_0000448
1110 Ga0496125_0009543
1111 Ga0496125_0134505
1112 Ga0496126_0000037
1113 Ga0496126_0000520
1114 Ga0496126_0001363
1115 Ga0496126_0006601
1116 Ga0496126_0013632
1117 Ga0496126_0024847
1118 Ga0501033_0122895
1119 Ga0501034_0002643
1120 Ga0501034_0019515
1121 Ga0501034_0096637
1122 Ga0501034_0219132
1123 Ga0501036_0138387
1124 Ga0501036_0256690
1125 Ga0501037_0001055
1126 Ga0501039_0000342
1127 Ga0501039_0117167
1128 Ga0501040_0072848
1129 Ga0501042_0204796
1130 Ga0501043_0000206
1131 Ga0501043_0195403
1132 Ga0501047_0011184
1133 Ga0501047_0158714
1134 Ga0501047_0240530
1135 Ga0501047_0380762
1136 Ga0501069_0000043
1137 Ga0501069_0000044
1138 Ga0501070_0000001
1139 Ga0501070_0000298
1140 Ga0501070_0001435
1141 Ga0501070_0002796
1142 Ga0501070_0009605
1143 Ga0501070_0078901
1144 Ga0501071_0003348
1145 Ga0501071_0146945
1146 Ga0501071_0211869
1147 Ga0501072_0005902
1148 Ga0501072_0083300
1149 Ga0501073_0039350
1150 Ga0501079_0021620
1151 Ga0501080_0011102
1152 Ga0501044_0346623
1153 Ga0501045_0065014
1154 nmdc:mga03683_17709_c1
1155 nmdc:mga03683_76803_c1
1156 nmdc:mga03n38_11449_c1
1157 nmdc:mga03n38_5437_c1
1158 nmdc:mga03n38_57587_c1
1159 nmdc:mga00v17_11206_c1
1160 nmdc:mga00v17_11847_c1
1161 nmdc:mga00v17_128306_c1
1162 nmdc:mga00v17_41204_c1
1163 nmdc:mga00v17_41320_c1
1164 nmdc:mga00v17_47242_c1
1165 nmdc:mga0yw44_238_c1
1166 nmdc:mga0yw44_30480_c1
1167 nmdc:mga0yw44_370_c1
1168 nmdc:mga06z11_145863_c1
1169 nmdc:mga06z11_25007_c1
1170 nmdc:mga07m45_31165_c1
1171 nmdc:mga07m45_31448_c1
1172 nmdc:mga05p37_103632_c1
1173 nmdc:mga05p37_3605_c1
1174 nmdc:mga05p37_564334_c1
1175 nmdc:mga05p37_77935_c1
1176 nmdc:mga09592_1137_c1
1177 nmdc:mga09592_197491_c1
1178 nmdc:mga09592_47719_c1
1179 nmdc:mga0qj67_118037_c1
1180 nmdc:mga0qj67_121160_c1
1181 nmdc:mga0qj67_126563_c1
1182 nmdc:mga0qj67_18056_c1
1183 nmdc:mga0qj67_1880_c1
1184 nmdc:mga0qj67_55546_c1
1185 nmdc:mga0qj67_61153_c1
1186 nmdc:mga0qj67_62405_c1
1187 nmdc:mga0qj67_73897_c1
1188 nmdc:mga06r32_152896_c1
1189 nmdc:mga06r32_58210_c1
1190 nmdc:mga06r32_6827_c1
1191 nmdc:mga08y16_29479_c1
1192 nmdc:mga08y16_5749_c1
1193 nmdc:mga0rr50_155626_c1
1194 nmdc:mga0sz30_30212_c1
1195 nmdc:mga0sz30_492_c1
1196 nmdc:mga0sz30_7637_c1
1197 Ga0495601_0021250
1198 Ga0495601_0126306
1199 Ga0500610_0125985
1200 Ga0495619_0029814
1201 Ga0500643_001012
1202 Ga0500652_000173
1203 Ga0500652_000994
1204 Ga0500616_0013120
1205 Ga0500616_0036367
1206 Ga0500645_000123
1207 Ga0501084_0000304
1208 Ga0501084_0219473
1209 Ga0466962_0004573
1210 Ga0530510_0007512
1211 Ga0530510_0013123
1212 Ga0530510_0176328
1213 2508673188
1214 2523382885
1215 2644636025
1216 2671833209
1217 2671838352
1218 2689963092
1219 2738666999
1220 2739145843
1221 2744955868
1222 2774845144
1223 2774851365
1224 2774856508
1225 2809193512
1226 2842138671
1227 2902815539
1228 2929214598
1229 2939586472
1230 8055161831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22691

Thiolase_C_1

Thiolase C-terminal domain-like

264

395

0.91

PF02803

Thiolase_C

Thiolase, C-terminal domain

258

373

0.87

PF00108

Thiolase_N

Thiolase, N-terminal domain

19

193

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.8815 1 357
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.8768 1 357
6ok1-assembly1.cif.gz_C ltp2-chsh2(duf35) aldolase 0.876 2 358
6ok1-assembly1.cif.gz_C ltp2-chsh2(duf35) aldolase 0.8713 2 358
6ok1-assembly1.cif.gz_A ltp2-chsh2(duf35) aldolase 0.8706 3 358
ID Description Score Start End Superfamily
af_O06144_7_401_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8882 3 357 3.40.47.10
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8811 3 357 3.40.47.10
af_O06144_7_401_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8787 3 357 3.40.47.10
af_I6Y3T7_1_386_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8724 2 355 3.40.47.10
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8716 3 357 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A259C826-F1-model_v4 Acetyl-CoA acetyltransferase 0.9981 241 358 GO:0016746
AF-A0A259C826-F1-model_v4 Acetyl-CoA acetyltransferase 0.9897 241 358 GO:0016746
AF-A0A1T3VU86-F1-model_v4 Lipid-transfer protein 0.9817 233 358 GO:0016746
AF-A0A1V3WT70-F1-model_v4 Thiolase, C-terminal domain protein 0.9749 118 348 GO:0016746
AF-A0A7Y1ZLB4-F1-model_v4 Thiolase family protein 0.9728 129 358 GO:0016746

Map