F469442

General Info

Members Datasets Scaffolds Average Seq Length
615 435 444 161

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_11634767|Ga0157369_116347671
Length 179
Sequence MGRKSMITLNVNGQSHEVDADPATPLLYVLRDHLALNGAKFGCGLGQCGACTVMIDADAVFSCVTPIAGLAGRRIRTIEGLGTLDQPGPMQRAFIEEQAAQCGYCIPGMMMRAQALLERTSAPTRADIRRHMSPNLCRCGTHMRILRAVERASRLMQAEGGVGVNRGAITPTSSEPSTT

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
3 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
4 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
5 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
6 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
7 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
8 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
9 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
10 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
11 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
12 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
13 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
14 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
15 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
16 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
17 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
18 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
19 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
20 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
21 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
22 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
23 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
24 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
25 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
26 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
27 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
28 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
29 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
30 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
31 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
32 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
33 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
34 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
35 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
36 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
37 2919404418 Luteibacter sp. 3190 Isolate Unclassified
38 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
39 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
40 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
41 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
42 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
43 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
44 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
45 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
46 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
47 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
48 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
49 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
50 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
51 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
52 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
53 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
54 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
55 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
56 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
57 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
58 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
59 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
60 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
61 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
62 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
63 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
64 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
65 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
66 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
67 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
68 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
69 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
70 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
71 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
72 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
73 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
74 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
75 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
76 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
77 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
78 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
79 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
80 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
81 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
82 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
83 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
84 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
85 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
86 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
87 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
88 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
89 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
90 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
91 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
92 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
93 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
94 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
95 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
96 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
97 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
98 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
99 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
100 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
101 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
102 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
103 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
104 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
105 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
106 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
107 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
108 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
109 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
110 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
111 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
112 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
113 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
114 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
115 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
116 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
117 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
118 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
119 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
120 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
121 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
122 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
123 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
124 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
125 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
126 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
127 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
128 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
129 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
130 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
131 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
132 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
133 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
134 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
135 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
136 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
137 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
138 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
139 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
140 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
141 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
142 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
143 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
144 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
145 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
146 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
147 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
148 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
149 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
150 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
151 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
152 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
153 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
154 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
155 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
156 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
157 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
158 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
159 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
160 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
161 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
162 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
163 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
164 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
165 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
166 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
167 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
168 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
169 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
170 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
171 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
172 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
173 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
174 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
175 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
176 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
177 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
178 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
179 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
180 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
181 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
182 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
183 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
184 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
185 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
186 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
187 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
188 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
189 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
190 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
191 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
192 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
193 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
194 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
195 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
196 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
197 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
198 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
199 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
200 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
201 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
202 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
203 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
204 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
205 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
206 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
207 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
208 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
209 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
210 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
211 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
212 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
213 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
214 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
215 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
216 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
217 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
218 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
219 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
220 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
221 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
222 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
223 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
224 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
225 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
226 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
227 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
228 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
229 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
230 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
231 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
232 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
233 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
234 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
235 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
236 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
237 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
238 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
239 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
240 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
241 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
242 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
243 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
244 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
245 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
246 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
247 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
248 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
249 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
250 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
251 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
252 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
253 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
254 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
255 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
256 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
257 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
258 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
259 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
260 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
261 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
262 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
263 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
264 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
265 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
266 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
267 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
269 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
271 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
272 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
273 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
275 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
312 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
316 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
317 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
318 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
319 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
320 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
321 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
322 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
323 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
324 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
325 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
326 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
327 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
328 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
329 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
330 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
332 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
333 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
334 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
335 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
336 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
337 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
338 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
339 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
340 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
341 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
342 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
343 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
344 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
345 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
346 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
347 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
348 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
349 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
350 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
351 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
352 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
353 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
354 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
355 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
356 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
357 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
358 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
359 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
360 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
361 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
362 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
363 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
364 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
365 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
371 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
372 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
373 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
374 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
375 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
376 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
377 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
378 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
379 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
380 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
381 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
382 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
383 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
396 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
397 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
398 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
411 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
412 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
413 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
414 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
415 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
416 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
417 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
418 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
419 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
423 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
424 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
425 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
426 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
427 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
428 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
429 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
430 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
431 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
434 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
435 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.22
Metatranscriptomes 0.98
Isolates 27.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 26.99
Rhizoplane 4.55
Rhizosphere 58.86
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000306 3300002705 Bacteria 32521
2 JGI25153J46596_10085527 3300003215 Bacteria 775
3 rootL2_10195908 3300003322 Bacteria 1809
4 rootH1_10162803 3300003323 Bacteria 2093
5 Ga0006562J51391_1078777 3300003578 Bacteria 4210
6 Ga0006562J51391_1078780 3300003578 Bacteria 4120
7 Ga0055533_1000441 3300003756 Bacteria 15794
8 Ga0055524_1007446 3300003775 Bacteria 4644
9 Ga0055528_1000299 3300003790 Bacteria 42145
10 Ga0055543_1051346 3300004625 Bacteria 675
11 Ga0065165_1000001 3300005262 Bacteria 494087
12 Ga0070658_10756659 3300005327 Bacteria 844
13 Ga0070683_100214824 3300005329 Bacteria 1827
14 Ga0068869_100608456 3300005334 Bacteria 924
15 Ga0068869_101797565 3300005334 Bacteria 548
16 Ga0070666_10171731 3300005335 Bacteria 1518
17 Ga0070680_100011053 3300005336 Bacteria 6976
18 Ga0070680_100066209 3300005336 Bacteria 2962
19 Ga0070680_100210550 3300005336 Bacteria 1640
20 Ga0070680_100742736 3300005336 Bacteria 845
21 Ga0068868_100338271 3300005338 Bacteria 1286
22 Ga0070660_100104673 3300005339 Bacteria 2245
23 Ga0070660_100204537 3300005339 Bacteria 1602
24 Ga0070689_100016680 3300005340 Bacteria 5377
25 Ga0070689_100089609 3300005340 Bacteria 2423
26 Ga0070687_100485358 3300005343 Bacteria 829
27 Ga0070669_100057169 3300005353 Bacteria 2862
28 Ga0070669_100473671 3300005353 Bacteria 1035
29 Ga0070675_100042262 3300005354 Bacteria 3724
30 Ga0070671_100319022 3300005355 Bacteria 1324
31 Ga0070671_100609111 3300005355 Bacteria 944
32 Ga0070688_100105745 3300005365 Bacteria 1863
33 Ga0070688_100376693 3300005365 Bacteria 1045
34 Ga0070659_100031669 3300005366 Bacteria 4097
35 Ga0070659_100213967 3300005366 Bacteria 1589
36 Ga0070709_10069621 3300005434 Bacteria 2267
37 Ga0070714_100006501 3300005435 Bacteria 9036
38 Ga0070714_100026513 3300005435 Bacteria 4790
39 Ga0070714_100293988 3300005435 Bacteria 1512
40 Ga0070714_100962421 3300005435 Bacteria 830
41 Ga0070713_100147655 3300005436 Bacteria 2089
42 Ga0070713_100820886 3300005436 Bacteria 892
43 Ga0070710_10723886 3300005437 Bacteria 704
44 Ga0070701_10387415 3300005438 Bacteria 882
45 Ga0070701_10824116 3300005438 Bacteria 635
46 Ga0070711_100071738 3300005439 Bacteria 2442
47 Ga0070711_100167609 3300005439 Bacteria 1671
48 Ga0070711_100176063 3300005439 Bacteria 1634
49 Ga0070711_100630665 3300005439 Bacteria 897
50 Ga0070663_100008193 3300005455 Bacteria 6414
51 Ga0070681_10002425 3300005458 Bacteria 17057
52 Ga0068867_100931204 3300005459 Bacteria 784
53 Ga0070685_10242404 3300005466 Bacteria 1190
54 Ga0070707_100443077 3300005468 Bacteria 1259
55 Ga0070698_100304719 3300005471 Bacteria 1524
56 Ga0070699_100610496 3300005518 Bacteria 995
57 Ga0070679_100064459 3300005530 Bacteria 3652
58 Ga0070679_100189164 3300005530 Bacteria 2028
59 Ga0070679_100207061 3300005530 Bacteria 1926
60 Ga0070679_100245086 3300005530 Bacteria 1749
61 Ga0070679_100333276 3300005530 Bacteria 1466
62 Ga0070684_100329484 3300005535 Bacteria 1403
63 Ga0070684_100448408 3300005535 Bacteria 1192
64 Ga0070697_100016999 3300005536 Bacteria 5720
65 Ga0070686_100358203 3300005544 Bacteria 1098
66 Ga0070693_100186730 3300005547 Bacteria 1338
67 Ga0070665_100839504 3300005548 Bacteria 932
68 Ga0070704_100475668 3300005549 Bacteria 1080
69 Ga0068855_100097727 3300005563 Bacteria 3382
70 Ga0068855_100239902 3300005563 Bacteria 2026
71 Ga0070664_100024833 3300005564 Bacteria 4963
72 Ga0070664_100047568 3300005564 Bacteria 3624
73 Ga0068857_100023431 3300005577 Bacteria 5435
74 Ga0068856_100005782 3300005614 Bacteria 12185
75 Ga0068856_100055682 3300005614 Bacteria 3903
76 Ga0068856_100134757 3300005614 Bacteria 2475
77 Ga0068856_100361678 3300005614 Bacteria 1470
78 Ga0068859_100202100 3300005617 Bacteria 2072
79 Ga0068859_100585172 3300005617 Bacteria 1210
80 Ga0068859_101554410 3300005617 Bacteria 730
81 Ga0068859_101875328 3300005617 Bacteria 662
82 Ga0068864_100567080 3300005618 Bacteria 1099
83 Ga0068864_101076306 3300005618 Bacteria 799
84 Ga0068861_100250364 3300005719 Bacteria 1511
85 Ga0068851_10025069 3300005834 Bacteria 2923
86 Ga0068863_101492165 3300005841 Bacteria 684
87 Ga0068858_100672663 3300005842 Bacteria 1006
88 Ga0081538_10170029 3300005981 Bacteria 952
89 Ga0070717_10301674 3300006028 Bacteria 1424
90 Ga0070715_10077982 3300006163 Bacteria 1497
91 Ga0070716_100147047 3300006173 Bacteria 1511
92 Ga0070716_100327928 3300006173 Bacteria 1075
93 Ga0070712_100001185 3300006175 Bacteria 15747
94 Ga0070712_100001285 3300006175 Bacteria 15162
95 Ga0070712_100030242 3300006175 Bacteria 3638
96 Ga0070712_100210339 3300006175 Bacteria 1533
97 Ga0075366_10083588 3300006195 Bacteria 1908
98 Ga0097621_100052569 3300006237 Bacteria 3319
99 Ga0075370_10262408 3300006353 Bacteria 1024
100 Ga0068871_101138566 3300006358 Bacteria 730
101 Ga0075431_100194564 3300006847 Bacteria 2076
102 Ga0075433_10145245 3300006852 Bacteria 2109
103 Ga0075433_10899895 3300006852 Bacteria 772
104 Ga0075434_100310470 3300006871 Bacteria 1597
105 Ga0075434_100579071 3300006871 Bacteria 1142
106 Ga0075434_101338916 3300006871 Bacteria 727
107 Ga0075434_102091910 3300006871 Bacteria 571
108 Ga0075436_100339645 3300006914 Bacteria 1081
109 Ga0097620_100202114 3300006931 Bacteria 2072
110 Ga0097620_100585171 3300006931 Bacteria 1210
111 Ga0097620_100734385 3300006931 Bacteria 1077
112 Ga0097620_101554399 3300006931 Bacteria 730
113 Ga0097620_101875604 3300006931 Bacteria 662
114 Ga0079104_1002704 3300006946 Bacteria 9115
115 Ga0075435_100028347 3300007076 Bacteria 4391
116 Ga0075435_100884046 3300007076 Bacteria 779
117 Ga0105240_10018795 3300009093 Bacteria 9259
118 Ga0105240_10070291 3300009093 Bacteria 4331
119 Ga0105240_10210815 3300009093 Bacteria 2270
120 Ga0105240_11720591 3300009093 Bacteria 654
121 Ga0105245_10037389 3300009098 Bacteria 4315
122 Ga0105245_11454436 3300009098 Bacteria 736
123 Ga0105243_11468975 3300009148 Bacteria 704
124 Ga0105241_10002057 3300009174 Bacteria 15193
125 Ga0105241_10251745 3300009174 Bacteria 1498
126 Ga0105248_11650776 3300009177 Bacteria 726
127 Ga0105237_10311621 3300009545 Bacteria 1577
128 Ga0105238_10049324 3300009551 Bacteria 4241
129 Ga0105238_10062335 3300009551 Bacteria 3729
130 Ga0105238_10084951 3300009551 Bacteria 3154
131 Ga0105238_10139797 3300009551 Bacteria 2398
132 Ga0105238_10315283 3300009551 Bacteria 1549
133 Ga0105238_10946838 3300009551 Bacteria 881
134 Ga0105239_10066613 3300010375 Bacteria 3956
135 Ga0157373_10061032 3300013100 Bacteria 2670
136 Ga0157371_10132606 3300013102 Bacteria 1773
137 Ga0157371_10163816 3300013102 Bacteria 1588
138 Ga0157370_10025918 3300013104 Bacteria 5796
139 Ga0157370_10169489 3300013104 Bacteria 2030
140 Ga0157369_10209933 3300013105 Bacteria 2041
141 Ga0157369_11634767 3300013105 Bacteria 655
142 Ga0157374_10003801 3300013296 Bacteria 12696
143 Ga0157378_11053173 3300013297 Bacteria 849
144 Ga0163162_10074776 3300013306 Bacteria 3447
145 Ga0157372_10010251 3300013307 Bacteria 9953
146 Ga0157372_10186375 3300013307 Bacteria 2403
147 Ga0157372_10187648 3300013307 Bacteria 2394
148 Ga0157372_10223509 3300013307 Bacteria 2183
149 Ga0157372_10467172 3300013307 Bacteria 1471
150 Ga0157372_11181364 3300013307 Bacteria 884
151 Ga0157375_10075704 3300013308 Bacteria 3391
152 Ga0157375_11292670 3300013308 Bacteria 857
153 Ga0163163_10002471 3300014325 Bacteria 15625
154 Ga0157380_10617676 3300014326 Bacteria 1075
155 Ga0182008_10116351 3300014497 Bacteria 1326
156 Ga0157376_11213390 3300014969 Bacteria 783
157 Ga0157376_11223845 3300014969 Bacteria 779
158 Ga0183361_10006 3300016635 Bacteria 368532
159 Ga0197907_10918686 3300020069 Bacteria 1069
160 Ga0206356_11861440 3300020070 Bacteria 1204
161 Ga0206353_11024365 3300020082 Bacteria 1896
162 Ga0213876_10023935 3300021384 Bacteria 3225
163 Ga0213876_10053857 3300021384 Bacteria 2125
164 Ga0213876_10248826 3300021384 Bacteria 945
165 Ga0213875_10000003 3300021388 Bacteria 719367
166 Ga0213875_10192760 3300021388 Bacteria 958
167 Ga0224712_10048163 3300022467 Bacteria 1644
168 Ga0209674_100137 3300025226 Bacteria 112326
169 Ga0209759_1000036 3300025256 Bacteria 261374
170 Ga0209673_1000054 3300025273 Bacteria 279116
171 Ga0209025_1004101 3300025294 Bacteria 12976
172 Ga0209025_1053080 3300025294 Bacteria 1594
173 Ga0209564_1014636 3300025295 Bacteria 3245
174 Ga0209564_1017714 3300025295 Bacteria 2758
175 Ga0209758_1000746 3300025297 Bacteria 47342
176 Ga0209256_1000605 3300025299 Bacteria 49814
177 Ga0207426_1009863 3300025302 Bacteria 3743
178 Ga0207685_10062506 3300025905 Bacteria 1480
179 Ga0207699_10085225 3300025906 Bacteria 1970
180 Ga0207643_10018312 3300025908 Bacteria 3836
181 Ga0207705_10153740 3300025909 Bacteria 1725
182 Ga0207654_10038263 3300025911 Bacteria 2691
183 Ga0207654_10101536 3300025911 Bacteria 1773
184 Ga0207707_10000845 3300025912 Bacteria 30005
185 Ga0207707_10007083 3300025912 Bacteria 9772
186 Ga0207707_10158476 3300025912 Bacteria 1979
187 Ga0207707_10338109 3300025912 Bacteria 1298
188 Ga0207695_10010468 3300025913 Bacteria 11343
189 Ga0207695_10078594 3300025913 Bacteria 3347
190 Ga0207695_10120056 3300025913 Bacteria 2598
191 Ga0207695_10844599 3300025913 Bacteria 796
192 Ga0207693_10003078 3300025915 Bacteria 14387
193 Ga0207693_10003954 3300025915 Bacteria 12595
194 Ga0207693_10044023 3300025915 Bacteria 3508
195 Ga0207663_10005258 3300025916 Bacteria 6518
196 Ga0207663_10095461 3300025916 Bacteria 1984
197 Ga0207663_10168394 3300025916 Bacteria 1554
198 Ga0207663_10257139 3300025916 Bacteria 1288
199 Ga0207660_10012172 3300025917 Bacteria 5622
200 Ga0207660_10239455 3300025917 Bacteria 1429
201 Ga0207660_11114452 3300025917 Bacteria 643
202 Ga0207657_10000412 3300025919 Bacteria 45322
203 Ga0207657_10309435 3300025919 Bacteria 1251
204 Ga0207652_10080436 3300025921 Bacteria 2849
205 Ga0207652_10273305 3300025921 Bacteria 1524
206 Ga0207652_10366681 3300025921 Bacteria 1300
207 Ga0207652_10840822 3300025921 Bacteria 813
208 Ga0207646_10534891 3300025922 Bacteria 1054
209 Ga0207681_10017808 3300025923 Bacteria 4467
210 Ga0207694_10011136 3300025924 Bacteria 6790
211 Ga0207694_10099057 3300025924 Bacteria 2308
212 Ga0207694_10521955 3300025924 Bacteria 995
213 Ga0207694_10573905 3300025924 Bacteria 948
214 Ga0207659_10053040 3300025926 Bacteria 2892
215 Ga0207687_10028383 3300025927 Bacteria 3759
216 Ga0207687_10082719 3300025927 Bacteria 2323
217 Ga0207700_10039163 3300025928 Bacteria 3447
218 Ga0207700_10372083 3300025928 Bacteria 1248
219 Ga0207700_10395691 3300025928 Bacteria 1210
220 Ga0207664_10042524 3300025929 Bacteria 3547
221 Ga0207664_10165030 3300025929 Bacteria 1891
222 Ga0207664_10197650 3300025929 Bacteria 1734
223 Ga0207664_10571797 3300025929 Bacteria 1014
224 Ga0207644_10489153 3300025931 Bacteria 1014
225 Ga0207644_10558660 3300025931 Bacteria 948
226 Ga0207690_10206773 3300025932 Bacteria 1494
227 Ga0207690_10786971 3300025932 Bacteria 785
228 Ga0207706_10028941 3300025933 Bacteria 4946
229 Ga0207686_10005486 3300025934 Bacteria 6806
230 Ga0207670_10079479 3300025936 Bacteria 2290
231 Ga0207665_10442807 3300025939 Bacteria 996
232 Ga0207665_10509718 3300025939 Bacteria 930
233 Ga0207689_10765812 3300025942 Bacteria 815
234 Ga0207661_10879286 3300025944 Bacteria 825
235 Ga0207679_10018209 3300025945 Bacteria 4701
236 Ga0207667_10005626 3300025949 Bacteria 15287
237 Ga0207667_10027829 3300025949 Bacteria 6147
238 Ga0207667_10054455 3300025949 Bacteria 4208
239 Ga0207667_10210229 3300025949 Bacteria 1994
240 Ga0207639_10089290 3300026041 Bacteria 2462
241 Ga0207678_10008591 3300026067 Bacteria 8997
242 Ga0207702_10012234 3300026078 Bacteria 7140
243 Ga0207702_10042516 3300026078 Bacteria 3812
244 Ga0207676_11230493 3300026095 Bacteria 742
245 Ga0207674_10001627 3300026116 Bacteria 28901
246 Ga0207674_10875127 3300026116 Bacteria 866
247 Ga0207683_10489182 3300026121 Bacteria 1136
248 Ga0207698_10055050 3300026142 Bacteria 3063
249 Ga0207698_11424328 3300026142 Bacteria 708
250 Ga0209281_1000324 3300027111 Bacteria 84060
251 Ga0268266_10263663 3300028379 Bacteria 1597
252 Ga0268265_10996082 3300028380 Bacteria 828
253 Ga0268264_10109622 3300028381 Bacteria 2416
254 Ga0265327_10006911 3300031251 Bacteria 8921
255 Ga0265327_10199724 3300031251 Unclassified 906
256 Ga0307407_10420820 3300031903 Bacteria 963
257 Ga0307409_100219114 3300031995 Bacteria 1717
258 Ga0307416_100320671 3300032002 Bacteria 1551
259 Ga0307416_102712175 3300032002 Bacteria 592
260 Ga0307411_10175201 3300032005 Bacteria 1622
261 Ga0307411_10924255 3300032005 Bacteria 776
262 Ga0307415_100320985 3300032126 Bacteria 1291
263 Ga0373926_0093478 3300035083 Bacteria 1120
264 Ga0373934_0048093 3300035086 Bacteria 1688
265 Ga0373936_0311626 3300035113 Bacteria 712
266 Ga0373945_0008382 3300035116 Bacteria 3366
267 Ga0373954_0196545 3300035118 Bacteria 991
268 Ga0373956_0166893 3300035119 Bacteria 1038
269 Ga0373956_0286356 3300035119 Bacteria 784
270 Ga0373943_0012979 3300035170 Bacteria 3757
271 Ga0373943_0325360 3300035170 Bacteria 877
272 Ga0373946_0009399 3300035171 Bacteria 3600
273 Ga0373955_0312615 3300035172 Bacteria 948
274 Ga0373924_0105996 3300035410 Bacteria 1212
275 Ga0373935_0037494 3300035692 Bacteria 3034
276 Ga0373935_0056134 3300035692 Bacteria 2510
277 Ga0373927_0005984 3300035695 Bacteria 8329
278 Ga0373927_0009698 3300035695 Bacteria 6458
279 Ga0373927_0028338 3300035695 Bacteria 3652
280 Ga0373933_0017385 3300035724 Bacteria 4036
281 Ga0373933_0074286 3300035724 Bacteria 2073
282 Ga0373947_0033045 3300035725 Bacteria 3052
283 Ga0373947_0048648 3300035725 Bacteria 2544
284 Ga0373937_0003075 3300036401 Bacteria 13951
285 Ga0373937_0078048 3300036401 Bacteria 3060
286 Ga0373937_0165395 3300036401 Bacteria 2074
287 Ga0373937_0199727 3300036401 Bacteria 1880
288 Ga0373925_0003994 3300037068 Bacteria 11226
289 Ga0373925_0056322 3300037068 Bacteria 2945
290 Ga0373925_0129203 3300037068 Bacteria 1968
291 Ga0373925_0209906 3300037068 Bacteria 1551
292 Ga0373925_0312046 3300037068 Bacteria 1271
293 Ga0395899_0001557 3300037312 Bacteria 19328
294 Ga0395899_0069191 3300037312 Bacteria 2585
295 Ga0395899_0404521 3300037312 Bacteria 902
296 Ga0395900_0000004 3300037418 Bacteria 564908
297 Ga0395900_0029893 3300037418 Bacteria 5591
298 Ga0395900_0124267 3300037418 Bacteria 2646
299 Ga0395898_0026069 3300037466 Bacteria 5885
300 Ga0395898_0035464 3300037466 Bacteria 4959
301 Ga0395898_0322943 3300037466 Bacteria 1472
302 Ga0395905_0130704 3300037471 Bacteria 2361
303 Ga0395905_0132588 3300037471 Bacteria 2343
304 Ga0395905_0501238 3300037471 Bacteria 1114
305 Ga0395905_0584560 3300037471 Bacteria 1018
306 Ga0436364_0503433 3300037853 Bacteria 24770
307 Ga0436364_0574873 3300037853 Bacteria 1048
308 Ga0436364_1015573 3300037853 Bacteria 2636
309 Ga0395901_0000005 3300038443 Bacteria 544998
310 Ga0395901_0062221 3300038443 Bacteria 3884
311 Ga0436365_0197643 3300039437 Bacteria 1331
312 Ga0436365_0290245 3300039437 Bacteria 4669
313 Ga0436365_0311079 3300039437 Bacteria 5152
314 Ga0436365_1319488 3300039437 Bacteria 830
315 Ga0436360_0795877 3300039438 Bacteria 1430
316 Ga0436360_0971348 3300039438 Bacteria 1179
317 Ga0436360_0992847 3300039438 Bacteria 641
318 Ga0436361_0910631 3300039447 Bacteria 2120
319 Ga0436363_0481301 3300039450 Bacteria 626
320 Ga0436363_1619455 3300039450 Bacteria 871
321 Ga0436363_1645645 3300039450 Bacteria 1511
322 Ga0436363_1675399 3300039450 Bacteria 1393
323 Ga0436362_0537392 3300039453 Bacteria 1858
324 Ga0451798_0378100 3300041458 Bacteria 548
325 Ga0466963_0851224 3300044694 Bacteria 643
326 Ga0466957_0400770 3300044842 Bacteria 938
327 Ga0451576_0441239 3300045051 Bacteria 1366
328 Ga0466967_0059922 3300045976 Bacteria 3371
329 Ga0466967_0186673 3300045976 Bacteria 1958
330 Ga0466967_0521453 3300045976 Bacteria 1168
331 Ga0495627_000007 3300046453 Bacteria 575915
332 Ga0495580_0016368 3300046472 Bacteria 5566
333 Ga0495582_0020380 3300046473 Bacteria 3629
334 Ga0495639_0015557 3300046475 Bacteria 3299
335 Ga0495662_0071911 3300046476 Bacteria 1676
336 Ga0495664_0030267 3300046477 Bacteria 3170
337 Ga0495585_0000001 3300046492 Bacteria 609804
338 Ga0495628_0011275 3300046516 Bacteria 7562
339 Ga0495630_0033906 3300046517 Bacteria 3808
340 Ga0495631_0002113 3300046518 Bacteria 11528
341 Ga0495631_0204647 3300046518 Bacteria 844
342 Ga0495666_0079889 3300046526 Bacteria 1548
343 Ga0495640_0085240 3300046533 Bacteria 2094
344 Ga0495586_0258369 3300046535 Bacteria 994
345 Ga0495656_0015324 3300046615 Bacteria 2892
346 Ga0495668_0033212 3300046616 Bacteria 2900
347 Ga0495634_0524963 3300046642 Bacteria 692
348 Ga0495635_0019115 3300046663 Bacteria 4781
349 Ga0495659_0282732 3300046664 Bacteria 697
350 Ga0495623_0327099 3300046679 Bacteria 840
351 Ga0495647_0237382 3300046681 Bacteria 808
352 Ga0495647_0259743 3300046681 Bacteria 775
353 Ga0495658_0031211 3300046683 Bacteria 2900
354 Ga0495613_0154780 3300046689 Bacteria 1633
355 Ga0495600_0220729 3300046809 Bacteria 1212
356 Ga0495581_0006065 3300047315 Bacteria 7006
357 Ga0495674_0266659 3300047319 Bacteria 1406
358 Ga0495680_0012839 3300047322 Bacteria 7340
359 Ga0495686_0094672 3300047472 Bacteria 1809
360 Ga0495614_0086829 3300048089 Bacteria 1358
361 Ga0496100_0128179 3300048903 Bacteria 1784
362 Ga0496100_0383180 3300048903 Bacteria 1068
363 Ga0496101_0429276 3300048904 Bacteria 1042
364 Ga0496102_0218609 3300048905 Bacteria 1796
365 Ga0496102_0547289 3300048905 Bacteria 1080
366 Ga0496104_0001526 3300048907 Bacteria 19967
367 Ga0496104_0436526 3300048907 Bacteria 1221
368 Ga0496105_0073612 3300048908 Bacteria 2822
369 Ga0496105_0079070 3300048908 Bacteria 2716
370 Ga0496105_0115538 3300048908 Bacteria 2214
371 Ga0496106_0238382 3300048909 Bacteria 1453
372 Ga0496106_0545948 3300048909 Bacteria 930
373 Ga0496108_0182361 3300048911 Bacteria 1818
374 Ga0496108_0486845 3300048911 Bacteria 1078
375 Ga0496108_0680046 3300048911 Bacteria 893
376 Ga0496109_0072728 3300048912 Bacteria 3159
377 Ga0496110_0461391 3300048913 Bacteria 1158
378 Ga0496111_0025294 3300048914 Bacteria 4189
379 Ga0496112_0098154 3300048915 Bacteria 2899
380 Ga0496112_0181197 3300048915 Bacteria 2071
381 Ga0496112_0483587 3300048915 Bacteria 1174
382 Ga0496113_0231251 3300048916 Bacteria 1474
383 Ga0496114_0307949 3300048917 Bacteria 1399
384 Ga0496115_0015930 3300048918 Bacteria 5714
385 Ga0496115_0237384 3300048918 Bacteria 1503
386 Ga0496115_0486662 3300048918 Bacteria 993
387 Ga0496115_0525844 3300048918 Bacteria 948
388 Ga0496116_0055907 3300048919 Bacteria 2590
389 Ga0496116_0172992 3300048919 Bacteria 1168
390 Ga0496119_0028295 3300048922 Bacteria 3828
391 Ga0496120_0083756 3300048923 Bacteria 1721
392 Ga0496121_0031042 3300048924 Bacteria 4893
393 Ga0496124_0048910 3300048927 Bacteria 3609
394 Ga0496124_0131024 3300048927 Bacteria 1992
395 Ga0501031_0560694 3300049568 Bacteria 736
396 Ga0501032_0310493 3300049569 Bacteria 1019
397 Ga0501033_0490307 3300049570 Bacteria 851
398 Ga0501033_0509181 3300049570 Bacteria 832
399 Ga0501034_0105241 3300049571 Bacteria 2815
400 Ga0501036_0688064 3300049572 Bacteria 845
401 Ga0501038_0093102 3300049574 Bacteria 2522
402 Ga0501038_0453515 3300049574 Bacteria 986
403 Ga0501039_0264476 3300049575 Bacteria 1352
404 Ga0501043_0855777 3300049579 Bacteria 655
405 Ga0501046_0728709 3300049580 Bacteria 697
406 Ga0501047_0151380 3300049581 Bacteria 2196
407 Ga0501067_0173423 3300049583 Bacteria 1201
408 Ga0501067_0323723 3300049583 Bacteria 858
409 Ga0501068_0195352 3300049584 Bacteria 1283
410 Ga0501069_0231066 3300049585 Bacteria 1077
411 Ga0501070_0304128 3300049586 Bacteria 1299
412 Ga0501070_1310448 3300049586 Bacteria 553
413 Ga0501072_0001059 3300049588 Bacteria 20378
414 Ga0501075_0695584 3300049591 Bacteria 775
415 Ga0501235_166668 3300049669 Bacteria 580
416 Ga0501079_0662622 3300049741 Bacteria 822
417 Ga0501080_0337804 3300049742 Bacteria 1361
418 Ga0501080_0873947 3300049742 Bacteria 785
419 Ga0501083_0051414 3300049744 Bacteria 2771
420 Ga0501083_0073347 3300049744 Bacteria 2275
421 Ga0501083_0195336 3300049744 Bacteria 1320
422 Ga0501083_0274195 3300049744 Bacteria 1097
423 Ga0501035_0083270 3300049822 Bacteria 2823
424 Ga0501035_0152748 3300049822 Bacteria 2003
425 Ga0501044_0160043 3300049823 Bacteria 2229
426 Ga0501044_0638892 3300049823 Bacteria 954
427 nmdc:mga07m45_192914_c1 3300050496 Bacteria 1185
428 nmdc:mga0n895_1635463_c1 3300050512 Bacteria 608
429 nmdc:mga0n895_306248_c1 3300050512 Bacteria 1610
430 nmdc:mga0n895_409614_c1 3300050512 Bacteria 1371
431 nmdc:mga0n895_490754_c1 3300050512 Bacteria 1238
432 nmdc:mga0n895_565301_c1 3300050512 Bacteria 1142
433 nmdc:mga0rr50_342646_c1 3300050513 Bacteria 1256
434 nmdc:mga0rr50_441773_c1 3300050513 Bacteria 1102
435 nmdc:mga0sz30_259519_c1 3300050516 Bacteria 774
436 Ga0495601_0351988 3300053077 Bacteria 958
437 Ga0495619_0060531 3300053085 Bacteria 2517
438 Ga0500643_000845 3300053087 Bacteria 19602
439 Ga0500651_0404663 3300053093 Bacteria 766
440 Ga0500595_068233 3300053119 Bacteria 1059
441 Ga0500642_0117652 3300053130 Bacteria 1242
442 Ga0501084_0125380 3300054114 Bacteria 2161
443 Ga0501084_0289500 3300054114 Bacteria 1383
444 Ga0530510_0148966 3300061734 Bacteria 1727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2964685014 2964685850 134
2 3300006175 Ga0070712_100001285 Ga0070712_1000012859 141
3 3300025915 Ga0207693_10003078 Ga0207693_100030787 141
4 3300037312 Ga0395899_0404521 Ga0395899_0404521_438_881 143
5 3300048922 Ga0496119_0028295 Ga0496119_0028295_997_1485 145
6 3300048923 Ga0496120_0083756 Ga0496120_0083756_82_570 145
7 3300005548 Ga0070665_100839504 Ga0070665_1008395042 147
8 3300028379 Ga0268266_10263663 Ga0268266_102636632 147
9 3300005617 Ga0068859_101875328 Ga0068859_1018753282 148
10 3300006931 Ga0097620_101875604 Ga0097620_1018756042 148
11 3300005327 Ga0070658_10756659 Ga0070658_107566592 149
12 3300005435 Ga0070714_100026513 Ga0070714_1000265135 149
13 3300005436 Ga0070713_100820886 Ga0070713_1008208862 149
14 3300005439 Ga0070711_100071738 Ga0070711_1000717381 149
15 3300005459 Ga0068867_100931204 Ga0068867_1009312042 149
16 3300005530 Ga0070679_100207061 Ga0070679_1002070612 149
17 3300005530 Ga0070679_100333276 Ga0070679_1003332762 149
18 3300005614 Ga0068856_100361678 Ga0068856_1003616782 149
19 3300006175 Ga0070712_100001185 Ga0070712_1000011858 149
20 3300009093 Ga0105240_10018795 Ga0105240_100187955 149
21 3300009093 Ga0105240_10070291 Ga0105240_100702912 149
22 3300009551 Ga0105238_10049324 Ga0105238_100493242 149
23 3300013105 Ga0157369_10209933 Ga0157369_102099332 149
24 3300013307 Ga0157372_10223509 Ga0157372_102235092 149
25 3300025911 Ga0207654_10038263 Ga0207654_100382632 149
26 3300025912 Ga0207707_10338109 Ga0207707_103381092 149
27 3300025913 Ga0207695_10010468 Ga0207695_100104683 149
28 3300025913 Ga0207695_10120056 Ga0207695_101200562 149
29 3300025915 Ga0207693_10003954 Ga0207693_100039543 149
30 3300025917 Ga0207660_11114452 Ga0207660_111144522 149
31 3300025921 Ga0207652_10366681 Ga0207652_103666812 149
32 3300025921 Ga0207652_10840822 Ga0207652_108408222 149
33 3300025924 Ga0207694_10099057 Ga0207694_100990572 149
34 3300025929 Ga0207664_10165030 Ga0207664_101650302 149
35 3300025949 Ga0207667_10027829 Ga0207667_100278295 149
36 3300049583 Ga0501067_0323723 Ga0501067_0323723_41_520 149
37 3300049742 Ga0501080_0873947 Ga0501080_0873947_47_526 149
38 3300049744 Ga0501083_0051414 Ga0501083_0051414_2192_2671 149
39 iso_pu_bacteria 2510065057 2510302974 149
40 iso_pu_bacteria 2511231052 2511496973 149
41 iso_pu_bacteria 2513237086 2513583414 149
42 iso_pu_bacteria 2513237091 2513614912 149
43 iso_pu_bacteria 2513237140 2513883962 149
44 iso_pu_bacteria 2513237143 2513901627 149
45 iso_pu_bacteria 2516653046 2516895797 149
46 iso_pu_bacteria 2524023207 2524449201 149
47 iso_pu_bacteria 2551306084 2551678734 149
48 iso_pu_bacteria 2551306084 2551681972 149
49 iso_pu_bacteria 2551306085 2551683285 149
50 iso_pu_bacteria 2551306086 2551696735 149
51 iso_pu_bacteria 2551306089 2551714154 149
52 iso_pu_bacteria 2551306090 2551716730 149
53 iso_pu_bacteria 2551306091 2551731374 149
54 iso_pu_bacteria 2551306093 2551744276 149
55 iso_pu_bacteria 2738541317 2738946704 149
56 iso_pu_bacteria 2791355094 2792640600 149
57 iso_pu_bacteria 2855825444 2855829386 149
58 iso_pu_bacteria 2855839649 2855844485 149
59 iso_pu_bacteria 2858800743 2858806054 149
60 iso_pu_bacteria 2913308742 2913311938 149
61 iso_pu_bacteria 2915986958 2915988095 149
62 iso_pu_bacteria 2915993759 2915993861 149
63 iso_pu_bacteria 2916000859 2916003276 149
64 iso_pu_bacteria 2916007675 2916008789 149
65 iso_pu_bacteria 2916014648 2916015779 149
66 iso_pu_bacteria 2916028427 2916028496 149
67 iso_pu_bacteria 2916035215 2916037498 149
68 iso_pu_bacteria 2916041962 2916042045 149
69 iso_pu_bacteria 2916048683 2916048817 149
70 iso_pu_bacteria 2916055098 2916059833 149
71 iso_pu_bacteria 2916068649 2916072542 149
72 iso_pu_bacteria 2916076590 2916077461 149
73 iso_pu_bacteria 2919404418 2919405724 149
74 iso_pu_bacteria 2921201388 2921205283 149
75 iso_pu_bacteria 2921208531 2921212080 149
76 iso_pu_bacteria 2921237296 2921237368 149
77 iso_pu_bacteria 2921244191 2921250104 149
78 iso_pu_bacteria 2921257292 2921259427 149
79 iso_pu_bacteria 2921263974 2921268124 149
80 iso_pu_bacteria 2921282425 2921282699 149
81 iso_pu_bacteria 2921289301 2921295128 149
82 iso_pu_bacteria 2921296804 2921302084 149
83 iso_pu_bacteria 2924144063 2924150451 149
84 iso_pu_bacteria 2924150972 2924157154 149
85 iso_pu_bacteria 2924158325 2924161735 149
86 iso_pu_bacteria 2924165586 2924171806 149
87 iso_pu_bacteria 2924172951 2924175009 149
88 iso_pu_bacteria 2924179722 2924182687 149
89 iso_pu_bacteria 2924186466 2924189151 149
90 iso_pu_bacteria 2924193448 2924196847 149
91 iso_pu_bacteria 2924200457 2924200564 149
92 iso_pu_bacteria 2924207177 2924207187 149
93 iso_pu_bacteria 2924214083 2924219290 149
94 iso_pu_bacteria 2924221636 2924223689 149
95 iso_pu_bacteria 2924228884 2924228904 149
96 iso_pu_bacteria 2937002841 2937003027 149
97 iso_pu_bacteria 2937009748 2937009876 149
98 iso_pu_bacteria 2937016420 2937020312 149
99 iso_pu_bacteria 2937023124 2937025195 149
100 iso_pu_bacteria 2937042894 2937047302 149
101 iso_pu_bacteria 2937049772 2937054546 149
102 iso_pu_bacteria 2937056579 2937058412 149
103 iso_pu_bacteria 2937063883 2937063956 149
104 iso_pu_bacteria 2937071275 2937072283 149
105 iso_pu_bacteria 2937091812 2937094388 149
106 iso_pu_bacteria 2937098957 2937101472 149
107 iso_pu_bacteria 2937106411 2937110182 149
108 iso_pu_bacteria 2937113482 2937115456 149
109 iso_pu_bacteria 2937119839 2937120062 149
110 iso_pu_bacteria 2937126314 2937128182 149
111 iso_pu_bacteria 2957382221 2957382303 149
112 iso_pu_bacteria 2957388812 2957395488 149
113 iso_pu_bacteria 2957395598 2957398015 149
114 iso_pu_bacteria 2957402308 2957404251 149
115 iso_pu_bacteria 2957408893 2957414816 149
116 iso_pu_bacteria 2957415311 2957421143 149
117 iso_pu_bacteria 2957422303 2957429228 149
118 iso_pu_bacteria 2957430029 2957431314 149
119 iso_pu_bacteria 2957443900 2957445979 149
120 iso_pu_bacteria 2957450854 2957451080 149
121 iso_pu_bacteria 2957457609 2957461720 149
122 iso_pu_bacteria 2957464669 2957468415 149
123 iso_pu_bacteria 2957471148 2957474548 149
124 iso_pu_bacteria 2957478035 2957483326 149
125 iso_pu_bacteria 2957484790 2957487730 149
126 iso_pu_bacteria 2957491536 2957496543 149
127 iso_pu_bacteria 2957498199 2957504769 149
128 iso_pu_bacteria 2957505466 2957505567 149
129 iso_pu_bacteria 2960584000 2960584045 149
130 iso_pu_bacteria 2960597568 2960603064 149
131 iso_pu_bacteria 2960603979 2960604131 149
132 iso_pu_bacteria 2960610863 2960610976 149
133 iso_pu_bacteria 2960617483 2960622342 149
134 iso_pu_bacteria 2960624210 2960624401 149
135 iso_pu_bacteria 2960637947 2960637956 149
136 iso_pu_bacteria 2960645483 2960649097 149
137 iso_pu_bacteria 2960652885 2960659626 149
138 iso_pu_bacteria 2960660292 2960663721 149
139 iso_pu_bacteria 2960667422 2960667535 149
140 iso_pu_bacteria 2960674078 2960676554 149
141 iso_pu_bacteria 2964607997 2964610149 149
142 iso_pu_bacteria 2964615318 2964615498 149
143 iso_pu_bacteria 2964621998 2964626144 149
144 iso_pu_bacteria 2964628898 2964628991 149
145 iso_pu_bacteria 2964636051 2964636098 149
146 iso_pu_bacteria 2964643177 2964643400 149
147 iso_pu_bacteria 2964649959 2964653939 149
148 iso_pu_bacteria 2964656573 2964656700 149
149 iso_pu_bacteria 2964663802 2964664027 149
150 iso_pu_bacteria 2964670856 2964676017 149
151 iso_pu_bacteria 2964678106 2964682348 149
152 iso_pu_bacteria 2964691889 2964695265 149
153 iso_pu_bacteria 2964698721 2964698886 149
154 iso_pu_bacteria 2964705432 2964707552 149
155 iso_pu_bacteria 2964712639 2964717802 149
156 iso_pu_bacteria 2964719344 2964720839 149
157 iso_pu_bacteria 2967664464 2967664540 149
158 iso_pu_bacteria 2967671571 2967672434 149
159 iso_pu_bacteria 2967678726 2967682621 149
160 iso_pu_bacteria 2967693043 2967698539 149
161 iso_pu_bacteria 2967699805 2967705812 149
162 iso_pu_bacteria 2967706974 2967708529 149
163 iso_pu_bacteria 2967714385 2967718612 149
164 iso_pu_bacteria 2967721400 2967723125 149
165 iso_pu_bacteria 2967735183 2967737432 149
166 iso_pu_bacteria 2967742019 2967744456 149
167 iso_pu_bacteria 2967748971 2967749196 149
168 iso_pu_bacteria 2967755722 2967755947 149
169 iso_pu_bacteria 2967762386 2967762501 149
170 iso_pu_bacteria 2967769361 2967769428 149
171 iso_pu_bacteria 2967775926 2967775941 149
172 iso_pu_bacteria 2970019648 2970019723 149
173 iso_pu_bacteria 2970033650 2970033875 149
174 iso_pu_bacteria 2970040964 2970044056 149
175 iso_pu_bacteria 2970047711 2970048292 149
176 iso_pu_bacteria 2970054988 2970055590 149
177 iso_pu_bacteria 2970061556 2970065170 149
178 iso_pu_bacteria 2970068827 2970069051 149
179 iso_pu_bacteria 2970076120 2970077991 149
180 iso_pu_bacteria 2970082768 2970084483 149
181 iso_pu_bacteria 2970088815 2970091881 149
182 iso_pu_bacteria 2970095765 2970097729 149
183 iso_pu_bacteria 2970102677 2970102902 149
184 iso_pu_bacteria 2970109326 2970111363 149
185 iso_pu_bacteria 2970116247 2970119036 149
186 iso_pu_bacteria 2970129317 2970135350 149
187 iso_pu_bacteria 2970136068 2970142038 149
188 iso_pu_bacteria 2970149975 2970152149 149
189 iso_pu_bacteria 2970156795 2970159996 149
190 iso_pu_bacteria 2970164137 2970165460 149
191 iso_pu_bacteria 2970170962 2970171204 149
192 iso_pu_bacteria 2970177841 2970179999 149
193 iso_pu_bacteria 2970184632 2970188231 149
194 iso_pu_bacteria 2970191845 2970192798 149
195 iso_pu_bacteria 2977516862 2977519559 149
196 iso_pu_bacteria 2977523885 2977525851 149
197 iso_pu_bacteria 2977537788 2977539855 149
198 iso_pu_bacteria 2977551784 2977556175 149
199 iso_pu_bacteria 2977558990 2977559089 149
200 iso_pu_bacteria 2977565890 2977566060 149
201 iso_pu_bacteria 2977572785 2977578459 149
202 iso_pu_bacteria 2977579622 2977585009 149
203 iso_pu_bacteria 648276728 648735497 149
204 iso_pu_bacteria 8003992118 8003997009 149
205 3300005365 Ga0070688_100105745 Ga0070688_1001057452 150
206 3300005438 Ga0070701_10387415 Ga0070701_103874151 150
207 3300005563 Ga0068855_100097727 Ga0068855_1000977272 150
208 3300005617 Ga0068859_100202100 Ga0068859_1002021002 150
209 3300006195 Ga0075366_10083588 Ga0075366_100835882 150
210 3300006353 Ga0075370_10262408 Ga0075370_102624082 150
211 3300006852 Ga0075433_10145245 Ga0075433_101452452 150
212 3300006871 Ga0075434_101338916 Ga0075434_1013389162 150
213 3300006931 Ga0097620_100202114 Ga0097620_1002021142 150
214 3300009545 Ga0105237_10311621 Ga0105237_103116212 150
215 3300009551 Ga0105238_10139797 Ga0105238_101397972 150
216 3300025924 Ga0207694_10573905 Ga0207694_105739052 150
217 3300025927 Ga0207687_10028383 Ga0207687_100283833 150
218 3300025949 Ga0207667_10210229 Ga0207667_102102292 150
219 3300037312 Ga0395899_0001557 Ga0395899_0001557_1119_1601 150
220 3300037418 Ga0395900_0000004 Ga0395900_0000004_230586_231068 150
221 3300037466 Ga0395898_0026069 Ga0395898_0026069_4883_5365 150
222 3300037471 Ga0395905_0130704 Ga0395905_0130704_956_1438 150
223 3300038443 Ga0395901_0000005 Ga0395901_0000005_334498_334980 150
224 3300041458 Ga0451798_0378100 Ga0451798_0378100_57_515 150
225 3300044842 Ga0466957_0400770 Ga0466957_0400770_371_859 150
226 3300050496 nmdc:mga07m45_192914_c1 nmdc:mga07m45_192914_c1_285_752 150
227 iso_pu_bacteria 2513237351 2514587942 150
228 iso_pu_bacteria 2526164713 2527079349 150
229 iso_pu_bacteria 2838074704 2838077788 150
230 iso_pu_bacteria 2920760137 2920764842 150
231 3300009098 Ga0105245_10037389 Ga0105245_100373893 151
232 3300009551 Ga0105238_10946838 Ga0105238_109468382 151
233 3300013306 Ga0163162_10074776 Ga0163162_100747762 151
234 3300013308 Ga0157375_10075704 Ga0157375_100757042 151
235 3300021384 Ga0213876_10053857 Ga0213876_100538572 151
236 3300025931 Ga0207644_10558660 Ga0207644_105586602 151
237 3300025939 Ga0207665_10509718 Ga0207665_105097182 151
238 3300039437 Ga0436365_0197643 Ga0436365_0197643_292_768 151
239 3300039437 Ga0436365_0290245 Ga0436365_0290245_2652_3137 151
240 3300039450 Ga0436363_0481301 Ga0436363_0481301_130_588 151
241 3300046615 Ga0495656_0015324 Ga0495656_0015324_333_788 151
242 3300046664 Ga0495659_0282732 Ga0495659_0282732_31_486 151
243 3300048903 Ga0496100_0383180 Ga0496100_0383180_475_966 151
244 3300048905 Ga0496102_0218609 Ga0496102_0218609_943_1434 151
245 3300048909 Ga0496106_0545948 Ga0496106_0545948_392_883 151
246 3300048911 Ga0496108_0486845 Ga0496108_0486845_560_1051 151
247 3300048912 Ga0496109_0072728 Ga0496109_0072728_2602_3093 151
248 3300048913 Ga0496110_0461391 Ga0496110_0461391_639_1130 151
249 3300048914 Ga0496111_0025294 Ga0496111_0025294_2617_3108 151
250 3300048916 Ga0496113_0231251 Ga0496113_0231251_569_1060 151
251 3300050512 nmdc:mga0n895_409614_c1 nmdc:mga0n895_409614_c1_61_552 151
252 3300005336 Ga0070680_100742736 Ga0070680_1007427362 152
253 3300005340 Ga0070689_100089609 Ga0070689_1000896092 152
254 3300005343 Ga0070687_100485358 Ga0070687_1004853582 152
255 3300005353 Ga0070669_100057169 Ga0070669_1000571693 152
256 3300005354 Ga0070675_100042262 Ga0070675_1000422622 152
257 3300005355 Ga0070671_100319022 Ga0070671_1003190222 152
258 3300005434 Ga0070709_10069621 Ga0070709_100696211 152
259 3300005435 Ga0070714_100006501 Ga0070714_1000065013 152
260 3300005436 Ga0070713_100147655 Ga0070713_1001476553 152
261 3300005439 Ga0070711_100630665 Ga0070711_1006306652 152
262 3300005536 Ga0070697_100016999 Ga0070697_1000169992 152
263 3300005547 Ga0070693_100186730 Ga0070693_1001867302 152
264 3300005719 Ga0068861_100250364 Ga0068861_1002503642 152
265 3300006173 Ga0070716_100147047 Ga0070716_1001470472 152
266 3300006852 Ga0075433_10899895 Ga0075433_108998952 152
267 3300006871 Ga0075434_100310470 Ga0075434_1003104702 152
268 3300006914 Ga0075436_100339645 Ga0075436_1003396452 152
269 3300006931 Ga0097620_100734385 Ga0097620_1007343852 152
270 3300007076 Ga0075435_100028347 Ga0075435_1000283472 152
271 3300013307 Ga0157372_10186375 Ga0157372_101863752 152
272 3300014326 Ga0157380_10617676 Ga0157380_106176762 152
273 3300021388 Ga0213875_10000003 Ga0213875_10000003677 152
274 3300025906 Ga0207699_10085225 Ga0207699_100852252 152
275 3300025916 Ga0207663_10095461 Ga0207663_100954612 152
276 3300025923 Ga0207681_10017808 Ga0207681_100178083 152
277 3300025926 Ga0207659_10053040 Ga0207659_100530402 152
278 3300025927 Ga0207687_10082719 Ga0207687_100827192 152
279 3300025928 Ga0207700_10039163 Ga0207700_100391632 152
280 3300025929 Ga0207664_10042524 Ga0207664_100425242 152
281 3300025936 Ga0207670_10079479 Ga0207670_100794792 152
282 3300026121 Ga0207683_10489182 Ga0207683_104891822 152
283 3300031251 Ga0265327_10006911 Ga0265327_100069114 152
284 3300032002 Ga0307416_102712175 Ga0307416_1027121752 152
285 3300037312 Ga0395899_0069191 Ga0395899_0069191_802_1278 152
286 3300037418 Ga0395900_0029893 Ga0395900_0029893_3808_4284 152
287 3300037418 Ga0395900_0124267 Ga0395900_0124267_322_798 152
288 3300037466 Ga0395898_0035464 Ga0395898_0035464_2380_2856 152
289 3300037466 Ga0395898_0322943 Ga0395898_0322943_783_1259 152
290 3300037471 Ga0395905_0132588 Ga0395905_0132588_1833_2309 152
291 3300037471 Ga0395905_0584560 Ga0395905_0584560_512_988 152
292 3300037853 Ga0436364_0503433 Ga0436364_0503433_17658_18143 152
293 3300038443 Ga0395901_0062221 Ga0395901_0062221_927_1403 152
294 3300039438 Ga0436360_0971348 Ga0436360_0971348_619_1101 152
295 3300045051 Ga0451576_0441239 Ga0451576_0441239_206_697 152
296 3300045976 Ga0466967_0186673 Ga0466967_0186673_1136_1633 152
297 3300046453 Ga0495627_000007 Ga0495627_000007_103572_104039 152
298 3300046492 Ga0495585_0000001 Ga0495585_0000001_424832_425320 152
299 3300046518 Ga0495631_0002113 Ga0495631_0002113_5976_6464 152
300 3300046616 Ga0495668_0033212 Ga0495668_0033212_406_897 152
301 3300048903 Ga0496100_0128179 Ga0496100_0128179_1159_1638 152
302 3300048918 Ga0496115_0525844 Ga0496115_0525844_387_866 152
303 3300048919 Ga0496116_0055907 Ga0496116_0055907_416_883 152
304 3300048927 Ga0496124_0048910 Ga0496124_0048910_3020_3499 152
305 3300048927 Ga0496124_0131024 Ga0496124_0131024_101_568 152
306 3300050512 nmdc:mga0n895_565301_c1 nmdc:mga0n895_565301_c1_31_501 152
307 3300053087 Ga0500643_000845 Ga0500643_000845_4244_4711 152
308 3300053093 Ga0500651_0404663 Ga0500651_0404663_230_721 152
309 3300003322 rootL2_10195908 rootL2_101959082 153
310 3300003323 rootH1_10162803 rootH1_101628032 153
311 3300003578 Ga0006562J51391_1078777 Ga0006562J51391_10787773 153
312 3300003578 Ga0006562J51391_1078780 Ga0006562J51391_10787803 153
313 3300003775 Ga0055524_1007446 Ga0055524_10074462 153
314 3300003790 Ga0055528_1000299 Ga0055528_100029936 153
315 3300004625 Ga0055543_1051346 Ga0055543_10513462 153
316 3300005262 Ga0065165_1000001 Ga0065165_1000001401 153
317 3300005329 Ga0070683_100214824 Ga0070683_1002148242 153
318 3300005334 Ga0068869_100608456 Ga0068869_1006084562 153
319 3300005334 Ga0068869_101797565 Ga0068869_1017975651 153
320 3300005335 Ga0070666_10171731 Ga0070666_101717312 153
321 3300005336 Ga0070680_100011053 Ga0070680_1000110534 153
322 3300005336 Ga0070680_100066209 Ga0070680_1000662092 153
323 3300005336 Ga0070680_100210550 Ga0070680_1002105501 153
324 3300005338 Ga0068868_100338271 Ga0068868_1003382712 153
325 3300005339 Ga0070660_100104673 Ga0070660_1001046732 153
326 3300005339 Ga0070660_100204537 Ga0070660_1002045372 153
327 3300005340 Ga0070689_100016680 Ga0070689_1000166804 153
328 3300005355 Ga0070671_100609111 Ga0070671_1006091112 153
329 3300005365 Ga0070688_100376693 Ga0070688_1003766931 153
330 3300005366 Ga0070659_100031669 Ga0070659_1000316692 153
331 3300005366 Ga0070659_100213967 Ga0070659_1002139671 153
332 3300005435 Ga0070714_100293988 Ga0070714_1002939882 153
333 3300005435 Ga0070714_100962421 Ga0070714_1009624212 153
334 3300005437 Ga0070710_10723886 Ga0070710_107238861 153
335 3300005439 Ga0070711_100167609 Ga0070711_1001676092 153
336 3300005439 Ga0070711_100176063 Ga0070711_1001760632 153
337 3300005455 Ga0070663_100008193 Ga0070663_1000081936 153
338 3300005458 Ga0070681_10002425 Ga0070681_1000242510 153
339 3300005466 Ga0070685_10242404 Ga0070685_102424041 153
340 3300005468 Ga0070707_100443077 Ga0070707_1004430771 153
341 3300005471 Ga0070698_100304719 Ga0070698_1003047192 153
342 3300005518 Ga0070699_100610496 Ga0070699_1006104961 153
343 3300005530 Ga0070679_100064459 Ga0070679_1000644592 153
344 3300005530 Ga0070679_100189164 Ga0070679_1001891642 153
345 3300005530 Ga0070679_100245086 Ga0070679_1002450861 153
346 3300005535 Ga0070684_100329484 Ga0070684_1003294842 153
347 3300005535 Ga0070684_100448408 Ga0070684_1004484081 153
348 3300005544 Ga0070686_100358203 Ga0070686_1003582032 153
349 3300005549 Ga0070704_100475668 Ga0070704_1004756682 153
350 3300005563 Ga0068855_100239902 Ga0068855_1002399022 153
351 3300005564 Ga0070664_100024833 Ga0070664_1000248332 153
352 3300005564 Ga0070664_100047568 Ga0070664_1000475682 153
353 3300005577 Ga0068857_100023431 Ga0068857_1000234311 153
354 3300005614 Ga0068856_100005782 Ga0068856_1000057828 153
355 3300005614 Ga0068856_100055682 Ga0068856_1000556822 153
356 3300005614 Ga0068856_100134757 Ga0068856_1001347572 153
357 3300005617 Ga0068859_100585172 Ga0068859_1005851722 153
358 3300005617 Ga0068859_101554410 Ga0068859_1015544102 153
359 3300005618 Ga0068864_100567080 Ga0068864_1005670802 153
360 3300005618 Ga0068864_101076306 Ga0068864_1010763062 153
361 3300005834 Ga0068851_10025069 Ga0068851_100250692 153
362 3300005841 Ga0068863_101492165 Ga0068863_1014921651 153
363 3300005842 Ga0068858_100672663 Ga0068858_1006726632 153
364 3300006028 Ga0070717_10301674 Ga0070717_103016742 153
365 3300006163 Ga0070715_10077982 Ga0070715_100779821 153
366 3300006173 Ga0070716_100327928 Ga0070716_1003279282 153
367 3300006175 Ga0070712_100030242 Ga0070712_1000302422 153
368 3300006175 Ga0070712_100210339 Ga0070712_1002103392 153
369 3300006237 Ga0097621_100052569 Ga0097621_1000525692 153
370 3300006358 Ga0068871_101138566 Ga0068871_1011385662 153
371 3300006847 Ga0075431_100194564 Ga0075431_1001945643 153
372 3300006871 Ga0075434_100579071 Ga0075434_1005790712 153
373 3300006931 Ga0097620_100585171 Ga0097620_1005851712 153
374 3300006931 Ga0097620_101554399 Ga0097620_1015543992 153
375 3300006946 Ga0079104_1002704 Ga0079104_10027042 153
376 3300007076 Ga0075435_100884046 Ga0075435_1008840462 153
377 3300009093 Ga0105240_10210815 Ga0105240_102108152 153
378 3300009093 Ga0105240_11720591 Ga0105240_117205911 153
379 3300009098 Ga0105245_11454436 Ga0105245_114544362 153
380 3300009148 Ga0105243_11468975 Ga0105243_114689751 153
381 3300009174 Ga0105241_10002057 Ga0105241_1000205710 153
382 3300009174 Ga0105241_10251745 Ga0105241_102517451 153
383 3300009177 Ga0105248_11650776 Ga0105248_116507762 153
384 3300009551 Ga0105238_10062335 Ga0105238_100623353 153
385 3300009551 Ga0105238_10084951 Ga0105238_100849512 153
386 3300009551 Ga0105238_10315283 Ga0105238_103152832 153
387 3300010375 Ga0105239_10066613 Ga0105239_100666133 153
388 3300013100 Ga0157373_10061032 Ga0157373_100610322 153
389 3300013102 Ga0157371_10132606 Ga0157371_101326062 153
390 3300013102 Ga0157371_10163816 Ga0157371_101638162 153
391 3300013104 Ga0157370_10025918 Ga0157370_100259182 153
392 3300013104 Ga0157370_10169489 Ga0157370_101694892 153
393 3300013296 Ga0157374_10003801 Ga0157374_1000380111 153
394 3300013297 Ga0157378_11053173 Ga0157378_110531731 153
395 3300013307 Ga0157372_10010251 Ga0157372_100102517 153
396 3300013307 Ga0157372_10187648 Ga0157372_101876482 153
397 3300013307 Ga0157372_10467172 Ga0157372_104671722 153
398 3300013307 Ga0157372_11181364 Ga0157372_111813642 153
399 3300013308 Ga0157375_11292670 Ga0157375_112926702 153
400 3300014325 Ga0163163_10002471 Ga0163163_1000247115 153
401 3300014497 Ga0182008_10116351 Ga0182008_101163511 153
402 3300014969 Ga0157376_11213390 Ga0157376_112133902 153
403 3300014969 Ga0157376_11223845 Ga0157376_112238452 153
404 3300020069 Ga0197907_10918686 Ga0197907_109186862 153
405 3300020070 Ga0206356_11861440 Ga0206356_118614402 153
406 3300020082 Ga0206353_11024365 Ga0206353_110243652 153
407 3300021384 Ga0213876_10023935 Ga0213876_100239352 153
408 3300021384 Ga0213876_10248826 Ga0213876_102488262 153
409 3300021388 Ga0213875_10192760 Ga0213875_101927602 153
410 3300022467 Ga0224712_10048163 Ga0224712_100481632 153
411 3300025273 Ga0209673_1000054 Ga0209673_1000054171 153
412 3300025294 Ga0209025_1004101 Ga0209025_10041015 153
413 3300025295 Ga0209564_1017714 Ga0209564_10177144 153
414 3300025299 Ga0209256_1000605 Ga0209256_100060512 153
415 3300025302 Ga0207426_1009863 Ga0207426_10098632 153
416 3300025905 Ga0207685_10062506 Ga0207685_100625062 153
417 3300025908 Ga0207643_10018312 Ga0207643_100183124 153
418 3300025909 Ga0207705_10153740 Ga0207705_101537402 153
419 3300025911 Ga0207654_10101536 Ga0207654_101015362 153
420 3300025912 Ga0207707_10000845 Ga0207707_1000084516 153
421 3300025912 Ga0207707_10158476 Ga0207707_101584762 153
422 3300025913 Ga0207695_10078594 Ga0207695_100785942 153
423 3300025913 Ga0207695_10844599 Ga0207695_108445992 153
424 3300025915 Ga0207693_10044023 Ga0207693_100440232 153
425 3300025916 Ga0207663_10005258 Ga0207663_100052582 153
426 3300025916 Ga0207663_10168394 Ga0207663_101683942 153
427 3300025916 Ga0207663_10257139 Ga0207663_102571392 153
428 3300025917 Ga0207660_10012172 Ga0207660_100121723 153
429 3300025917 Ga0207660_10239455 Ga0207660_102394552 153
430 3300025919 Ga0207657_10000412 Ga0207657_100004123 153
431 3300025919 Ga0207657_10309435 Ga0207657_103094352 153
432 3300025921 Ga0207652_10080436 Ga0207652_100804363 153
433 3300025921 Ga0207652_10273305 Ga0207652_102733052 153
434 3300025922 Ga0207646_10534891 Ga0207646_105348911 153
435 3300025924 Ga0207694_10011136 Ga0207694_100111362 153
436 3300025924 Ga0207694_10521955 Ga0207694_105219551 153
437 3300025928 Ga0207700_10372083 Ga0207700_103720832 153
438 3300025928 Ga0207700_10395691 Ga0207700_103956912 153
439 3300025929 Ga0207664_10197650 Ga0207664_101976502 153
440 3300025929 Ga0207664_10571797 Ga0207664_105717972 153
441 3300025931 Ga0207644_10489153 Ga0207644_104891532 153
442 3300025932 Ga0207690_10206773 Ga0207690_102067731 153
443 3300025932 Ga0207690_10786971 Ga0207690_107869712 153
444 3300025933 Ga0207706_10028941 Ga0207706_100289415 153
445 3300025934 Ga0207686_10005486 Ga0207686_100054865 153
446 3300025939 Ga0207665_10442807 Ga0207665_104428072 153
447 3300025942 Ga0207689_10765812 Ga0207689_107658122 153
448 3300025944 Ga0207661_10879286 Ga0207661_108792861 153
449 3300025945 Ga0207679_10018209 Ga0207679_100182094 153
450 3300025949 Ga0207667_10005626 Ga0207667_100056264 153
451 3300025949 Ga0207667_10054455 Ga0207667_100544554 153
452 3300026041 Ga0207639_10089290 Ga0207639_100892902 153
453 3300026067 Ga0207678_10008591 Ga0207678_100085913 153
454 3300026078 Ga0207702_10012234 Ga0207702_100122342 153
455 3300026078 Ga0207702_10042516 Ga0207702_100425163 153
456 3300026095 Ga0207676_11230493 Ga0207676_112304932 153
457 3300026116 Ga0207674_10001627 Ga0207674_1000162712 153
458 3300026116 Ga0207674_10875127 Ga0207674_108751272 153
459 3300026142 Ga0207698_10055050 Ga0207698_100550502 153
460 3300026142 Ga0207698_11424328 Ga0207698_114243281 153
461 3300027111 Ga0209281_1000324 Ga0209281_10003242 153
462 3300028380 Ga0268265_10996082 Ga0268265_109960821 153
463 3300031251 Ga0265327_10199724 Ga0265327_101997242 153
464 3300031903 Ga0307407_10420820 Ga0307407_104208202 153
465 3300031995 Ga0307409_100219114 Ga0307409_1002191142 153
466 3300032002 Ga0307416_100320671 Ga0307416_1003206712 153
467 3300032005 Ga0307411_10175201 Ga0307411_101752012 153
468 3300032005 Ga0307411_10924255 Ga0307411_109242552 153
469 3300032126 Ga0307415_100320985 Ga0307415_1003209851 153
470 3300035083 Ga0373926_0093478 Ga0373926_0093478_201_668 153
471 3300035086 Ga0373934_0048093 Ga0373934_0048093_997_1488 153
472 3300035113 Ga0373936_0311626 Ga0373936_0311626_134_601 153
473 3300035116 Ga0373945_0008382 Ga0373945_0008382_2455_2946 153
474 3300035118 Ga0373954_0196545 Ga0373954_0196545_51_548 153
475 3300035119 Ga0373956_0166893 Ga0373956_0166893_66_533 153
476 3300035119 Ga0373956_0286356 Ga0373956_0286356_83_571 153
477 3300035170 Ga0373943_0012979 Ga0373943_0012979_1494_1985 153
478 3300035170 Ga0373943_0325360 Ga0373943_0325360_213_680 153
479 3300035171 Ga0373946_0009399 Ga0373946_0009399_449_940 153
480 3300035172 Ga0373955_0312615 Ga0373955_0312615_48_542 153
481 3300035410 Ga0373924_0105996 Ga0373924_0105996_594_1085 153
482 3300035692 Ga0373935_0037494 Ga0373935_0037494_772_1239 153
483 3300035692 Ga0373935_0056134 Ga0373935_0056134_414_905 153
484 3300035695 Ga0373927_0005984 Ga0373927_0005984_7606_8097 153
485 3300035695 Ga0373927_0009698 Ga0373927_0009698_5408_5899 153
486 3300035695 Ga0373927_0028338 Ga0373927_0028338_543_1031 153
487 3300035724 Ga0373933_0017385 Ga0373933_0017385_2970_3461 153
488 3300035724 Ga0373933_0074286 Ga0373933_0074286_1509_1976 153
489 3300035725 Ga0373947_0033045 Ga0373947_0033045_917_1408 153
490 3300035725 Ga0373947_0048648 Ga0373947_0048648_1399_1866 153
491 3300036401 Ga0373937_0003075 Ga0373937_0003075_10416_10883 153
492 3300036401 Ga0373937_0078048 Ga0373937_0078048_1263_1757 153
493 3300036401 Ga0373937_0165395 Ga0373937_0165395_1099_1587 153
494 3300036401 Ga0373937_0199727 Ga0373937_0199727_63_530 153
495 3300037068 Ga0373925_0003994 Ga0373925_0003994_2637_3128 153
496 3300037068 Ga0373925_0056322 Ga0373925_0056322_1339_1806 153
497 3300037068 Ga0373925_0129203 Ga0373925_0129203_488_979 153
498 3300037068 Ga0373925_0209906 Ga0373925_0209906_771_1265 153
499 3300037068 Ga0373925_0312046 Ga0373925_0312046_618_1106 153
500 3300037471 Ga0395905_0501238 Ga0395905_0501238_559_1050 153
501 3300037853 Ga0436364_0574873 Ga0436364_0574873_283_780 153
502 3300037853 Ga0436364_1015573 Ga0436364_1015573_907_1404 153
503 3300039437 Ga0436365_0311079 Ga0436365_0311079_2367_2864 153
504 3300039437 Ga0436365_1319488 Ga0436365_1319488_81_548 153
505 3300039438 Ga0436360_0795877 Ga0436360_0795877_382_879 153
506 3300039438 Ga0436360_0992847 Ga0436360_0992847_44_511 153
507 3300039450 Ga0436363_1619455 Ga0436363_1619455_106_603 153
508 3300039450 Ga0436363_1645645 Ga0436363_1645645_177_644 153
509 3300039450 Ga0436363_1675399 Ga0436363_1675399_869_1330 153
510 3300039453 Ga0436362_0537392 Ga0436362_0537392_833_1312 153
511 3300044694 Ga0466963_0851224 Ga0466963_0851224_32_523 153
512 3300045976 Ga0466967_0059922 Ga0466967_0059922_809_1303 153
513 3300045976 Ga0466967_0521453 Ga0466967_0521453_638_1138 153
514 3300046472 Ga0495580_0016368 Ga0495580_0016368_3730_4221 153
515 3300046473 Ga0495582_0020380 Ga0495582_0020380_2173_2664 153
516 3300046475 Ga0495639_0015557 Ga0495639_0015557_2142_2633 153
517 3300046476 Ga0495662_0071911 Ga0495662_0071911_90_581 153
518 3300046477 Ga0495664_0030267 Ga0495664_0030267_1476_1967 153
519 3300046516 Ga0495628_0011275 Ga0495628_0011275_2395_2886 153
520 3300046517 Ga0495630_0033906 Ga0495630_0033906_2583_3074 153
521 3300046518 Ga0495631_0204647 Ga0495631_0204647_230_724 153
522 3300046526 Ga0495666_0079889 Ga0495666_0079889_517_1008 153
523 3300046533 Ga0495640_0085240 Ga0495640_0085240_457_924 153
524 3300046535 Ga0495586_0258369 Ga0495586_0258369_219_710 153
525 3300046642 Ga0495634_0524963 Ga0495634_0524963_134_601 153
526 3300046663 Ga0495635_0019115 Ga0495635_0019115_969_1460 153
527 3300046679 Ga0495623_0327099 Ga0495623_0327099_316_810 153
528 3300046681 Ga0495647_0237382 Ga0495647_0237382_205_696 153
529 3300046681 Ga0495647_0259743 Ga0495647_0259743_170_637 153
530 3300046683 Ga0495658_0031211 Ga0495658_0031211_2009_2500 153
531 3300046689 Ga0495613_0154780 Ga0495613_0154780_210_701 153
532 3300046809 Ga0495600_0220729 Ga0495600_0220729_98_589 153
533 3300047315 Ga0495581_0006065 Ga0495581_0006065_818_1309 153
534 3300047319 Ga0495674_0266659 Ga0495674_0266659_110_601 153
535 3300047322 Ga0495680_0012839 Ga0495680_0012839_2073_2564 153
536 3300047472 Ga0495686_0094672 Ga0495686_0094672_66_554 153
537 3300048089 Ga0495614_0086829 Ga0495614_0086829_664_1155 153
538 3300048904 Ga0496101_0429276 Ga0496101_0429276_468_956 153
539 3300048905 Ga0496102_0547289 Ga0496102_0547289_554_1051 153
540 3300048907 Ga0496104_0001526 Ga0496104_0001526_10141_10608 153
541 3300048907 Ga0496104_0436526 Ga0496104_0436526_146_643 153
542 3300048908 Ga0496105_0073612 Ga0496105_0073612_2289_2780 153
543 3300048908 Ga0496105_0079070 Ga0496105_0079070_989_1456 153
544 3300048908 Ga0496105_0115538 Ga0496105_0115538_386_883 153
545 3300048909 Ga0496106_0238382 Ga0496106_0238382_549_1016 153
546 3300048911 Ga0496108_0182361 Ga0496108_0182361_82_579 153
547 3300048911 Ga0496108_0680046 Ga0496108_0680046_201_725 153
548 3300048915 Ga0496112_0098154 Ga0496112_0098154_1007_1504 153
549 3300048915 Ga0496112_0181197 Ga0496112_0181197_1456_1944 153
550 3300048915 Ga0496112_0483587 Ga0496112_0483587_373_870 153
551 3300048917 Ga0496114_0307949 Ga0496114_0307949_663_1160 153
552 3300048918 Ga0496115_0015930 Ga0496115_0015930_1809_2276 153
553 3300048918 Ga0496115_0237384 Ga0496115_0237384_171_668 153
554 3300048918 Ga0496115_0486662 Ga0496115_0486662_389_856 153
555 3300048919 Ga0496116_0172992 Ga0496116_0172992_199_693 153
556 3300048924 Ga0496121_0031042 Ga0496121_0031042_3528_4016 153
557 3300049568 Ga0501031_0560694 Ga0501031_0560694_83_565 153
558 3300049569 Ga0501032_0310493 Ga0501032_0310493_64_546 153
559 3300049570 Ga0501033_0490307 Ga0501033_0490307_282_764 153
560 3300049570 Ga0501033_0509181 Ga0501033_0509181_75_566 153
561 3300049571 Ga0501034_0105241 Ga0501034_0105241_970_1461 153
562 3300049574 Ga0501038_0093102 Ga0501038_0093102_927_1415 153
563 3300049574 Ga0501038_0453515 Ga0501038_0453515_172_654 153
564 3300049575 Ga0501039_0264476 Ga0501039_0264476_393_869 153
565 3300049579 Ga0501043_0855777 Ga0501043_0855777_28_510 153
566 3300049580 Ga0501046_0728709 Ga0501046_0728709_188_679 153
567 3300049581 Ga0501047_0151380 Ga0501047_0151380_250_741 153
568 3300049583 Ga0501067_0173423 Ga0501067_0173423_530_1030 153
569 3300049585 Ga0501069_0231066 Ga0501069_0231066_22_510 153
570 3300049586 Ga0501070_0304128 Ga0501070_0304128_25_522 153
571 3300049586 Ga0501070_1310448 Ga0501070_1310448_40_522 153
572 3300049588 Ga0501072_0001059 Ga0501072_0001059_14455_14922 153
573 3300049591 Ga0501075_0695584 Ga0501075_0695584_43_519 153
574 3300049669 Ga0501235_166668 Ga0501235_166668_19_507 153
575 3300049744 Ga0501083_0073347 Ga0501083_0073347_333_800 153
576 3300049744 Ga0501083_0274195 Ga0501083_0274195_81_548 153
577 3300049822 Ga0501035_0152748 Ga0501035_0152748_90_578 153
578 3300049823 Ga0501044_0160043 Ga0501044_0160043_1558_2046 153
579 3300050512 nmdc:mga0n895_306248_c1 nmdc:mga0n895_306248_c1_549_1037 153
580 3300050512 nmdc:mga0n895_490754_c1 nmdc:mga0n895_490754_c1_565_1032 153
581 3300050513 nmdc:mga0rr50_342646_c1 nmdc:mga0rr50_342646_c1_104_604 153
582 3300050513 nmdc:mga0rr50_441773_c1 nmdc:mga0rr50_441773_c1_556_1056 153
583 3300050516 nmdc:mga0sz30_259519_c1 nmdc:mga0sz30_259519_c1_117_608 153
584 3300053077 Ga0495601_0351988 Ga0495601_0351988_437_928 153
585 3300053085 Ga0495619_0060531 Ga0495619_0060531_602_1099 153
586 3300053119 Ga0500595_068233 Ga0500595_068233_262_729 153
587 3300054114 Ga0501084_0289500 Ga0501084_0289500_96_563 153
588 3300002705 JGI25156J39149_1000306 JGI25156J39149_10003063 154
589 3300003215 JGI25153J46596_10085527 JGI25153J46596_100855271 154
590 3300003756 Ga0055533_1000441 Ga0055533_100044116 154
591 3300005353 Ga0070669_100473671 Ga0070669_1004736712 154
592 3300005438 Ga0070701_10824116 Ga0070701_108241161 154
593 3300005981 Ga0081538_10170029 Ga0081538_101700292 154
594 3300006871 Ga0075434_102091910 Ga0075434_1020919101 154
595 3300013105 Ga0157369_11634767 Ga0157369_116347671 154
596 3300016635 Ga0183361_10006 Ga0183361_10006127 154
597 3300025226 Ga0209674_100137 Ga0209674_10013736 154
598 3300025256 Ga0209759_1000036 Ga0209759_1000036164 154
599 3300025294 Ga0209025_1053080 Ga0209025_10530801 154
600 3300025295 Ga0209564_1014636 Ga0209564_10146362 154
601 3300025297 Ga0209758_1000746 Ga0209758_100074614 154
602 3300025912 Ga0207707_10007083 Ga0207707_100070838 154
603 3300028381 Ga0268264_10109622 Ga0268264_101096221 154
604 3300039447 Ga0436361_0910631 Ga0436361_0910631_102_608 154
605 3300049572 Ga0501036_0688064 Ga0501036_0688064_124_621 154
606 3300049584 Ga0501068_0195352 Ga0501068_0195352_688_1185 154
607 3300049741 Ga0501079_0662622 Ga0501079_0662622_177_674 154
608 3300049742 Ga0501080_0337804 Ga0501080_0337804_97_594 154
609 3300049744 Ga0501083_0195336 Ga0501083_0195336_440_937 154
610 3300049822 Ga0501035_0083270 Ga0501035_0083270_271_768 154
611 3300049823 Ga0501044_0638892 Ga0501044_0638892_139_636 154
612 3300050512 nmdc:mga0n895_1635463_c1 nmdc:mga0n895_1635463_c1_88_570 154
613 3300053130 Ga0500642_0117652 Ga0500642_0117652_271_765 154
614 3300054114 Ga0501084_0125380 Ga0501084_0125380_344_841 154
615 3300061734 Ga0530510_0148966 Ga0530510_0148966_30_527 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

77

150

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

9

76

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9538 2 153
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9487 2 152
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9471 1 153
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9441 1 153
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9423 1 154
ID Description Score Start End Superfamily
1alo002 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9601 73 153 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.952 77 152 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9481 77 152 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9354 78 154 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9329 78 152 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A2I8EDS3-F1-model_v4 deleted 0.9894 1 154
AF-A0A370NBK9-F1-model_v4 (2Fe-2S)-binding protein 0.9849 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A537SQ24-F1-model_v4 (2Fe-2S)-binding protein 0.9845 1 152 GO:0016491
GO:0046872
GO:0051537
AF-I2IVS5-F1-model_v4 deleted 0.984 1 153
AF-A0A537JTT9-F1-model_v4 (2Fe-2S)-binding protein 0.9832 2 151 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
95.88 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map