F469414

General Info

Members Datasets Scaffolds Average Seq Length
615 226 1230 195

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100307112|Ga0070690_1003071122
Length 212
Sequence VRATADGQQHAVKLIAGLGNPGREYRDTRHNIGFMVLDEIARRHGLTFAMAPSQVPDAFVVKRFGAPNGGPPVLLAKPLTYMNRSGDAVSALARYYGIEPVDLLVVYDDIDLPFTKLRARARGSAGTHNGMRSVVERLGTLEFPRLRLGVGRGDSRRDLADHVLAKFEQDEQSDLEGFITRAADAAEMFAADGILKVMNVYNAEPADSADVN

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.35
Stem 0
Stem Tuber 0
Unclassified 17.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100307112 3300005330 Unclassified 1139
2 JGI24746J21847_1012615 3300001977 Unclassified 1236
3 JGI24751J29686_10064745 3300002459 Bacteria 753
4 JGI25406J46586_10002558 3300003203 Bacteria 8597
5 JGI25406J46586_10004887 3300003203 Bacteria 6229
6 Ga0058859_11254279 3300004798 Bacteria 1266
7 Ga0065714_10076672 3300005288 Unclassified 2766
8 Ga0065712_10003454 3300005290 Bacteria 5229
9 Ga0065712_10068756 3300005290 Bacteria 9137
10 Ga0065712_10069551 3300005290 Bacteria 7073
11 Ga0065715_10013671 3300005293 Unclassified 2245
12 Ga0065715_10118424 3300005293 Bacteria 2316
13 Ga0065715_10193376 3300005293 Bacteria 1402
14 Ga0065707_10258126 3300005295 Unclassified 1105
15 Ga0070676_10006086 3300005328 Bacteria 6441
16 Ga0070676_10222370 3300005328 Bacteria 1247
17 Ga0070690_100008734 3300005330 Bacteria 5847
18 Ga0070690_100010639 3300005330 Bacteria 5359
19 Ga0070670_100010366 3300005331 Bacteria 7954
20 Ga0070670_100028216 3300005331 Bacteria 4831
21 Ga0070670_100031102 3300005331 Unclassified 4597
22 Ga0070670_100158838 3300005331 Bacteria 1959
23 Ga0070670_100640753 3300005331 Bacteria 953
24 Ga0070677_10002190 3300005333 Bacteria 6244
25 Ga0070677_10353398 3300005333 Bacteria 762
26 Ga0068869_100001626 3300005334 Bacteria 13378
27 Ga0068869_100012728 3300005334 Bacteria 5564
28 Ga0070666_10004581 3300005335 Bacteria 8433
29 Ga0070666_10152563 3300005335 Bacteria 1612
30 Ga0070680_100179144 3300005336 Bacteria 1785
31 Ga0070680_100198182 3300005336 Bacteria 1693
32 Ga0070682_100237358 3300005337 Bacteria 1307
33 Ga0070682_100871852 3300005337 Bacteria 737
34 Ga0068868_100002019 3300005338 Bacteria 13955
35 Ga0068868_100324209 3300005338 Bacteria 1313
36 Ga0068868_100790941 3300005338 Bacteria 855
37 Ga0070689_100012908 3300005340 Bacteria 6032
38 Ga0070689_100013543 3300005340 Bacteria 5904
39 Ga0070689_100040765 3300005340 Bacteria 3561
40 Ga0070689_100623746 3300005340 Bacteria 936
41 Ga0070691_10155608 3300005341 Bacteria 1175
42 Ga0070691_10171031 3300005341 Bacteria 1126
43 Ga0070687_100003425 3300005343 Bacteria 6160
44 Ga0070687_100037603 3300005343 Unclassified 2421
45 Ga0070687_100112807 3300005343 Bacteria 1541
46 Ga0070661_100065786 3300005344 Unclassified 2664
47 Ga0070661_100101023 3300005344 Bacteria 2145
48 Ga0070661_100697787 3300005344 Bacteria 827
49 Ga0070692_10047670 3300005345 Bacteria 2218
50 Ga0070692_10118005 3300005345 Bacteria 1476
51 Ga0070692_10163554 3300005345 Bacteria 1277
52 Ga0070692_10315102 3300005345 Unclassified 960
53 Ga0070668_100045975 3300005347 Bacteria 3350
54 Ga0070668_100056981 3300005347 Unclassified 3019
55 Ga0070669_100000356 3300005353 Bacteria 35464
56 Ga0070669_100004793 3300005353 Bacteria 9763
57 Ga0070669_100066685 3300005353 Unclassified 2653
58 Ga0070669_100067973 3300005353 Unclassified 2629
59 Ga0070669_100085301 3300005353 Bacteria 2358
60 Ga0070669_100357282 3300005353 Unclassified 1187
61 Ga0070675_100000449 3300005354 Bacteria 28086
62 Ga0070675_100019250 3300005354 Bacteria 5438
63 Ga0070675_100038343 3300005354 Bacteria 3905
64 Ga0070675_100049584 3300005354 Bacteria 3446
65 Ga0070675_100059547 3300005354 Bacteria 3150
66 Ga0070675_100112373 3300005354 Bacteria 2307
67 Ga0070671_100684382 3300005355 Unclassified 889
68 Ga0070671_100733863 3300005355 Bacteria 858
69 Ga0070674_100000621 3300005356 Bacteria 17860
70 Ga0070674_100361906 3300005356 Bacteria 1175
71 Ga0070674_100474537 3300005356 Bacteria 1037
72 Ga0070673_100001452 3300005364 Bacteria 13877
73 Ga0070673_100010661 3300005364 Bacteria 6232
74 Ga0070673_100014054 3300005364 Bacteria 5560
75 Ga0070673_100056097 3300005364 Bacteria 3106
76 Ga0070673_101030882 3300005364 Bacteria 767
77 Ga0070688_100006830 3300005365 Bacteria 6122
78 Ga0070688_100011032 3300005365 Bacteria 5009
79 Ga0070688_100012005 3300005365 Bacteria 4839
80 Ga0070688_100032343 3300005365 Bacteria 3153
81 Ga0070688_100273606 3300005365 Unclassified 1211
82 Ga0070659_100039500 3300005366 Bacteria 3685
83 Ga0070659_100126941 3300005366 Bacteria 2070
84 Ga0070659_100154093 3300005366 Bacteria 1876
85 Ga0070667_100004998 3300005367 Bacteria 11107
86 Ga0070667_100217984 3300005367 Unclassified 1698
87 Ga0070703_10178787 3300005406 Bacteria 818
88 Ga0070701_10026968 3300005438 Unclassified 2809
89 Ga0070701_10050422 3300005438 Bacteria 2155
90 Ga0070701_10173330 3300005438 Bacteria 1258
91 Ga0070705_100000175 3300005440 Bacteria 37567
92 Ga0070705_100135449 3300005440 Bacteria 1613
93 Ga0070705_100273776 3300005440 Unclassified 1197
94 Ga0070700_100025384 3300005441 Bacteria 3488
95 Ga0070700_100043485 3300005441 Bacteria 2763
96 Ga0070700_100068669 3300005441 Bacteria 2254
97 Ga0070700_100125144 3300005441 Bacteria 1727
98 Ga0070694_100001956 3300005444 Bacteria 12226
99 Ga0070694_100070465 3300005444 Unclassified 2407
100 Ga0070708_100251307 3300005445 Bacteria 1661
101 Ga0070678_100043523 3300005456 Bacteria 3199
102 Ga0070678_100053708 3300005456 Bacteria 2932
103 Ga0070678_100501505 3300005456 Bacteria 1071
104 Ga0070662_100011793 3300005457 Bacteria 5774
105 Ga0070662_100279118 3300005457 Bacteria 1351
106 Ga0070662_100501132 3300005457 Bacteria 1013
107 Ga0070662_100740675 3300005457 Bacteria 833
108 Ga0070681_10003993 3300005458 Bacteria 13917
109 Ga0068867_100009195 3300005459 Bacteria 6975
110 Ga0068867_100055254 3300005459 Bacteria 2935
111 Ga0068867_100110944 3300005459 Bacteria 2107
112 Ga0068867_100208373 3300005459 Bacteria 1569
113 Ga0068867_100710813 3300005459 Bacteria 888
114 Ga0070685_10020692 3300005466 Bacteria 3563
115 Ga0070685_10075779 3300005466 Bacteria 2005
116 Ga0070685_10468147 3300005466 Unclassified 886
117 Ga0070685_10568093 3300005466 Unclassified 812
118 Ga0070707_100320975 3300005468 Bacteria 1505
119 Ga0070707_100857016 3300005468 Bacteria 873
120 Ga0070698_100015868 3300005471 Bacteria 7954
121 Ga0070698_100108866 3300005471 Bacteria 2738
122 Ga0070698_100513734 3300005471 Bacteria 1136
123 Ga0070698_100515769 3300005471 Unclassified 1134
124 Ga0070699_100031238 3300005518 Bacteria 4597
125 Ga0070699_100113679 3300005518 Bacteria 2378
126 Ga0070699_100125958 3300005518 Bacteria 2255
127 Ga0070679_100104432 3300005530 Bacteria 2820
128 Ga0070679_100842373 3300005530 Bacteria 860
129 Ga0070672_100105245 3300005543 Bacteria 2294
130 Ga0070672_100106471 3300005543 Unclassified 2281
131 Ga0070672_100298360 3300005543 Bacteria 1365
132 Ga0070672_100336469 3300005543 Unclassified 1285
133 Ga0070686_100007692 3300005544 Bacteria 6023
134 Ga0070686_100013945 3300005544 Bacteria 4616
135 Ga0070686_100046476 3300005544 Unclassified 2740
136 Ga0070695_100000031 3300005545 Bacteria 53175
137 Ga0070695_100115540 3300005545 Bacteria 1828
138 Ga0070695_100149620 3300005545 Bacteria 1628
139 Ga0070696_100000952 3300005546 Bacteria 18789
140 Ga0070696_100074389 3300005546 Bacteria 2395
141 Ga0070696_100838418 3300005546 Unclassified 759
142 Ga0070665_100026153 3300005548 Bacteria 5876
143 Ga0070704_100003614 3300005549 Bacteria 8887
144 Ga0070704_100260452 3300005549 Unclassified 1428
145 Ga0070664_100003339 3300005564 Bacteria 12971
146 Ga0070664_100056818 3300005564 Bacteria 3325
147 Ga0070664_100144967 3300005564 Bacteria 2093
148 Ga0070664_100289700 3300005564 Bacteria 1478
149 Ga0070664_100353360 3300005564 Bacteria 1337
150 Ga0070664_100817443 3300005564 Bacteria 872
151 Ga0068857_100100232 3300005577 Bacteria 2598
152 Ga0068857_100198061 3300005577 Bacteria 1830
153 Ga0068857_100214085 3300005577 Bacteria 1759
154 Ga0070702_100057282 3300005615 Bacteria 2254
155 Ga0068852_100055879 3300005616 Bacteria 3409
156 Ga0068852_100213213 3300005616 Bacteria 1833
157 Ga0068859_100003506 3300005617 Bacteria 15982
158 Ga0068859_100005089 3300005617 Bacteria 13360
159 Ga0068859_100012528 3300005617 Bacteria 8531
160 Ga0068859_100029319 3300005617 Bacteria 5522
161 Ga0068859_100067429 3300005617 Bacteria 3613
162 Ga0068859_100201160 3300005617 Unclassified 2077
163 Ga0068864_100016718 3300005618 Bacteria 6113
164 Ga0068864_100043635 3300005618 Bacteria 3839
165 Ga0068864_100059703 3300005618 Bacteria 3300
166 Ga0068864_100120195 3300005618 Bacteria 2348
167 Ga0068861_100008915 3300005719 Bacteria 6913
168 Ga0068861_100041726 3300005719 Bacteria 3437
169 Ga0068861_100124549 3300005719 Bacteria 2084
170 Ga0068861_100269043 3300005719 Bacteria 1463
171 Ga0068861_100296895 3300005719 Bacteria 1398
172 Ga0068870_10000638 3300005840 Bacteria 13364
173 Ga0068870_10001843 3300005840 Bacteria 8716
174 Ga0068870_10042814 3300005840 Bacteria 2359
175 Ga0068870_10052773 3300005840 Bacteria 2157
176 Ga0068870_10105447 3300005840 Bacteria 1601
177 Ga0068870_10312520 3300005840 Bacteria 996
178 Ga0068863_100116484 3300005841 Bacteria 2546
179 Ga0068863_100147893 3300005841 Unclassified 2248
180 Ga0068863_100517261 3300005841 Bacteria 1176
181 Ga0068858_100004942 3300005842 Bacteria 13061
182 Ga0068858_100142793 3300005842 Unclassified 2248
183 Ga0068858_100263167 3300005842 Bacteria 1640
184 Ga0068858_100881430 3300005842 Unclassified 875
185 Ga0068860_100022390 3300005843 Bacteria 6112
186 Ga0068860_100075114 3300005843 Bacteria 3215
187 Ga0068862_100000604 3300005844 Bacteria 37343
188 Ga0068862_100016252 3300005844 Bacteria 6193
189 Ga0068862_100146627 3300005844 Unclassified 2098
190 Ga0068862_100160769 3300005844 Bacteria 2005
191 Ga0068862_100435806 3300005844 Bacteria 1233
192 Ga0081539_10001302 3300005985 Bacteria 43747
193 Ga0081539_10001531 3300005985 Bacteria 38711
194 Ga0081539_10053997 3300005985 Bacteria 2246
195 Ga0097621_100227197 3300006237 Unclassified 1628
196 Ga0097621_100369391 3300006237 Unclassified 1279
197 Ga0097621_100451035 3300006237 Bacteria 1159
198 Ga0068871_100046192 3300006358 Bacteria 3507
199 Ga0068871_100618622 3300006358 Bacteria 986
200 Ga0068871_100849179 3300006358 Unclassified 844
201 Ga0075428_100004640 3300006844 Bacteria 15203
202 Ga0075428_100016351 3300006844 Bacteria 8199
203 Ga0075428_100069934 3300006844 Bacteria 3837
204 Ga0075428_100093902 3300006844 Bacteria 3271
205 Ga0075428_100123556 3300006844 Bacteria 2817
206 Ga0075428_100270262 3300006844 Bacteria 1829
207 Ga0075430_100001712 3300006846 Bacteria 17889
208 Ga0075430_100002487 3300006846 Bacteria 15354
209 Ga0075430_100008089 3300006846 Bacteria 8889
210 Ga0075430_100028865 3300006846 Bacteria 4710
211 Ga0075430_100286849 3300006846 Bacteria 1362
212 Ga0075430_100304539 3300006846 Bacteria 1318
213 Ga0075430_100315894 3300006846 Bacteria 1292
214 Ga0075431_100264256 3300006847 Bacteria 1746
215 Ga0075431_100299329 3300006847 Bacteria 1625
216 Ga0075431_100300315 3300006847 Bacteria 1622
217 Ga0075431_100801029 3300006847 Bacteria 915
218 Ga0075433_10049257 3300006852 Unclassified 3665
219 Ga0075433_10932632 3300006852 Bacteria 757
220 Ga0075434_100022785 3300006871 Bacteria 6099
221 Ga0075434_100052504 3300006871 Bacteria 4050
222 Ga0075434_100070659 3300006871 Bacteria 3482
223 Ga0075434_100285836 3300006871 Bacteria 1669
224 Ga0075434_100967512 3300006871 Bacteria 865
225 Ga0075429_100001850 3300006880 Bacteria 17532
226 Ga0075429_100052248 3300006880 Bacteria 3555
227 Ga0075429_100094544 3300006880 Bacteria 2606
228 Ga0075429_100204162 3300006880 Bacteria 1732
229 Ga0075429_100234745 3300006880 Bacteria 1606
230 Ga0075429_100430795 3300006880 Bacteria 1155
231 Ga0068865_100039758 3300006881 Bacteria 3192
232 Ga0068865_100303558 3300006881 Bacteria 1278
233 Ga0097620_100003506 3300006931 Bacteria 15982
234 Ga0097620_100005089 3300006931 Bacteria 13360
235 Ga0097620_100012527 3300006931 Bacteria 8531
236 Ga0097620_100029320 3300006931 Bacteria 5522
237 Ga0097620_100067428 3300006931 Bacteria 3613
238 Ga0097620_100201163 3300006931 Unclassified 2077
239 Ga0075435_100022720 3300007076 Bacteria 4841
240 Ga0075435_100095276 3300007076 Unclassified 2461
241 Ga0075435_100350387 3300007076 Bacteria 1266
242 Ga0111539_10001096 3300009094 Bacteria 35773
243 Ga0111539_10002763 3300009094 Bacteria 23280
244 Ga0111539_10036473 3300009094 Bacteria 5945
245 Ga0111539_10047738 3300009094 Bacteria 5117
246 Ga0111539_10083552 3300009094 Bacteria 3755
247 Ga0111539_10188834 3300009094 Bacteria 2405
248 Ga0111539_10344034 3300009094 Unclassified 1736
249 Ga0111539_10897336 3300009094 Bacteria 1031
250 Ga0105245_10256230 3300009098 Bacteria 1701
251 Ga0105247_10624063 3300009101 Unclassified 802
252 Ga0114129_10003000 3300009147 Bacteria 23643
253 Ga0114129_10010477 3300009147 Bacteria 13221
254 Ga0114129_10039657 3300009147 Bacteria 6640
255 Ga0114129_10057516 3300009147 Bacteria 5441
256 Ga0114129_10612245 3300009147 Bacteria 1410
257 Ga0114129_11552532 3300009147 Bacteria 812
258 Ga0105243_10281048 3300009148 Bacteria 1499
259 Ga0105243_11414540 3300009148 Bacteria 716
260 Ga0105242_10110044 3300009176 Bacteria 2346
261 Ga0105248_10102598 3300009177 Unclassified 3224
262 Ga0105248_10792720 3300009177 Unclassified 1069
263 Ga0105249_10003369 3300009553 Bacteria 13832
264 Ga0105249_10004066 3300009553 Bacteria 12617
265 Ga0105239_10676955 3300010375 Bacteria 1179
266 Ga0105246_10085652 3300011119 Unclassified 2257
267 Ga0105246_10259306 3300011119 Bacteria 1384
268 Ga0157370_10712869 3300013104 Bacteria 915
269 Ga0157378_10711114 3300013297 Unclassified 1025
270 Ga0157378_11492077 3300013297 Bacteria 720
271 Ga0163162_10009201 3300013306 Bacteria 9614
272 Ga0157375_10018460 3300013308 Bacteria 6326
273 Ga0157375_10387232 3300013308 Bacteria 1565
274 Ga0157375_12047979 3300013308 Unclassified 681
275 Ga0163163_10023433 3300014325 Bacteria 5860
276 Ga0157380_10120349 3300014326 Unclassified 2223
277 Ga0157380_10297349 3300014326 Bacteria 1485
278 Ga0157380_10353616 3300014326 Unclassified 1376
279 Ga0157380_10427828 3300014326 Bacteria 1265
280 Ga0157380_11630152 3300014326 Bacteria 701
281 Ga0157377_10006610 3300014745 Bacteria 5541
282 Ga0157377_10030800 3300014745 Bacteria 2910
283 Ga0157377_10068750 3300014745 Unclassified 2042
284 Ga0157377_10070073 3300014745 Bacteria 2025
285 Ga0157377_10099714 3300014745 Unclassified 1728
286 Ga0157379_10012186 3300014968 Bacteria 7511
287 Ga0157376_10047108 3300014969 Bacteria 3558
288 Ga0157376_10096981 3300014969 Unclassified 2567
289 Ga0163161_10025178 3300017792 Unclassified 4210
290 Ga0163161_10063984 3300017792 Unclassified 2682
291 Ga0163161_10188837 3300017792 Bacteria 1583
292 Ga0163161_10446325 3300017792 Bacteria 1045
293 Ga0207697_10010331 3300025315 Bacteria 3995
294 Ga0207697_10092859 3300025315 Bacteria 1280
295 Ga0207653_10011153 3300025885 Bacteria 2805
296 Ga0207682_10001536 3300025893 Bacteria 10611
297 Ga0207682_10253433 3300025893 Unclassified 820
298 Ga0207682_10288661 3300025893 Bacteria 768
299 Ga0207642_10468178 3300025899 Unclassified 766
300 Ga0207688_10025816 3300025901 Bacteria 3229
301 Ga0207688_10032760 3300025901 Bacteria 2873
302 Ga0207680_10080083 3300025903 Unclassified 2050
303 Ga0207680_10083249 3300025903 Unclassified 2016
304 Ga0207647_10364314 3300025904 Bacteria 817
305 Ga0207645_10004090 3300025907 Bacteria 10853
306 Ga0207645_10125643 3300025907 Bacteria 1667
307 Ga0207645_10170491 3300025907 Bacteria 1426
308 Ga0207643_10000421 3300025908 Bacteria 28011
309 Ga0207643_10002610 3300025908 Bacteria 9750
310 Ga0207643_10025731 3300025908 Bacteria 3255
311 Ga0207643_10029252 3300025908 Bacteria 3064
312 Ga0207643_10116295 3300025908 Bacteria 1580
313 Ga0207707_10017732 3300025912 Bacteria 6211
314 Ga0207660_10303286 3300025917 Bacteria 1272
315 Ga0207662_10020465 3300025918 Bacteria 3776
316 Ga0207662_10068397 3300025918 Bacteria 2145
317 Ga0207662_10188558 3300025918 Unclassified 1330
318 Ga0207649_10038891 3300025920 Bacteria 2882
319 Ga0207649_10123307 3300025920 Bacteria 1750
320 Ga0207646_10267142 3300025922 Unclassified 1546
321 Ga0207646_10275191 3300025922 Bacteria 1521
322 Ga0207681_10002621 3300025923 Bacteria 11400
323 Ga0207681_10008164 3300025923 Bacteria 6400
324 Ga0207681_10026028 3300025923 Bacteria 3770
325 Ga0207681_10062026 3300025923 Unclassified 2572
326 Ga0207681_10076803 3300025923 Unclassified 2346
327 Ga0207681_10145322 3300025923 Unclassified 1771
328 Ga0207681_10576072 3300025923 Bacteria 928
329 Ga0207650_10012745 3300025925 Bacteria 5807
330 Ga0207650_10018223 3300025925 Bacteria 4924
331 Ga0207650_10134168 3300025925 Bacteria 1940
332 Ga0207650_10167490 3300025925 Bacteria 1744
333 Ga0207650_10298314 3300025925 Bacteria 1316
334 Ga0207650_10315741 3300025925 Bacteria 1279
335 Ga0207659_10000377 3300025926 Bacteria 26919
336 Ga0207659_10006771 3300025926 Bacteria 7042
337 Ga0207659_10010855 3300025926 Bacteria 5736
338 Ga0207659_10012187 3300025926 Bacteria 5457
339 Ga0207659_10029685 3300025926 Bacteria 3729
340 Ga0207659_10035597 3300025926 Bacteria 3442
341 Ga0207659_10035868 3300025926 Bacteria 3431
342 Ga0207659_10057016 3300025926 Unclassified 2799
343 Ga0207659_10094126 3300025926 Unclassified 2244
344 Ga0207659_10504436 3300025926 Unclassified 1024
345 Ga0207644_10043233 3300025931 Bacteria 3196
346 Ga0207644_10077423 3300025931 Unclassified 2449
347 Ga0207690_10076017 3300025932 Unclassified 2331
348 Ga0207690_10428502 3300025932 Bacteria 1059
349 Ga0207690_10514305 3300025932 Bacteria 970
350 Ga0207690_10613243 3300025932 Unclassified 889
351 Ga0207706_10004179 3300025933 Bacteria 13594
352 Ga0207706_10037543 3300025933 Bacteria 4300
353 Ga0207706_10097099 3300025933 Unclassified 2591
354 Ga0207706_10105810 3300025933 Bacteria 2476
355 Ga0207706_10217474 3300025933 Bacteria 1674
356 Ga0207686_10114646 3300025934 Bacteria 1824
357 Ga0207686_10174062 3300025934 Bacteria 1520
358 Ga0207709_10040997 3300025935 Bacteria 2776
359 Ga0207709_10474682 3300025935 Unclassified 971
360 Ga0207670_10002195 3300025936 Bacteria 10203
361 Ga0207670_10026892 3300025936 Bacteria 3632
362 Ga0207670_10040035 3300025936 Bacteria 3074
363 Ga0207670_10073627 3300025936 Unclassified 2369
364 Ga0207670_10169628 3300025936 Bacteria 1635
365 Ga0207670_10756419 3300025936 Bacteria 807
366 Ga0207669_10000774 3300025937 Bacteria 13711
367 Ga0207669_10543823 3300025937 Bacteria 936
368 Ga0207704_10060606 3300025938 Unclassified 2342
369 Ga0207704_10342713 3300025938 Bacteria 1161
370 Ga0207704_10594497 3300025938 Bacteria 905
371 Ga0207691_10005425 3300025940 Bacteria 12310
372 Ga0207691_10044024 3300025940 Bacteria 4111
373 Ga0207691_10056891 3300025940 Bacteria 3561
374 Ga0207691_10076125 3300025940 Bacteria 3024
375 Ga0207691_10099621 3300025940 Bacteria 2594
376 Ga0207691_10110995 3300025940 Unclassified 2439
377 Ga0207691_10150655 3300025940 Bacteria 2045
378 Ga0207691_10247870 3300025940 Unclassified 1538
379 Ga0207691_10287822 3300025940 Bacteria 1413
380 Ga0207691_10437437 3300025940 Bacteria 1114
381 Ga0207711_10094368 3300025941 Unclassified 2636
382 Ga0207711_10129035 3300025941 Bacteria 2265
383 Ga0207689_10039906 3300025942 Bacteria 3886
384 Ga0207689_10046622 3300025942 Bacteria 3581
385 Ga0207689_10051282 3300025942 Bacteria 3401
386 Ga0207689_10256252 3300025942 Unclassified 1447
387 Ga0207679_10013257 3300025945 Bacteria 5402
388 Ga0207679_10016631 3300025945 Bacteria 4886
389 Ga0207679_10065695 3300025945 Bacteria 2716
390 Ga0207679_10341194 3300025945 Bacteria 1303
391 Ga0207679_10558388 3300025945 Bacteria 1028
392 Ga0207651_10004088 3300025960 Bacteria 7277
393 Ga0207651_10042760 3300025960 Unclassified 3018
394 Ga0207651_10045016 3300025960 Bacteria 2957
395 Ga0207651_10057383 3300025960 Bacteria 2685
396 Ga0207651_10097119 3300025960 Unclassified 2175
397 Ga0207651_10145303 3300025960 Bacteria 1838
398 Ga0207651_10204384 3300025960 Unclassified 1585
399 Ga0207651_10264298 3300025960 Bacteria 1414
400 Ga0207651_10409588 3300025960 Bacteria 1155
401 Ga0207712_10002623 3300025961 Bacteria 11519
402 Ga0207712_10020436 3300025961 Bacteria 4335
403 Ga0207668_10108517 3300025972 Bacteria 2078
404 Ga0207668_10239792 3300025972 Unclassified 1466
405 Ga0207640_10632251 3300025981 Bacteria 910
406 Ga0207658_10181741 3300025986 Bacteria 1741
407 Ga0207658_10245393 3300025986 Unclassified 1519
408 Ga0207677_10239248 3300026023 Bacteria 1467
409 Ga0207677_10631565 3300026023 Bacteria 943
410 Ga0207703_10010644 3300026035 Bacteria 7185
411 Ga0207703_10109772 3300026035 Unclassified 2352
412 Ga0207703_10530011 3300026035 Bacteria 1109
413 Ga0207703_10896580 3300026035 Unclassified 849
414 Ga0207678_10095342 3300026067 Bacteria 2543
415 Ga0207708_10002735 3300026075 Bacteria 12952
416 Ga0207708_10044171 3300026075 Bacteria 3395
417 Ga0207708_10058007 3300026075 Bacteria 2954
418 Ga0207708_10059874 3300026075 Bacteria 2907
419 Ga0207708_10211958 3300026075 Bacteria 1549
420 Ga0207708_10251862 3300026075 Unclassified 1423
421 Ga0207641_10015590 3300026088 Bacteria 6228
422 Ga0207648_10002107 3300026089 Bacteria 21670
423 Ga0207648_10025424 3300026089 Bacteria 5275
424 Ga0207648_10038178 3300026089 Bacteria 4227
425 Ga0207648_10162878 3300026089 Bacteria 1970
426 Ga0207676_10064177 3300026095 Bacteria 2919
427 Ga0207676_10084076 3300026095 Unclassified 2593
428 Ga0207676_10154312 3300026095 Bacteria 1981
429 Ga0207676_11009256 3300026095 Bacteria 820
430 Ga0207674_10160711 3300026116 Bacteria 2201
431 Ga0207674_10247616 3300026116 Unclassified 1729
432 Ga0207674_10279677 3300026116 Bacteria 1617
433 Ga0207674_10638705 3300026116 Bacteria 1028
434 Ga0207675_100000725 3300026118 Bacteria 32713
435 Ga0207675_100019646 3300026118 Bacteria 6306
436 Ga0207675_100050602 3300026118 Bacteria 3876
437 Ga0207675_100325770 3300026118 Bacteria 1501
438 Ga0207675_100347331 3300026118 Unclassified 1453
439 Ga0207675_100620505 3300026118 Bacteria 1086
440 Ga0207683_10045304 3300026121 Bacteria 3846
441 Ga0207683_10153210 3300026121 Bacteria 2081
442 Ga0207683_10235466 3300026121 Unclassified 1670
443 Ga0207698_10070747 3300026142 Unclassified 2766
444 Ga0209966_1048463 3300027695 Bacteria 899
445 Ga0207428_10000482 3300027907 Bacteria 48138
446 Ga0207428_10000515 3300027907 Bacteria 46261
447 Ga0207428_10001092 3300027907 Bacteria 29510
448 Ga0207428_10018539 3300027907 Bacteria 5942
449 Ga0207428_10086046 3300027907 Bacteria 2447
450 Ga0207428_10194528 3300027907 Bacteria 1528
451 Ga0207428_10334616 3300027907 Bacteria 1116
452 Ga0268266_10264984 3300028379 Unclassified 1593
453 Ga0268265_10000160 3300028380 Bacteria 81960
454 Ga0268265_10088644 3300028380 Unclassified 2465
455 Ga0268265_10167768 3300028380 Bacteria 1873
456 Ga0268265_10541930 3300028380 Bacteria 1103
457 Ga0268264_10025004 3300028381 Bacteria 4880
458 Ga0268264_10044873 3300028381 Bacteria 3668
459 Ga0268264_10260925 3300028381 Bacteria 1614
460 Ga0268264_10336719 3300028381 Bacteria 1432
461 Ga0268264_10773758 3300028381 Bacteria 958
462 Ga0307408_100100299 3300031548 Unclassified 2205
463 Ga0307405_10091546 3300031731 Bacteria 2015
464 Ga0307405_10269556 3300031731 Bacteria 1276
465 Ga0307413_10064431 3300031824 Bacteria 2277
466 Ga0307410_10480052 3300031852 Bacteria 1019
467 Ga0307410_10512143 3300031852 Unclassified 989
468 Ga0307412_10324736 3300031911 Bacteria 1226
469 Ga0307412_10523103 3300031911 Unclassified 991
470 Ga0307409_100038857 3300031995 Bacteria 3525
471 Ga0307409_100055192 3300031995 Bacteria 3065
472 Ga0307416_100020043 3300032002 Bacteria 4760
473 Ga0307411_10261751 3300032005 Bacteria 1366
474 Ga0307415_100568790 3300032126 Unclassified 1003
475 Ga0373940_0044634 3300035088 Unclassified 1228
476 Ga0373949_0012311 3300035090 Bacteria 1891
477 Ga0373960_0018520 3300035121 Bacteria 1817
478 Ga0373961_0059182 3300035241 Unclassified 1158
479 Ga0373931_0032885 3300035691 Bacteria 2686
480 Ga0373935_0255614 3300035692 Bacteria 1227
481 Ga0373933_0086531 3300035724 Bacteria 1929
482 Ga0373937_0116572 3300036401 Bacteria 2487
483 Ga0373925_0405277 3300037068 Bacteria 1113
484 Ga0439450_046236 3300042008 Bacteria 1023
485 Ga0439446_0104158 3300042156 Bacteria 900
486 Ga0439435_0003191 3300042436 Bacteria 3377
487 Ga0451577_0481251 3300042876 Bacteria 1127
488 Ga0451576_0006881 3300045051 Bacteria 13769
489 Ga0451576_0073885 3300045051 Bacteria 3548
490 Ga0451576_0112603 3300045051 Bacteria 2832
491 Ga0451576_0296314 3300045051 Bacteria 1691
492 Ga0451576_0738991 3300045051 Bacteria 1034
493 Ga0451576_1209678 3300045051 Bacteria 789
494 Ga0495580_0446197 3300046472 Unclassified 868
495 Ga0495584_0037034 3300046491 Bacteria 2464
496 Ga0495594_0006412 3300046499 Bacteria 6051
497 Ga0495594_0022373 3300046499 Bacteria 3381
498 Ga0495663_0036052 3300046525 Bacteria 1487
499 Ga0495663_0079382 3300046525 Unclassified 1055
500 Ga0495642_0096353 3300046528 Bacteria 1256
501 Ga0495654_0133783 3300046530 Bacteria 1111
502 Ga0495598_0056269 3300046537 Bacteria 1200
503 Ga0495598_0115176 3300046537 Bacteria 905
504 Ga0495609_0044099 3300046538 Bacteria 2001
505 Ga0495621_0003200 3300046539 Bacteria 4493
506 Ga0495621_0003425 3300046539 Bacteria 4383
507 Ga0495621_0256973 3300046539 Bacteria 715
508 Ga0495633_0142422 3300046558 Bacteria 1108
509 Ga0495633_0305283 3300046558 Bacteria 723
510 Ga0495656_0184143 3300046615 Bacteria 1028
511 Ga0495656_0235611 3300046615 Bacteria 920
512 Ga0495659_0011326 3300046664 Bacteria 2873
513 Ga0495659_0033004 3300046664 Bacteria 1815
514 Ga0495647_0098158 3300046681 Bacteria 1210
515 Ga0495647_0336234 3300046681 Bacteria 686
516 Ga0495658_0043744 3300046683 Bacteria 2507
517 Ga0495669_0315374 3300046684 Unclassified 754
518 Ga0495670_0086450 3300046691 Bacteria 1601
519 Ga0495670_0333297 3300046691 Bacteria 815
520 Ga0495671_0179425 3300046692 Unclassified 1029
521 Ga0495581_0250830 3300047315 Bacteria 1035
522 Ga0495636_0028495 3300047318 Bacteria 2278
523 Ga0495677_0060414 3300047445 Bacteria 1405
524 Ga0496109_0066944 3300048912 Bacteria 3290
525 Ga0496109_0514820 3300048912 Unclassified 1129
526 Ga0496113_0201450 3300048916 Bacteria 1582
527 Ga0501036_0381457 3300049572 Bacteria 1176
528 Ga0501038_0343801 3300049574 Bacteria 1163
529 Ga0501039_0060202 3300049575 Bacteria 2941
530 Ga0501039_0678932 3300049575 Bacteria 806
531 Ga0501040_0139475 3300049576 Bacteria 1707
532 Ga0501040_0245299 3300049576 Bacteria 1277
533 Ga0501041_0096987 3300049577 Bacteria 1823
534 Ga0501041_0100702 3300049577 Bacteria 1788
535 Ga0501042_0338612 3300049578 Bacteria 1087
536 Ga0501046_0120129 3300049580 Bacteria 2000
537 Ga0501048_0048914 3300049582 Unclassified 3015
538 Ga0501069_0351251 3300049585 Bacteria 869
539 Ga0501071_0071518 3300049587 Unclassified 2529
540 Ga0501072_0019925 3300049588 Bacteria 5192
541 Ga0501072_0027575 3300049588 Bacteria 4431
542 Ga0501073_0764933 3300049589 Bacteria 666
543 Ga0501075_0083250 3300049591 Bacteria 2423
544 Ga0501076_0007697 3300049592 Bacteria 7848
545 Ga0501076_0114977 3300049592 Unclassified 2177
546 Ga0501077_0046709 3300049593 Bacteria 2751
547 Ga0501079_0021013 3300049741 Bacteria 4990
548 Ga0501079_0049299 3300049741 Bacteria 3250
549 Ga0501080_0758533 3300049742 Unclassified 853
550 Ga0501081_0248746 3300049743 Unclassified 1297
551 Ga0501083_0240800 3300049744 Bacteria 1178
552 Ga0501270_057977 3300049767 Unclassified 719
553 Ga0501045_0025539 3300049824 Bacteria 4248
554 Ga0501045_0232023 3300049824 Bacteria 1374
555 Ga0501045_0236595 3300049824 Bacteria 1360
556 Ga0501045_0853994 3300049824 Bacteria 669
557 nmdc:mga05p37_232716_c1 3300050507 Bacteria 2219
558 nmdc:mga05p37_343762_c1 3300050507 Bacteria 1759
559 nmdc:mga05p37_81706_c1 3300050507 Bacteria 3981
560 nmdc:mga05p37_8826_c1 3300050507 Bacteria 11909
561 nmdc:mga09592_126177_c1 3300050508 Bacteria 2200
562 nmdc:mga09592_160001_c1 3300050508 Bacteria 1945
563 nmdc:mga09592_282778_c1 3300050508 Bacteria 1439
564 nmdc:mga09592_373790_c1 3300050508 Bacteria 1233
565 nmdc:mga09592_40697_c1 3300050508 Bacteria 3905
566 nmdc:mga09592_45979_c1 3300050508 Bacteria 3677
567 nmdc:mga09592_59367_c1 3300050508 Bacteria 3233
568 nmdc:mga0qj67_2637_c1 3300050509 Bacteria 12848
569 nmdc:mga0qj67_26655_c1 3300050509 Bacteria 4475
570 nmdc:mga0qj67_273054_c1 3300050509 Bacteria 1371
571 nmdc:mga0qj67_297491_c1 3300050509 Bacteria 1308
572 nmdc:mga0qj67_33100_c1 3300050509 Bacteria 4033
573 nmdc:mga0qj67_50667_c1 3300050509 Bacteria 3284
574 nmdc:mga06r32_280387_c1 3300050510 Bacteria 1654
575 nmdc:mga06r32_33192_c1 3300050510 Bacteria 4861
576 nmdc:mga06r32_47914_c1 3300050510 Bacteria 4084
577 nmdc:mga06r32_629936_c1 3300050510 Bacteria 1042
578 nmdc:mga06r32_85121_c1 3300050510 Bacteria 3083
579 nmdc:mga08y16_10061_c1 3300050511 Bacteria 9926
580 nmdc:mga08y16_104943_c1 3300050511 Bacteria 2942
581 nmdc:mga08y16_1323_c1 3300050511 Bacteria 24650
582 nmdc:mga08y16_14743_c1 3300050511 Bacteria 5320
583 nmdc:mga08y16_156363_c1 3300050511 Bacteria 2369
584 nmdc:mga08y16_217348_c1 3300050511 Bacteria 1979
585 nmdc:mga08y16_25255_c1 3300050511 Bacteria 6265
586 nmdc:mga08y16_254948_c1 3300050511 Unclassified 1813
587 nmdc:mga08y16_438572_c1 3300050511 Unclassified 1333
588 nmdc:mga08y16_71753_c1 3300050511 Bacteria 3608
589 nmdc:mga08y16_73846_c1 3300050511 Bacteria 3553
590 nmdc:mga08y16_87_c1 3300050511 Bacteria 77764
591 nmdc:mga0n895_192878_c1 3300050512 Bacteria 2068
592 nmdc:mga0n895_21825_c1 3300050512 Bacteria 5994
593 nmdc:mga0n895_229683_c1 3300050512 Bacteria 1884
594 nmdc:mga0n895_66742_c1 3300050512 Bacteria 3562
595 nmdc:mga0n895_78162_c1 3300050512 Bacteria 3293
596 nmdc:mga0rr50_19784_c1 3300050513 Bacteria 4554
597 nmdc:mga0rr50_521608_c1 3300050513 Bacteria 1011
598 nmdc:mga0rr50_86455_c1 3300050513 Bacteria 2432
599 nmdc:mga0a205_133988_c1 3300050515 Bacteria 2378
600 nmdc:mga0a205_30867_c1 3300050515 Bacteria 5133
601 nmdc:mga0a205_50617_c1 3300050515 Bacteria 4011
602 nmdc:mga0a205_522221_c1 3300050515 Unclassified 1044
603 nmdc:mga0a205_854824_c1 3300050515 Bacteria 757
604 Ga0501084_0291557 3300054114 Bacteria 1378
605 Ga0501084_0832309 3300054114 Bacteria 777
606 Ga0590071_001237 3300059421 Bacteria 6908
607 Ga0590071_008933 3300059421 Bacteria 2356
608 Ga0590074_001098 3300059423 Bacteria 4263
609 Ga0590075_000361 3300059424 Bacteria 12519
610 Ga0590075_002529 3300059424 Bacteria 4368
611 Ga0590077_002903 3300059426 Bacteria 3596
612 Ga0590077_003476 3300059426 Bacteria 3257
613 Ga0590077_033170 3300059426 Bacteria 1132
614 Ga0501082_0110889 3300060353 Bacteria 2374
615 Ga0501082_0191927 3300060353 Bacteria 1777
616 Ga0070690_100307112
617 JGI24746J21847_1012615
618 JGI24751J29686_10064745
619 JGI25406J46586_10002558
620 JGI25406J46586_10004887
621 Ga0058859_11254279
622 Ga0065714_10076672
623 Ga0065712_10003454
624 Ga0065712_10068756
625 Ga0065712_10069551
626 Ga0065715_10013671
627 Ga0065715_10118424
628 Ga0065715_10193376
629 Ga0065707_10258126
630 Ga0070676_10006086
631 Ga0070676_10222370
632 Ga0070690_100008734
633 Ga0070690_100010639
634 Ga0070670_100010366
635 Ga0070670_100028216
636 Ga0070670_100031102
637 Ga0070670_100158838
638 Ga0070670_100640753
639 Ga0070677_10002190
640 Ga0070677_10353398
641 Ga0068869_100001626
642 Ga0068869_100012728
643 Ga0070666_10004581
644 Ga0070666_10152563
645 Ga0070680_100179144
646 Ga0070680_100198182
647 Ga0070682_100237358
648 Ga0070682_100871852
649 Ga0068868_100002019
650 Ga0068868_100324209
651 Ga0068868_100790941
652 Ga0070689_100012908
653 Ga0070689_100013543
654 Ga0070689_100040765
655 Ga0070689_100623746
656 Ga0070691_10155608
657 Ga0070691_10171031
658 Ga0070687_100003425
659 Ga0070687_100037603
660 Ga0070687_100112807
661 Ga0070661_100065786
662 Ga0070661_100101023
663 Ga0070661_100697787
664 Ga0070692_10047670
665 Ga0070692_10118005
666 Ga0070692_10163554
667 Ga0070692_10315102
668 Ga0070668_100045975
669 Ga0070668_100056981
670 Ga0070669_100000356
671 Ga0070669_100004793
672 Ga0070669_100066685
673 Ga0070669_100067973
674 Ga0070669_100085301
675 Ga0070669_100357282
676 Ga0070675_100000449
677 Ga0070675_100019250
678 Ga0070675_100038343
679 Ga0070675_100049584
680 Ga0070675_100059547
681 Ga0070675_100112373
682 Ga0070671_100684382
683 Ga0070671_100733863
684 Ga0070674_100000621
685 Ga0070674_100361906
686 Ga0070674_100474537
687 Ga0070673_100001452
688 Ga0070673_100010661
689 Ga0070673_100014054
690 Ga0070673_100056097
691 Ga0070673_101030882
692 Ga0070688_100006830
693 Ga0070688_100011032
694 Ga0070688_100012005
695 Ga0070688_100032343
696 Ga0070688_100273606
697 Ga0070659_100039500
698 Ga0070659_100126941
699 Ga0070659_100154093
700 Ga0070667_100004998
701 Ga0070667_100217984
702 Ga0070703_10178787
703 Ga0070701_10026968
704 Ga0070701_10050422
705 Ga0070701_10173330
706 Ga0070705_100000175
707 Ga0070705_100135449
708 Ga0070705_100273776
709 Ga0070700_100025384
710 Ga0070700_100043485
711 Ga0070700_100068669
712 Ga0070700_100125144
713 Ga0070694_100001956
714 Ga0070694_100070465
715 Ga0070708_100251307
716 Ga0070678_100043523
717 Ga0070678_100053708
718 Ga0070678_100501505
719 Ga0070662_100011793
720 Ga0070662_100279118
721 Ga0070662_100501132
722 Ga0070662_100740675
723 Ga0070681_10003993
724 Ga0068867_100009195
725 Ga0068867_100055254
726 Ga0068867_100110944
727 Ga0068867_100208373
728 Ga0068867_100710813
729 Ga0070685_10020692
730 Ga0070685_10075779
731 Ga0070685_10468147
732 Ga0070685_10568093
733 Ga0070707_100320975
734 Ga0070707_100857016
735 Ga0070698_100015868
736 Ga0070698_100108866
737 Ga0070698_100513734
738 Ga0070698_100515769
739 Ga0070699_100031238
740 Ga0070699_100113679
741 Ga0070699_100125958
742 Ga0070679_100104432
743 Ga0070679_100842373
744 Ga0070672_100105245
745 Ga0070672_100106471
746 Ga0070672_100298360
747 Ga0070672_100336469
748 Ga0070686_100007692
749 Ga0070686_100013945
750 Ga0070686_100046476
751 Ga0070695_100000031
752 Ga0070695_100115540
753 Ga0070695_100149620
754 Ga0070696_100000952
755 Ga0070696_100074389
756 Ga0070696_100838418
757 Ga0070665_100026153
758 Ga0070704_100003614
759 Ga0070704_100260452
760 Ga0070664_100003339
761 Ga0070664_100056818
762 Ga0070664_100144967
763 Ga0070664_100289700
764 Ga0070664_100353360
765 Ga0070664_100817443
766 Ga0068857_100100232
767 Ga0068857_100198061
768 Ga0068857_100214085
769 Ga0070702_100057282
770 Ga0068852_100055879
771 Ga0068852_100213213
772 Ga0068859_100003506
773 Ga0068859_100005089
774 Ga0068859_100012528
775 Ga0068859_100029319
776 Ga0068859_100067429
777 Ga0068859_100201160
778 Ga0068864_100016718
779 Ga0068864_100043635
780 Ga0068864_100059703
781 Ga0068864_100120195
782 Ga0068861_100008915
783 Ga0068861_100041726
784 Ga0068861_100124549
785 Ga0068861_100269043
786 Ga0068861_100296895
787 Ga0068870_10000638
788 Ga0068870_10001843
789 Ga0068870_10042814
790 Ga0068870_10052773
791 Ga0068870_10105447
792 Ga0068870_10312520
793 Ga0068863_100116484
794 Ga0068863_100147893
795 Ga0068863_100517261
796 Ga0068858_100004942
797 Ga0068858_100142793
798 Ga0068858_100263167
799 Ga0068858_100881430
800 Ga0068860_100022390
801 Ga0068860_100075114
802 Ga0068862_100000604
803 Ga0068862_100016252
804 Ga0068862_100146627
805 Ga0068862_100160769
806 Ga0068862_100435806
807 Ga0081539_10001302
808 Ga0081539_10001531
809 Ga0081539_10053997
810 Ga0097621_100227197
811 Ga0097621_100369391
812 Ga0097621_100451035
813 Ga0068871_100046192
814 Ga0068871_100618622
815 Ga0068871_100849179
816 Ga0075428_100004640
817 Ga0075428_100016351
818 Ga0075428_100069934
819 Ga0075428_100093902
820 Ga0075428_100123556
821 Ga0075428_100270262
822 Ga0075430_100001712
823 Ga0075430_100002487
824 Ga0075430_100008089
825 Ga0075430_100028865
826 Ga0075430_100286849
827 Ga0075430_100304539
828 Ga0075430_100315894
829 Ga0075431_100264256
830 Ga0075431_100299329
831 Ga0075431_100300315
832 Ga0075431_100801029
833 Ga0075433_10049257
834 Ga0075433_10932632
835 Ga0075434_100022785
836 Ga0075434_100052504
837 Ga0075434_100070659
838 Ga0075434_100285836
839 Ga0075434_100967512
840 Ga0075429_100001850
841 Ga0075429_100052248
842 Ga0075429_100094544
843 Ga0075429_100204162
844 Ga0075429_100234745
845 Ga0075429_100430795
846 Ga0068865_100039758
847 Ga0068865_100303558
848 Ga0097620_100003506
849 Ga0097620_100005089
850 Ga0097620_100012527
851 Ga0097620_100029320
852 Ga0097620_100067428
853 Ga0097620_100201163
854 Ga0075435_100022720
855 Ga0075435_100095276
856 Ga0075435_100350387
857 Ga0111539_10001096
858 Ga0111539_10002763
859 Ga0111539_10036473
860 Ga0111539_10047738
861 Ga0111539_10083552
862 Ga0111539_10188834
863 Ga0111539_10344034
864 Ga0111539_10897336
865 Ga0105245_10256230
866 Ga0105247_10624063
867 Ga0114129_10003000
868 Ga0114129_10010477
869 Ga0114129_10039657
870 Ga0114129_10057516
871 Ga0114129_10612245
872 Ga0114129_11552532
873 Ga0105243_10281048
874 Ga0105243_11414540
875 Ga0105242_10110044
876 Ga0105248_10102598
877 Ga0105248_10792720
878 Ga0105249_10003369
879 Ga0105249_10004066
880 Ga0105239_10676955
881 Ga0105246_10085652
882 Ga0105246_10259306
883 Ga0157370_10712869
884 Ga0157378_10711114
885 Ga0157378_11492077
886 Ga0163162_10009201
887 Ga0157375_10018460
888 Ga0157375_10387232
889 Ga0157375_12047979
890 Ga0163163_10023433
891 Ga0157380_10120349
892 Ga0157380_10297349
893 Ga0157380_10353616
894 Ga0157380_10427828
895 Ga0157380_11630152
896 Ga0157377_10006610
897 Ga0157377_10030800
898 Ga0157377_10068750
899 Ga0157377_10070073
900 Ga0157377_10099714
901 Ga0157379_10012186
902 Ga0157376_10047108
903 Ga0157376_10096981
904 Ga0163161_10025178
905 Ga0163161_10063984
906 Ga0163161_10188837
907 Ga0163161_10446325
908 Ga0207697_10010331
909 Ga0207697_10092859
910 Ga0207653_10011153
911 Ga0207682_10001536
912 Ga0207682_10253433
913 Ga0207682_10288661
914 Ga0207642_10468178
915 Ga0207688_10025816
916 Ga0207688_10032760
917 Ga0207680_10080083
918 Ga0207680_10083249
919 Ga0207647_10364314
920 Ga0207645_10004090
921 Ga0207645_10125643
922 Ga0207645_10170491
923 Ga0207643_10000421
924 Ga0207643_10002610
925 Ga0207643_10025731
926 Ga0207643_10029252
927 Ga0207643_10116295
928 Ga0207707_10017732
929 Ga0207660_10303286
930 Ga0207662_10020465
931 Ga0207662_10068397
932 Ga0207662_10188558
933 Ga0207649_10038891
934 Ga0207649_10123307
935 Ga0207646_10267142
936 Ga0207646_10275191
937 Ga0207681_10002621
938 Ga0207681_10008164
939 Ga0207681_10026028
940 Ga0207681_10062026
941 Ga0207681_10076803
942 Ga0207681_10145322
943 Ga0207681_10576072
944 Ga0207650_10012745
945 Ga0207650_10018223
946 Ga0207650_10134168
947 Ga0207650_10167490
948 Ga0207650_10298314
949 Ga0207650_10315741
950 Ga0207659_10000377
951 Ga0207659_10006771
952 Ga0207659_10010855
953 Ga0207659_10012187
954 Ga0207659_10029685
955 Ga0207659_10035597
956 Ga0207659_10035868
957 Ga0207659_10057016
958 Ga0207659_10094126
959 Ga0207659_10504436
960 Ga0207644_10043233
961 Ga0207644_10077423
962 Ga0207690_10076017
963 Ga0207690_10428502
964 Ga0207690_10514305
965 Ga0207690_10613243
966 Ga0207706_10004179
967 Ga0207706_10037543
968 Ga0207706_10097099
969 Ga0207706_10105810
970 Ga0207706_10217474
971 Ga0207686_10114646
972 Ga0207686_10174062
973 Ga0207709_10040997
974 Ga0207709_10474682
975 Ga0207670_10002195
976 Ga0207670_10026892
977 Ga0207670_10040035
978 Ga0207670_10073627
979 Ga0207670_10169628
980 Ga0207670_10756419
981 Ga0207669_10000774
982 Ga0207669_10543823
983 Ga0207704_10060606
984 Ga0207704_10342713
985 Ga0207704_10594497
986 Ga0207691_10005425
987 Ga0207691_10044024
988 Ga0207691_10056891
989 Ga0207691_10076125
990 Ga0207691_10099621
991 Ga0207691_10110995
992 Ga0207691_10150655
993 Ga0207691_10247870
994 Ga0207691_10287822
995 Ga0207691_10437437
996 Ga0207711_10094368
997 Ga0207711_10129035
998 Ga0207689_10039906
999 Ga0207689_10046622
1000 Ga0207689_10051282
1001 Ga0207689_10256252
1002 Ga0207679_10013257
1003 Ga0207679_10016631
1004 Ga0207679_10065695
1005 Ga0207679_10341194
1006 Ga0207679_10558388
1007 Ga0207651_10004088
1008 Ga0207651_10042760
1009 Ga0207651_10045016
1010 Ga0207651_10057383
1011 Ga0207651_10097119
1012 Ga0207651_10145303
1013 Ga0207651_10204384
1014 Ga0207651_10264298
1015 Ga0207651_10409588
1016 Ga0207712_10002623
1017 Ga0207712_10020436
1018 Ga0207668_10108517
1019 Ga0207668_10239792
1020 Ga0207640_10632251
1021 Ga0207658_10181741
1022 Ga0207658_10245393
1023 Ga0207677_10239248
1024 Ga0207677_10631565
1025 Ga0207703_10010644
1026 Ga0207703_10109772
1027 Ga0207703_10530011
1028 Ga0207703_10896580
1029 Ga0207678_10095342
1030 Ga0207708_10002735
1031 Ga0207708_10044171
1032 Ga0207708_10058007
1033 Ga0207708_10059874
1034 Ga0207708_10211958
1035 Ga0207708_10251862
1036 Ga0207641_10015590
1037 Ga0207648_10002107
1038 Ga0207648_10025424
1039 Ga0207648_10038178
1040 Ga0207648_10162878
1041 Ga0207676_10064177
1042 Ga0207676_10084076
1043 Ga0207676_10154312
1044 Ga0207676_11009256
1045 Ga0207674_10160711
1046 Ga0207674_10247616
1047 Ga0207674_10279677
1048 Ga0207674_10638705
1049 Ga0207675_100000725
1050 Ga0207675_100019646
1051 Ga0207675_100050602
1052 Ga0207675_100325770
1053 Ga0207675_100347331
1054 Ga0207675_100620505
1055 Ga0207683_10045304
1056 Ga0207683_10153210
1057 Ga0207683_10235466
1058 Ga0207698_10070747
1059 Ga0209966_1048463
1060 Ga0207428_10000482
1061 Ga0207428_10000515
1062 Ga0207428_10001092
1063 Ga0207428_10018539
1064 Ga0207428_10086046
1065 Ga0207428_10194528
1066 Ga0207428_10334616
1067 Ga0268266_10264984
1068 Ga0268265_10000160
1069 Ga0268265_10088644
1070 Ga0268265_10167768
1071 Ga0268265_10541930
1072 Ga0268264_10025004
1073 Ga0268264_10044873
1074 Ga0268264_10260925
1075 Ga0268264_10336719
1076 Ga0268264_10773758
1077 Ga0307408_100100299
1078 Ga0307405_10091546
1079 Ga0307405_10269556
1080 Ga0307413_10064431
1081 Ga0307410_10480052
1082 Ga0307410_10512143
1083 Ga0307412_10324736
1084 Ga0307412_10523103
1085 Ga0307409_100038857
1086 Ga0307409_100055192
1087 Ga0307416_100020043
1088 Ga0307411_10261751
1089 Ga0307415_100568790
1090 Ga0373940_0044634
1091 Ga0373949_0012311
1092 Ga0373960_0018520
1093 Ga0373961_0059182
1094 Ga0373931_0032885
1095 Ga0373935_0255614
1096 Ga0373933_0086531
1097 Ga0373937_0116572
1098 Ga0373925_0405277
1099 Ga0439450_046236
1100 Ga0439446_0104158
1101 Ga0439435_0003191
1102 Ga0451577_0481251
1103 Ga0451576_0006881
1104 Ga0451576_0073885
1105 Ga0451576_0112603
1106 Ga0451576_0296314
1107 Ga0451576_0738991
1108 Ga0451576_1209678
1109 Ga0495580_0446197
1110 Ga0495584_0037034
1111 Ga0495594_0006412
1112 Ga0495594_0022373
1113 Ga0495663_0036052
1114 Ga0495663_0079382
1115 Ga0495642_0096353
1116 Ga0495654_0133783
1117 Ga0495598_0056269
1118 Ga0495598_0115176
1119 Ga0495609_0044099
1120 Ga0495621_0003200
1121 Ga0495621_0003425
1122 Ga0495621_0256973
1123 Ga0495633_0142422
1124 Ga0495633_0305283
1125 Ga0495656_0184143
1126 Ga0495656_0235611
1127 Ga0495659_0011326
1128 Ga0495659_0033004
1129 Ga0495647_0098158
1130 Ga0495647_0336234
1131 Ga0495658_0043744
1132 Ga0495669_0315374
1133 Ga0495670_0086450
1134 Ga0495670_0333297
1135 Ga0495671_0179425
1136 Ga0495581_0250830
1137 Ga0495636_0028495
1138 Ga0495677_0060414
1139 Ga0496109_0066944
1140 Ga0496109_0514820
1141 Ga0496113_0201450
1142 Ga0501036_0381457
1143 Ga0501038_0343801
1144 Ga0501039_0060202
1145 Ga0501039_0678932
1146 Ga0501040_0139475
1147 Ga0501040_0245299
1148 Ga0501041_0096987
1149 Ga0501041_0100702
1150 Ga0501042_0338612
1151 Ga0501046_0120129
1152 Ga0501048_0048914
1153 Ga0501069_0351251
1154 Ga0501071_0071518
1155 Ga0501072_0019925
1156 Ga0501072_0027575
1157 Ga0501073_0764933
1158 Ga0501075_0083250
1159 Ga0501076_0007697
1160 Ga0501076_0114977
1161 Ga0501077_0046709
1162 Ga0501079_0021013
1163 Ga0501079_0049299
1164 Ga0501080_0758533
1165 Ga0501081_0248746
1166 Ga0501083_0240800
1167 Ga0501270_057977
1168 Ga0501045_0025539
1169 Ga0501045_0232023
1170 Ga0501045_0236595
1171 Ga0501045_0853994
1172 nmdc:mga05p37_232716_c1
1173 nmdc:mga05p37_343762_c1
1174 nmdc:mga05p37_81706_c1
1175 nmdc:mga05p37_8826_c1
1176 nmdc:mga09592_126177_c1
1177 nmdc:mga09592_160001_c1
1178 nmdc:mga09592_282778_c1
1179 nmdc:mga09592_373790_c1
1180 nmdc:mga09592_40697_c1
1181 nmdc:mga09592_45979_c1
1182 nmdc:mga09592_59367_c1
1183 nmdc:mga0qj67_2637_c1
1184 nmdc:mga0qj67_26655_c1
1185 nmdc:mga0qj67_273054_c1
1186 nmdc:mga0qj67_297491_c1
1187 nmdc:mga0qj67_33100_c1
1188 nmdc:mga0qj67_50667_c1
1189 nmdc:mga06r32_280387_c1
1190 nmdc:mga06r32_33192_c1
1191 nmdc:mga06r32_47914_c1
1192 nmdc:mga06r32_629936_c1
1193 nmdc:mga06r32_85121_c1
1194 nmdc:mga08y16_10061_c1
1195 nmdc:mga08y16_104943_c1
1196 nmdc:mga08y16_1323_c1
1197 nmdc:mga08y16_14743_c1
1198 nmdc:mga08y16_156363_c1
1199 nmdc:mga08y16_217348_c1
1200 nmdc:mga08y16_25255_c1
1201 nmdc:mga08y16_254948_c1
1202 nmdc:mga08y16_438572_c1
1203 nmdc:mga08y16_71753_c1
1204 nmdc:mga08y16_73846_c1
1205 nmdc:mga08y16_87_c1
1206 nmdc:mga0n895_192878_c1
1207 nmdc:mga0n895_21825_c1
1208 nmdc:mga0n895_229683_c1
1209 nmdc:mga0n895_66742_c1
1210 nmdc:mga0n895_78162_c1
1211 nmdc:mga0rr50_19784_c1
1212 nmdc:mga0rr50_521608_c1
1213 nmdc:mga0rr50_86455_c1
1214 nmdc:mga0a205_133988_c1
1215 nmdc:mga0a205_30867_c1
1216 nmdc:mga0a205_50617_c1
1217 nmdc:mga0a205_522221_c1
1218 nmdc:mga0a205_854824_c1
1219 Ga0501084_0291557
1220 Ga0501084_0832309
1221 Ga0590071_001237
1222 Ga0590071_008933
1223 Ga0590074_001098
1224 Ga0590075_000361
1225 Ga0590075_002529
1226 Ga0590077_002903
1227 Ga0590077_003476
1228 Ga0590077_033170
1229 Ga0501082_0110889
1230 Ga0501082_0191927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

14

202

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9237 2 178
4yly-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9195 1 189
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9188 2 189
4qt4-assembly2.cif.gz_B crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, streptococcus pyogenes at 2.19 angstrom resolution shows the closed structure of the substrate binding cleft 0.9175 2 188
5zx8-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from thermus thermophilus 0.9093 1 187
ID Description Score Start End Superfamily
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9195 1 189 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9176 2 188 3.40.50.1470
5zx8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9093 1 187 3.40.50.1470
af_Q10LI6_46_183_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9053 2 135 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9038 2 188 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A093RUA7-F1-model_v4 Putative peptidyl-tRNA hydrolase 0.9546 47 137 GO:0004045
AF-A0A1W9RTH7-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9544 2 187 GO:0004045
GO:0005737
GO:0006412
AF-A0A356IZ24-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9544 2 140 GO:0004045
AF-A0A7X6X285-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9535 1 140 GO:0004045
AF-A0A1B1Q1B4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9532 1 187 GO:0004045
GO:0005737
GO:0006412

Map