F469403

General Info

Members Datasets Scaffolds Average Seq Length
614 338 596 163

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2751185725|2753035381
Length 189
Sequence LIMAADCVGITVAATLSARSCTHEHECMTVTDEYLDNNRAYAADFSGPLPLPPSKHVAVVACMDARLNIYGILGLEDGEAHVIRNAGGVITDDEIRSLAISQRLLGTTEIILIHHTDCGMLTFTDDDFKRAIQDEVGVKPAWSAEAFSDLDEDVRQSLARIEKSPFITKTTSLRGFVFDVATGKLNEVS

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2643221692 Nocardia sp. Root136 Isolate Unclassified
5 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
6 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
7 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
8 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
11 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
12 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
13 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
14 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
15 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
16 2922554459 Rhodococcus sp. 66b Isolate Unclassified
17 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
197 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
198 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
201 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
202 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
203 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
222 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
223 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
245 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
246 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
247 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
295 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
317 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
318 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
319 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
320 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
336 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.46
Metatranscriptomes 2.61
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 7.98
Rhizosphere 84.53
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10064511 3300002075 Bacteria 754
2 JGI24033J26618_1027155 3300002155 Bacteria 757
3 JGI24751J29686_10003840 3300002459 Bacteria 3032
4 JGI25406J46586_10002057 3300003203 Bacteria 9500
5 JGI25407J50210_10001230 3300003373 Bacteria 5719
6 JGI25405J52794_10019198 3300003911 Bacteria 1369
7 Ga0070658_10024804 3300005327 Bacteria 4809
8 Ga0070658_10191274 3300005327 Bacteria 1725
9 Ga0070658_10641174 3300005327 Bacteria 921
10 Ga0070676_10052877 3300005328 Bacteria 2390
11 Ga0070683_100000645 3300005329 Bacteria 25129
12 Ga0070683_100008181 3300005329 Bacteria 8885
13 Ga0070683_101001103 3300005329 Bacteria 802
14 Ga0070683_101008147 3300005329 Bacteria 799
15 Ga0070690_100791185 3300005330 Bacteria 735
16 Ga0070670_101794019 3300005331 Bacteria 565
17 Ga0068869_100013076 3300005334 Bacteria 5508
18 Ga0068869_100013296 3300005334 Bacteria 5471
19 Ga0068869_100257909 3300005334 Bacteria 1395
20 Ga0070666_10317715 3300005335 Bacteria 1111
21 Ga0070680_100065730 3300005336 Bacteria 2972
22 Ga0070682_100007182 3300005337 Bacteria 6274
23 Ga0070682_100007928 3300005337 Bacteria 5974
24 Ga0070682_100216067 3300005337 Bacteria 1362
25 Ga0068868_100016666 3300005338 Bacteria 5463
26 Ga0068868_100055286 3300005338 Bacteria 3131
27 Ga0070660_100032361 3300005339 Bacteria 3934
28 Ga0070660_100102593 3300005339 Bacteria 2267
29 Ga0070689_100064431 3300005340 Bacteria 2853
30 Ga0070691_10045552 3300005341 Bacteria 2082
31 Ga0070691_10477458 3300005341 Bacteria 717
32 Ga0070661_100012025 3300005344 Bacteria 6047
33 Ga0070692_10118059 3300005345 Bacteria 1475
34 Ga0070668_100358589 3300005347 Bacteria 1236
35 Ga0070675_100074866 3300005354 Bacteria 2814
36 Ga0070675_100079377 3300005354 Bacteria 2734
37 Ga0070675_100336247 3300005354 Bacteria 1337
38 Ga0070671_100000635 3300005355 Bacteria 25088
39 Ga0070671_100097460 3300005355 Bacteria 2466
40 Ga0070674_100622438 3300005356 Bacteria 915
41 Ga0070673_100099907 3300005364 Bacteria 2388
42 Ga0070673_100351819 3300005364 Bacteria 1308
43 Ga0070688_100033036 3300005365 Bacteria 3125
44 Ga0070659_100078634 3300005366 Bacteria 2631
45 Ga0070667_100358745 3300005367 Bacteria 1321
46 Ga0070709_10041051 3300005434 Bacteria 2848
47 Ga0070709_10083245 3300005434 Bacteria 2092
48 Ga0070714_100061206 3300005435 Bacteria 3233
49 Ga0070714_101642811 3300005435 Bacteria 628
50 Ga0070713_100002466 3300005436 Bacteria 12073
51 Ga0070710_10070565 3300005437 Bacteria 2012
52 Ga0070710_10182468 3300005437 Bacteria 1315
53 Ga0070711_100046256 3300005439 Bacteria 2964
54 Ga0070711_100463541 3300005439 Bacteria 1039
55 Ga0070705_100178902 3300005440 Bacteria 1435
56 Ga0070700_100008738 3300005441 Bacteria 5528
57 Ga0070700_100032739 3300005441 Bacteria 3127
58 Ga0070708_100111783 3300005445 Bacteria 2511
59 Ga0070663_100059236 3300005455 Bacteria 2752
60 Ga0070663_100144532 3300005455 Bacteria 1819
61 Ga0070678_100016305 3300005456 Bacteria 4751
62 Ga0070678_100017872 3300005456 Bacteria 4579
63 Ga0070662_100171939 3300005457 Bacteria 1702
64 Ga0070681_10004229 3300005458 Bacteria 13603
65 Ga0070685_10168581 3300005466 Bacteria 1402
66 Ga0070706_100003943 3300005467 Bacteria 14457
67 Ga0070706_100008907 3300005467 Bacteria 9345
68 Ga0070706_100674069 3300005467 Bacteria 959
69 Ga0070707_100124620 3300005468 Bacteria 2502
70 Ga0070707_100423405 3300005468 Bacteria 1292
71 Ga0070698_100007953 3300005471 Bacteria 11471
72 Ga0070679_100009544 3300005530 Bacteria 9179
73 Ga0070679_100415050 3300005530 Bacteria 1292
74 Ga0070679_100501004 3300005530 Bacteria 1158
75 Ga0070679_100657368 3300005530 Bacteria 991
76 Ga0070684_100003617 3300005535 Bacteria 11636
77 Ga0070684_100046824 3300005535 Bacteria 3747
78 Ga0070684_100616036 3300005535 Bacteria 1010
79 Ga0070697_101430015 3300005536 Bacteria 618
80 Ga0068853_100103857 3300005539 Bacteria 2516
81 Ga0068853_100977342 3300005539 Bacteria 815
82 Ga0070686_100447943 3300005544 Bacteria 992
83 Ga0070695_100545892 3300005545 Bacteria 903
84 Ga0070693_100003642 3300005547 Bacteria 7202
85 Ga0070665_100079122 3300005548 Bacteria 3293
86 Ga0070665_100109040 3300005548 Bacteria 2771
87 Ga0070664_100003373 3300005564 Bacteria 12904
88 Ga0070664_100004267 3300005564 Bacteria 11491
89 Ga0070664_100653340 3300005564 Bacteria 977
90 Ga0068857_100113374 3300005577 Bacteria 2437
91 Ga0068857_100635847 3300005577 Bacteria 1010
92 Ga0068854_100112119 3300005578 Bacteria 2059
93 Ga0068854_100425001 3300005578 Bacteria 1104
94 Ga0068856_100005907 3300005614 Bacteria 12057
95 Ga0068856_100014656 3300005614 Bacteria 7570
96 Ga0068856_100022369 3300005614 Bacteria 6145
97 Ga0068856_100099071 3300005614 Bacteria 2905
98 Ga0068856_100587025 3300005614 Bacteria 1135
99 Ga0068856_101305631 3300005614 Bacteria 741
100 Ga0070702_100011239 3300005615 Bacteria 4447
101 Ga0070702_100076891 3300005615 Bacteria 1988
102 Ga0070702_100749298 3300005615 Bacteria 750
103 Ga0068852_100043957 3300005616 Bacteria 3791
104 Ga0068859_101673156 3300005617 Bacteria 703
105 Ga0068864_100033409 3300005618 Bacteria 4373
106 Ga0068864_100075568 3300005618 Bacteria 2942
107 Ga0068864_100153856 3300005618 Bacteria 2086
108 Ga0068866_10148215 3300005718 Bacteria 1356
109 Ga0068851_10519524 3300005834 Bacteria 716
110 Ga0068870_10005633 3300005840 Bacteria 5478
111 Ga0068863_100045066 3300005841 Bacteria 4185
112 Ga0068863_100045100 3300005841 Bacteria 4184
113 Ga0068863_100567240 3300005841 Bacteria 1122
114 Ga0068858_100021168 3300005842 Bacteria 6072
115 Ga0068858_100810391 3300005842 Bacteria 914
116 Ga0068860_100467415 3300005843 Bacteria 1256
117 Ga0068860_102095375 3300005843 Bacteria 587
118 Ga0081455_10000112 3300005937 Bacteria 92158
119 Ga0081538_10001711 3300005981 Bacteria 22362
120 Ga0081539_10000417 3300005985 Bacteria 90642
121 Ga0070717_10062409 3300006028 Bacteria 3090
122 Ga0070717_10305605 3300006028 Bacteria 1414
123 Ga0070717_10528098 3300006028 Bacteria 1068
124 Ga0070717_11202188 3300006028 Bacteria 690
125 Ga0075365_10032360 3300006038 Bacteria 3361
126 Ga0075363_100020237 3300006048 Bacteria 3335
127 Ga0075363_100231665 3300006048 Bacteria 1060
128 Ga0075364_10236582 3300006051 Bacteria 1240
129 Ga0075432_10075403 3300006058 Bacteria 1216
130 Ga0070715_10159448 3300006163 Bacteria 1113
131 Ga0070712_100065485 3300006175 Bacteria 2579
132 Ga0070712_100306531 3300006175 Bacteria 1287
133 Ga0075367_10087339 3300006178 Bacteria 1894
134 Ga0075367_10531029 3300006178 Bacteria 747
135 Ga0075369_10049567 3300006186 Bacteria 1814
136 Ga0097621_100044452 3300006237 Bacteria 3583
137 Ga0075370_10110482 3300006353 Bacteria 1596
138 Ga0075370_10382380 3300006353 Bacteria 843
139 Ga0068871_100034451 3300006358 Bacteria 4018
140 Ga0068871_100101384 3300006358 Bacteria 2413
141 Ga0075428_100855611 3300006844 Bacteria 965
142 Ga0075431_100534283 3300006847 Bacteria 1161
143 Ga0075433_10034214 3300006852 Bacteria 4362
144 Ga0075433_10257675 3300006852 Bacteria 1547
145 Ga0075434_101584206 3300006871 Bacteria 664
146 Ga0068865_100052661 3300006881 Bacteria 2822
147 Ga0075436_100004718 3300006914 Bacteria 9350
148 Ga0097620_101673132 3300006931 Bacteria 703
149 Ga0075435_100481069 3300007076 Bacteria 1072
150 Ga0111539_10185986 3300009094 Bacteria 2426
151 Ga0105245_10004181 3300009098 Bacteria 12821
152 Ga0105245_10024376 3300009098 Bacteria 5312
153 Ga0105245_10883605 3300009098 Bacteria 935
154 Ga0114129_10678678 3300009147 Bacteria 1327
155 Ga0114129_12041070 3300009147 Bacteria 693
156 Ga0105243_10348262 3300009148 Bacteria 1359
157 Ga0105241_10091554 3300009174 Bacteria 2400
158 Ga0105241_10440076 3300009174 Bacteria 1151
159 Ga0105248_10112801 3300009177 Bacteria 3066
160 Ga0105248_10188794 3300009177 Bacteria 2322
161 Ga0105248_11240191 3300009177 Bacteria 843
162 Ga0105237_10142080 3300009545 Bacteria 2395
163 Ga0105237_10247018 3300009545 Bacteria 1786
164 Ga0105237_10316468 3300009545 Bacteria 1564
165 Ga0105238_10143677 3300009551 Bacteria 2363
166 Ga0105238_10150719 3300009551 Bacteria 2301
167 Ga0105238_11119585 3300009551 Bacteria 810
168 Ga0105239_10051102 3300010375 Bacteria 4532
169 Ga0105239_10124927 3300010375 Bacteria 2859
170 Ga0105239_10265692 3300010375 Bacteria 1929
171 Ga0105239_10339748 3300010375 Bacteria 1694
172 Ga0105239_10839214 3300010375 Bacteria 1053
173 Ga0105246_10004760 3300011119 Bacteria 8265
174 Ga0105246_10007691 3300011119 Bacteria 6614
175 Ga0157313_1011581 3300012503 Bacteria 769
176 Ga0157373_10029646 3300013100 Bacteria 3940
177 Ga0157373_10177090 3300013100 Bacteria 1501
178 Ga0157371_10080858 3300013102 Bacteria 2301
179 Ga0157371_10099868 3300013102 Bacteria 2058
180 Ga0157370_10059246 3300013104 Bacteria 3639
181 Ga0157370_10167821 3300013104 Bacteria 2041
182 Ga0157370_10271781 3300013104 Bacteria 1566
183 Ga0157369_10029298 3300013105 Bacteria 6085
184 Ga0157369_10074949 3300013105 Bacteria 3628
185 Ga0157369_10120886 3300013105 Bacteria 2779
186 Ga0157369_10352452 3300013105 Bacteria 1528
187 Ga0157369_10567396 3300013105 Bacteria 1172
188 Ga0157369_10573477 3300013105 Bacteria 1165
189 Ga0157369_10910826 3300013105 Bacteria 902
190 Ga0157374_10007098 3300013296 Bacteria 9536
191 Ga0157374_10030772 3300013296 Bacteria 4875
192 Ga0157374_10097991 3300013296 Bacteria 2806
193 Ga0157374_10780301 3300013296 Bacteria 971
194 Ga0157378_10268853 3300013297 Bacteria 1639
195 Ga0163162_10216950 3300013306 Bacteria 2043
196 Ga0157372_10007491 3300013307 Bacteria 11606
197 Ga0157372_10012336 3300013307 Bacteria 9107
198 Ga0157372_10058337 3300013307 Bacteria 4314
199 Ga0157372_10061049 3300013307 Bacteria 4220
200 Ga0157375_10017301 3300013308 Bacteria 6503
201 Ga0157375_10041386 3300013308 Bacteria 4449
202 Ga0157375_10292475 3300013308 Bacteria 1792
203 Ga0163163_10024547 3300014325 Bacteria 5738
204 Ga0163163_10165552 3300014325 Bacteria 2257
205 Ga0163163_10562139 3300014325 Bacteria 1203
206 Ga0163163_10830422 3300014325 Bacteria 987
207 Ga0157380_10057796 3300014326 Bacteria 3090
208 Ga0182008_10082452 3300014497 Bacteria 1583
209 Ga0157377_10000822 3300014745 Bacteria 12885
210 Ga0157377_10003853 3300014745 Bacteria 6827
211 Ga0157377_10004097 3300014745 Bacteria 6657
212 Ga0157379_10028595 3300014968 Bacteria 4958
213 Ga0157379_10126152 3300014968 Bacteria 2303
214 Ga0157379_10477852 3300014968 Bacteria 1153
215 Ga0157376_10025716 3300014969 Bacteria 4639
216 Ga0157376_10044482 3300014969 Bacteria 3650
217 Ga0157376_10190061 3300014969 Bacteria 1882
218 Ga0157376_12061311 3300014969 Bacteria 608
219 Ga0163161_10056268 3300017792 Bacteria 2857
220 Ga0163161_11696552 3300017792 Bacteria 559
221 Ga0197907_11109537 3300020069 Bacteria 1202
222 Ga0206356_10615563 3300020070 Bacteria 827
223 Ga0206356_11021213 3300020070 Bacteria 887
224 Ga0206349_1672554 3300020075 Bacteria 787
225 Ga0206349_1791822 3300020075 Bacteria 956
226 Ga0206349_1905463 3300020075 Bacteria 561
227 Ga0206352_10509604 3300020078 Bacteria 626
228 Ga0206354_11531839 3300020081 Bacteria 640
229 Ga0206353_11048529 3300020082 Bacteria 636
230 Ga0206353_11064492 3300020082 Bacteria 1500
231 Ga0206353_11722789 3300020082 Bacteria 756
232 Ga0213875_10001884 3300021388 Bacteria 12993
233 Ga0224712_10040877 3300022467 Bacteria 1747
234 Ga0224712_10199793 3300022467 Bacteria 908
235 Ga0224712_10339153 3300022467 Bacteria 709
236 Ga0224712_10345686 3300022467 Bacteria 702
237 Ga0207656_10124637 3300025321 Bacteria 1202
238 Ga0207692_10052050 3300025898 Bacteria 2079
239 Ga0207692_10067245 3300025898 Bacteria 1875
240 Ga0207692_10117212 3300025898 Bacteria 1486
241 Ga0207688_10000691 3300025901 Bacteria 16661
242 Ga0207688_10414636 3300025901 Bacteria 836
243 Ga0207647_10071749 3300025904 Bacteria 2089
244 Ga0207647_10206504 3300025904 Bacteria 1135
245 Ga0207699_10040121 3300025906 Bacteria 2696
246 Ga0207699_10064303 3300025906 Bacteria 2219
247 Ga0207645_10258558 3300025907 Bacteria 1153
248 Ga0207643_10000039 3300025908 Bacteria 86154
249 Ga0207705_10039796 3300025909 Bacteria 3369
250 Ga0207705_10327046 3300025909 Bacteria 1178
251 Ga0207705_10570056 3300025909 Bacteria 880
252 Ga0207705_10867313 3300025909 Bacteria 700
253 Ga0207684_10002293 3300025910 Bacteria 19463
254 Ga0207684_10268814 3300025910 Bacteria 1471
255 Ga0207684_10285072 3300025910 Bacteria 1424
256 Ga0207654_10007978 3300025911 Bacteria 5338
257 Ga0207707_10205762 3300025912 Bacteria 1715
258 Ga0207671_10217023 3300025914 Bacteria 1498
259 Ga0207693_10022527 3300025915 Bacteria 5006
260 Ga0207693_10037089 3300025915 Bacteria 3841
261 Ga0207693_10090274 3300025915 Bacteria 2402
262 Ga0207693_10106583 3300025915 Bacteria 2199
263 Ga0207693_10145393 3300025915 Bacteria 1864
264 Ga0207663_10359961 3300025916 Bacteria 1104
265 Ga0207660_10031660 3300025917 Bacteria 3645
266 Ga0207657_10022954 3300025919 Bacteria 5822
267 Ga0207657_10054199 3300025919 Bacteria 3469
268 Ga0207657_10066688 3300025919 Bacteria 3063
269 Ga0207649_10127350 3300025920 Bacteria 1725
270 Ga0207649_10362972 3300025920 Bacteria 1075
271 Ga0207652_10081687 3300025921 Bacteria 2827
272 Ga0207652_10387601 3300025921 Bacteria 1261
273 Ga0207652_10397810 3300025921 Bacteria 1243
274 Ga0207646_10027431 3300025922 Bacteria 5193
275 Ga0207646_10509724 3300025922 Bacteria 1083
276 Ga0207694_10412817 3300025924 Bacteria 1124
277 Ga0207650_10021059 3300025925 Bacteria 4606
278 Ga0207650_11464015 3300025925 Bacteria 581
279 Ga0207659_10039209 3300025926 Bacteria 3302
280 Ga0207659_10488354 3300025926 Bacteria 1041
281 Ga0207687_10093558 3300025927 Bacteria 2198
282 Ga0207687_10115745 3300025927 Bacteria 1998
283 Ga0207687_10201867 3300025927 Bacteria 1555
284 Ga0207700_10039306 3300025928 Bacteria 3443
285 Ga0207664_10133982 3300025929 Bacteria 2088
286 Ga0207664_10224969 3300025929 Bacteria 1629
287 Ga0207664_11207215 3300025929 Bacteria 674
288 Ga0207644_10031153 3300025931 Bacteria 3714
289 Ga0207644_10096153 3300025931 Bacteria 2216
290 Ga0207690_10071828 3300025932 Bacteria 2388
291 Ga0207709_10032271 3300025935 Bacteria 3065
292 Ga0207709_10149513 3300025935 Bacteria 1616
293 Ga0207709_10216463 3300025935 Bacteria 1378
294 Ga0207670_10009525 3300025936 Bacteria 5546
295 Ga0207669_10149399 3300025937 Bacteria 1634
296 Ga0207691_10836918 3300025940 Bacteria 772
297 Ga0207711_10044758 3300025941 Bacteria 3780
298 Ga0207711_10146655 3300025941 Bacteria 2127
299 Ga0207711_10417079 3300025941 Bacteria 1248
300 Ga0207689_10004582 3300025942 Bacteria 12514
301 Ga0207689_10040643 3300025942 Bacteria 3849
302 Ga0207661_10000277 3300025944 Bacteria 32727
303 Ga0207661_10056730 3300025944 Bacteria 3145
304 Ga0207661_10075267 3300025944 Bacteria 2769
305 Ga0207661_10220673 3300025944 Bacteria 1675
306 Ga0207661_10267456 3300025944 Bacteria 1525
307 Ga0207679_10022595 3300025945 Bacteria 4285
308 Ga0207679_11034076 3300025945 Bacteria 753
309 Ga0207712_10136107 3300025961 Bacteria 1879
310 Ga0207640_10027186 3300025981 Bacteria 3483
311 Ga0207640_10102043 3300025981 Bacteria 2014
312 Ga0207658_10299078 3300025986 Bacteria 1386
313 Ga0207677_10038846 3300026023 Bacteria 3124
314 Ga0207677_10370233 3300026023 Bacteria 1206
315 Ga0207703_10056001 3300026035 Bacteria 3209
316 Ga0207703_10425696 3300026035 Bacteria 1236
317 Ga0207703_10429769 3300026035 Bacteria 1230
318 Ga0207703_11686984 3300026035 Bacteria 609
319 Ga0207639_10102241 3300026041 Bacteria 2319
320 Ga0207678_10001338 3300026067 Bacteria 22707
321 Ga0207678_10053507 3300026067 Bacteria 3478
322 Ga0207708_10001612 3300026075 Bacteria 16825
323 Ga0207708_10043866 3300026075 Bacteria 3408
324 Ga0207702_10003837 3300026078 Bacteria 13562
325 Ga0207702_10040119 3300026078 Bacteria 3924
326 Ga0207702_10059280 3300026078 Bacteria 3260
327 Ga0207702_10223973 3300026078 Bacteria 1754
328 Ga0207702_10283693 3300026078 Bacteria 1566
329 Ga0207702_10941630 3300026078 Bacteria 856
330 Ga0207641_10058565 3300026088 Bacteria 3279
331 Ga0207641_10118247 3300026088 Bacteria 2361
332 Ga0207641_10152581 3300026088 Bacteria 2093
333 Ga0207648_10187483 3300026089 Bacteria 1832
334 Ga0207676_10018388 3300026095 Bacteria 5080
335 Ga0207676_10177361 3300026095 Bacteria 1862
336 Ga0207674_10061677 3300026116 Bacteria 3788
337 Ga0207674_10078182 3300026116 Bacteria 3314
338 Ga0207674_10398887 3300026116 Bacteria 1329
339 Ga0207674_10758245 3300026116 Bacteria 937
340 Ga0207674_11039366 3300026116 Bacteria 788
341 Ga0207683_10036359 3300026121 Bacteria 4288
342 Ga0207683_10391261 3300026121 Bacteria 1278
343 Ga0207698_10055350 3300026142 Bacteria 3057
344 Ga0207698_10118684 3300026142 Bacteria 2234
345 Ga0207428_10014004 3300027907 Bacteria 6985
346 Ga0268266_10202511 3300028379 Bacteria 1817
347 Ga0268266_10573509 3300028379 Bacteria 1082
348 Ga0268264_10063293 3300028381 Bacteria 3109
349 Ga0268264_10410038 3300028381 Bacteria 1304
350 Ga0265337_1005578 3300028556 Bacteria 4978
351 Ga0265326_10009317 3300028558 Bacteria 2934
352 Ga0265319_1016937 3300028563 Bacteria 2784
353 Ga0265334_10001541 3300028573 Bacteria 11128
354 Ga0265318_10115913 3300028577 Bacteria 984
355 Ga0265323_10022009 3300028653 Bacteria 2438
356 Ga0265322_10015885 3300028654 Bacteria 2173
357 Ga0265336_10019609 3300028666 Bacteria 2180
358 Ga0307515_10054619 3300028794 Bacteria 5859
359 Ga0265338_10054489 3300028800 Bacteria 3565
360 Ga0265338_10098405 3300028800 Bacteria 2393
361 Ga0265338_10107380 3300028800 Bacteria 2257
362 Ga0265324_10023583 3300029957 Bacteria 2191
363 Ga0265332_10020522 3300031238 Bacteria 2916
364 Ga0265320_10028769 3300031240 Bacteria 2882
365 Ga0265325_10051086 3300031241 Bacteria 2126
366 Ga0265340_10008327 3300031247 Bacteria 5602
367 Ga0265339_10018443 3300031249 Bacteria 4113
368 Ga0265316_10108575 3300031344 Bacteria 2103
369 Ga0307513_10002569 3300031456 Bacteria 25080
370 Ga0307509_10265069 3300031507 Bacteria 1490
371 Ga0307509_10498324 3300031507 Bacteria 903
372 Ga0307508_10141722 3300031616 Bacteria 2008
373 Ga0316575_10000001 3300031665 Bacteria 151281
374 Ga0265314_10003585 3300031711 Bacteria 14949
375 Ga0265342_10002630 3300031712 Bacteria 15363
376 Ga0307410_10321987 3300031852 Bacteria 1227
377 Ga0307416_100296216 3300032002 Bacteria 1605
378 Ga0316214_1013213 3300033545 Bacteria 1130
379 Ga0316212_1002673 3300033547 Bacteria 2545
380 Ga0316216_1007766 3300033548 Bacteria 808
381 Ga0373926_0004623 3300035083 Bacteria 4521
382 Ga0373944_0026988 3300035089 Bacteria 1700
383 Ga0373923_0394520 3300035111 Bacteria 665
384 Ga0373945_0059918 3300035116 Bacteria 1418
385 Ga0373945_0199939 3300035116 Bacteria 829
386 Ga0373954_0045894 3300035118 Bacteria 2042
387 Ga0373954_0053334 3300035118 Bacteria 1901
388 Ga0373954_0070231 3300035118 Bacteria 1664
389 Ga0373956_0078521 3300035119 Bacteria 1512
390 Ga0373943_0011580 3300035170 Bacteria 3970
391 Ga0373943_0134004 3300035170 Bacteria 1328
392 Ga0373946_0066247 3300035171 Bacteria 1548
393 Ga0373955_0139767 3300035172 Bacteria 1419
394 Ga0373924_0041898 3300035410 Bacteria 1877
395 Ga0373931_0303866 3300035691 Bacteria 986
396 Ga0373935_0000373 3300035692 Bacteria 22971
397 Ga0373935_0166276 3300035692 Bacteria 1506
398 Ga0373935_0665407 3300035692 Bacteria 764
399 Ga0373927_0113197 3300035695 Bacteria 1768
400 Ga0373933_0075850 3300035724 Bacteria 2053
401 Ga0373933_0969795 3300035724 Bacteria 560
402 Ga0373947_0000007 3300035725 Bacteria 192259
403 Ga0373947_0015886 3300035725 Bacteria 4323
404 Ga0373947_0198598 3300035725 Bacteria 1311
405 Ga0373947_1026277 3300035725 Bacteria 562
406 Ga0373937_0011172 3300036401 Bacteria 7871
407 Ga0373937_0165210 3300036401 Bacteria 2075
408 Ga0373937_0255360 3300036401 Bacteria 1652
409 Ga0373937_0541307 3300036401 Bacteria 1106
410 Ga0372808_053776 3300036459 Bacteria 577
411 Ga0373925_0002082 3300037068 Bacteria 16451
412 Ga0373925_0025135 3300037068 Bacteria 4349
413 Ga0395898_0119822 3300037466 Bacteria 2521
414 Ga0436364_0183141 3300037853 Bacteria 23094
415 Ga0451800_1285469 3300041459 Bacteria 710
416 Ga0450902_016473 3300042137 Bacteria 1205
417 Ga0439458_0045826 3300042157 Bacteria 1070
418 Ga0439459_0048730 3300042438 Bacteria 923
419 Ga0466966_0416913 3300044684 Bacteria 807
420 Ga0466961_0079250 3300044693 Bacteria 2080
421 Ga0466963_0120627 3300044694 Bacteria 1804
422 Ga0466963_0398797 3300044694 Bacteria 970
423 Ga0466971_0162254 3300044719 Bacteria 1046
424 Ga0466968_0030687 3300044735 Bacteria 2228
425 Ga0466960_0022426 3300044901 Bacteria 2823
426 Ga0466958_0040795 3300045836 Bacteria 2790
427 Ga0466958_0305781 3300045836 Bacteria 1021
428 Ga0466958_0474518 3300045836 Bacteria 811
429 Ga0466958_0578341 3300045836 Bacteria 730
430 Ga0466958_0771375 3300045836 Bacteria 627
431 Ga0466967_0074046 3300045976 Bacteria 3057
432 Ga0466967_0118190 3300045976 Bacteria 2445
433 Ga0466967_0409182 3300045976 Bacteria 1321
434 Ga0466967_0940552 3300045976 Bacteria 860
435 Ga0495592_0166421 3300046454 Bacteria 1513
436 Ga0495603_0097156 3300046455 Bacteria 1720
437 Ga0495603_0257194 3300046455 Bacteria 1005
438 Ga0495629_0007464 3300046459 Bacteria 8056
439 Ga0495641_0013609 3300046461 Bacteria 4457
440 Ga0495641_0025197 3300046461 Bacteria 2921
441 Ga0495653_0004538 3300046463 Bacteria 11222
442 Ga0495580_0047205 3300046472 Bacteria 3053
443 Ga0495582_0006325 3300046473 Bacteria 6585
444 Ga0495582_0424310 3300046473 Bacteria 767
445 Ga0495639_0003200 3300046475 Bacteria 7113
446 Ga0495664_0335399 3300046477 Bacteria 911
447 Ga0495594_0013348 3300046499 Bacteria 4288
448 Ga0495608_0013885 3300046511 Bacteria 5591
449 Ga0495608_0377958 3300046511 Bacteria 869
450 Ga0495618_0008168 3300046514 Bacteria 6341
451 Ga0495618_0083083 3300046514 Bacteria 2046
452 Ga0495628_0177033 3300046516 Bacteria 1615
453 Ga0495628_0223520 3300046516 Bacteria 1413
454 Ga0495630_0025918 3300046517 Bacteria 4338
455 Ga0495630_0060562 3300046517 Bacteria 2841
456 Ga0495630_0371399 3300046517 Bacteria 1095
457 Ga0495630_1228883 3300046517 Bacteria 566
458 Ga0495666_0023955 3300046526 Bacteria 3019
459 Ga0495666_0129169 3300046526 Bacteria 1181
460 Ga0495652_0156633 3300046529 Bacteria 1773
461 Ga0495652_0182782 3300046529 Bacteria 1607
462 Ga0495652_0241795 3300046529 Bacteria 1342
463 Ga0495665_0068005 3300046531 Bacteria 1878
464 Ga0495640_0039620 3300046533 Bacteria 3304
465 Ga0495640_0044601 3300046533 Bacteria 3082
466 Ga0495586_0063868 3300046535 Bacteria 2006
467 Ga0495586_0121114 3300046535 Bacteria 1462
468 Ga0495587_0088942 3300046536 Bacteria 1785
469 Ga0495587_0678325 3300046536 Bacteria 565
470 Ga0495667_0001764 3300046559 Bacteria 14367
471 Ga0495668_0000455 3300046616 Bacteria 52372
472 Ga0495634_0023344 3300046642 Bacteria 4349
473 Ga0495634_0137722 3300046642 Bacteria 1552
474 Ga0495634_0185279 3300046642 Bacteria 1301
475 Ga0495635_0104224 3300046663 Bacteria 1938
476 Ga0495588_0017724 3300046674 Bacteria 3463
477 Ga0495588_0072996 3300046674 Bacteria 1786
478 Ga0495657_0002947 3300046675 Bacteria 14105
479 Ga0495646_0117664 3300046680 Bacteria 1506
480 Ga0495646_0154220 3300046680 Bacteria 1275
481 Ga0495646_0506797 3300046680 Bacteria 619
482 Ga0495647_0013112 3300046681 Bacteria 2866
483 Ga0495647_0034373 3300046681 Bacteria 1898
484 Ga0495658_0003530 3300046683 Bacteria 7735
485 Ga0495658_0013334 3300046683 Bacteria 4182
486 Ga0495658_0204148 3300046683 Bacteria 1233
487 Ga0495613_0010160 3300046689 Bacteria 6993
488 Ga0495624_0011009 3300046690 Bacteria 6226
489 Ga0495624_0083776 3300046690 Bacteria 1971
490 Ga0495624_0356740 3300046690 Bacteria 879
491 Ga0495600_0017157 3300046809 Bacteria 4602
492 Ga0495600_0056048 3300046809 Bacteria 2574
493 Ga0495581_0008653 3300047315 Bacteria 5895
494 Ga0495581_0017634 3300047315 Bacteria 4147
495 Ga0495604_0007148 3300047317 Bacteria 8843
496 Ga0495604_0013106 3300047317 Bacteria 6603
497 Ga0495604_0331973 3300047317 Bacteria 1014
498 Ga0495674_0024837 3300047319 Bacteria 5501
499 Ga0495674_0034269 3300047319 Bacteria 4592
500 Ga0495674_0255361 3300047319 Bacteria 1441
501 Ga0495674_0340281 3300047319 Bacteria 1219
502 Ga0495676_0005830 3300047321 Bacteria 11305
503 Ga0495676_0048186 3300047321 Bacteria 3438
504 Ga0495680_0009868 3300047322 Bacteria 8558
505 Ga0495680_0025378 3300047322 Bacteria 4906
506 Ga0495684_0004208 3300047471 Bacteria 11242
507 Ga0495684_0028308 3300047471 Bacteria 4302
508 Ga0495684_0312185 3300047471 Bacteria 1126
509 Ga0495593_0010122 3300047673 Bacteria 5457
510 Ga0495593_0013915 3300047673 Bacteria 4583
511 Ga0495593_0051728 3300047673 Bacteria 2173
512 Ga0495602_0101228 3300048088 Bacteria 2364
513 Ga0495602_0730676 3300048088 Bacteria 670
514 Ga0496100_0029937 3300048903 Bacteria 3372
515 Ga0496100_0229885 3300048903 Bacteria 1364
516 Ga0496101_0017662 3300048904 Bacteria 4839
517 Ga0496102_0048132 3300048905 Bacteria 3876
518 Ga0496102_0089693 3300048905 Bacteria 2844
519 Ga0496102_0740709 3300048905 Bacteria 906
520 Ga0496103_0018758 3300048906 Bacteria 4152
521 Ga0496104_0023168 3300048907 Bacteria 5708
522 Ga0496104_0041631 3300048907 Bacteria 4308
523 Ga0496104_0055880 3300048907 Bacteria 3732
524 Ga0496104_0117648 3300048907 Bacteria 2551
525 Ga0496104_1506119 3300048907 Bacteria 576
526 Ga0496105_0003546 3300048908 Bacteria 11566
527 Ga0496105_0018272 3300048908 Bacteria 5631
528 Ga0496105_0018448 3300048908 Bacteria 5608
529 Ga0496105_1051267 3300048908 Bacteria 607
530 Ga0496106_0007409 3300048909 Bacteria 8109
531 Ga0496106_0021970 3300048909 Bacteria 4741
532 Ga0496107_0112542 3300048910 Bacteria 2001
533 Ga0496107_0127629 3300048910 Bacteria 1876
534 Ga0496108_0005484 3300048911 Bacteria 10261
535 Ga0496108_0029522 3300048911 Bacteria 4542
536 Ga0496108_0132278 3300048911 Bacteria 2144
537 Ga0496108_0244680 3300048911 Bacteria 1560
538 Ga0496108_0701595 3300048911 Bacteria 877
539 Ga0496109_0018316 3300048912 Bacteria 6151
540 Ga0496109_0028922 3300048912 Bacteria 4961
541 Ga0496109_0050143 3300048912 Bacteria 3802
542 Ga0496109_0051534 3300048912 Bacteria 3749
543 Ga0496109_1623248 3300048912 Bacteria 581
544 Ga0496110_0003522 3300048913 Bacteria 12016
545 Ga0496110_0016744 3300048913 Bacteria 6124
546 Ga0496110_0022592 3300048913 Bacteria 5343
547 Ga0496110_0030265 3300048913 Bacteria 4665
548 Ga0496111_0006940 3300048914 Bacteria 7391
549 Ga0496111_0008023 3300048914 Bacteria 6963
550 Ga0496111_0236287 3300048914 Bacteria 1357
551 Ga0496112_0025202 3300048915 Bacteria 5709
552 Ga0496112_0465701 3300048915 Bacteria 1201
553 Ga0496112_0502019 3300048915 Bacteria 1148
554 Ga0496112_0527313 3300048915 Bacteria 1115
555 Ga0496113_0022346 3300048916 Bacteria 4472
556 Ga0496113_0047128 3300048916 Bacteria 3202
557 Ga0496113_0180956 3300048916 Bacteria 1671
558 Ga0496114_0059656 3300048917 Bacteria 3187
559 Ga0496114_0300897 3300048917 Bacteria 1416
560 Ga0496114_0825259 3300048917 Bacteria 807
561 Ga0496115_0188317 3300048918 Bacteria 1705
562 Ga0496125_0015483 3300048928 Bacteria 7371
563 Ga0496126_0007302 3300048929 Bacteria 12137
564 Ga0501068_0486623 3300049584 Bacteria 800
565 Ga0501072_0211906 3300049588 Bacteria 1544
566 nmdc:mga03683_292572_c1 3300050489 Bacteria 762
567 nmdc:mga03n38_15964_c1 3300050490 Bacteria 2912
568 nmdc:mga03n38_260798_c1 3300050490 Bacteria 919
569 nmdc:mga00v17_75876_c1 3300050491 Bacteria 2091
570 nmdc:mga0yw44_289117_c1 3300050492 Bacteria 1097
571 nmdc:mga0yw44_37095_c1 3300050492 Bacteria 2876
572 nmdc:mga06z11_66806_c1 3300050494 Bacteria 1891
573 nmdc:mga07m45_4002_c1 3300050496 Bacteria 7171
574 nmdc:mga07m45_89945_c1 3300050496 Bacteria 788
575 nmdc:mga05p37_1166024_c1 3300050507 Bacteria 800
576 nmdc:mga09592_167511_c1 3300050508 Bacteria 1899
577 nmdc:mga06r32_1177145_c1 3300050510 Bacteria 713
578 nmdc:mga06r32_1276631_c1 3300050510 Bacteria 679
579 nmdc:mga08y16_157449_c1 3300050511 Bacteria 2361
580 nmdc:mga0n895_117364_c1 3300050512 Bacteria 2680
581 nmdc:mga0n895_32349_c1 3300050512 Bacteria 5020
582 nmdc:mga0n895_794615_c1 3300050512 Bacteria 937
583 nmdc:mga0rr50_226116_c1 3300050513 Bacteria 1547
584 nmdc:mga0rr50_913049_c1 3300050513 Bacteria 749
585 nmdc:mga08x19_7459_c1 3300050514 Bacteria 6496
586 nmdc:mga0a205_218415_c1 3300050515 Bacteria 1793
587 nmdc:mga0a205_996140_c1 3300050515 Bacteria 685
588 nmdc:mga0sz30_23875_c1 3300050516 Bacteria 2492
589 Ga0495601_0268474 3300053077 Bacteria 1113
590 Ga0495612_0096718 3300053078 Bacteria 1255
591 Ga0495595_0022864 3300053084 Bacteria 2747
592 Ga0495619_0017914 3300053085 Bacteria 4489
593 Ga0495619_0123324 3300053085 Bacteria 1777
594 Ga0500644_0025899 3300053088 Bacteria 1810
595 Ga0500573_0152892 3300053140 Bacteria 1262
596 Ga0466962_0199342 3300061719 Bacteria 978

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2547132424 2548695357 158
2 iso_pu_bacteria 2565956761 2566994269 158
3 iso_pu_bacteria 2585427649 2586062191 158
4 iso_pu_bacteria 2643221692 2644516467 158
5 iso_pu_bacteria 2738541308 2738887142 158
6 iso_pu_bacteria 2738543034 2739367256 158
7 iso_pu_bacteria 2791354901 2791912184 158
8 iso_pu_bacteria 2808606522 2809588640 158
9 iso_pu_bacteria 2904535858 2904538773 158
10 iso_pu_bacteria 2915768154 2915770006 158
11 iso_pu_bacteria 2919713450 2919717241 158
12 iso_pu_bacteria 2922554459 2922559501 158
13 iso_pu_bacteria 2939582691 2939584178 158
14 iso_pu_bacteria 8047710418 8047718059 158
15 iso_pu_bacteria 2675903059 2676485899 159
16 iso_pu_bacteria 2751185782 2753266537 159
17 3300002155 JGI24033J26618_1027155 JGI24033J26618_10271552 162
18 3300002459 JGI24751J29686_10003840 JGI24751J29686_100038403 162
19 3300003203 JGI25406J46586_10002057 JGI25406J46586_100020575 162
20 3300003911 JGI25405J52794_10019198 JGI25405J52794_100191981 162
21 3300005327 Ga0070658_10024804 Ga0070658_100248044 162
22 3300005327 Ga0070658_10641174 Ga0070658_106411742 162
23 3300005328 Ga0070676_10052877 Ga0070676_100528772 162
24 3300005329 Ga0070683_101001103 Ga0070683_1010011032 162
25 3300005329 Ga0070683_101008147 Ga0070683_1010081471 162
26 3300005330 Ga0070690_100791185 Ga0070690_1007911851 162
27 3300005334 Ga0068869_100013076 Ga0068869_1000130768 162
28 3300005334 Ga0068869_100257909 Ga0068869_1002579092 162
29 3300005335 Ga0070666_10317715 Ga0070666_103177152 162
30 3300005336 Ga0070680_100065730 Ga0070680_1000657301 162
31 3300005337 Ga0070682_100216067 Ga0070682_1002160672 162
32 3300005338 Ga0068868_100055286 Ga0068868_1000552862 162
33 3300005339 Ga0070660_100032361 Ga0070660_1000323612 162
34 3300005340 Ga0070689_100064431 Ga0070689_1000644312 162
35 3300005345 Ga0070692_10118059 Ga0070692_101180592 162
36 3300005354 Ga0070675_100079377 Ga0070675_1000793772 162
37 3300005355 Ga0070671_100000635 Ga0070671_1000006352 162
38 3300005364 Ga0070673_100099907 Ga0070673_1000999073 162
39 3300005434 Ga0070709_10041051 Ga0070709_100410512 162
40 3300005434 Ga0070709_10083245 Ga0070709_100832452 162
41 3300005435 Ga0070714_100061206 Ga0070714_1000612063 162
42 3300005435 Ga0070714_101642811 Ga0070714_1016428111 162
43 3300005436 Ga0070713_100002466 Ga0070713_10000246614 162
44 3300005437 Ga0070710_10070565 Ga0070710_100705651 162
45 3300005437 Ga0070710_10182468 Ga0070710_101824682 162
46 3300005439 Ga0070711_100046256 Ga0070711_1000462562 162
47 3300005439 Ga0070711_100463541 Ga0070711_1004635412 162
48 3300005440 Ga0070705_100178902 Ga0070705_1001789022 162
49 3300005441 Ga0070700_100032739 Ga0070700_1000327392 162
50 3300005445 Ga0070708_100111783 Ga0070708_1001117833 162
51 3300005455 Ga0070663_100059236 Ga0070663_1000592362 162
52 3300005456 Ga0070678_100017872 Ga0070678_1000178722 162
53 3300005467 Ga0070706_100003943 Ga0070706_10000394312 162
54 3300005467 Ga0070706_100008907 Ga0070706_10000890711 162
55 3300005467 Ga0070706_100674069 Ga0070706_1006740692 162
56 3300005468 Ga0070707_100124620 Ga0070707_1001246203 162
57 3300005468 Ga0070707_100423405 Ga0070707_1004234052 162
58 3300005471 Ga0070698_100007953 Ga0070698_1000079535 162
59 3300005530 Ga0070679_100415050 Ga0070679_1004150502 162
60 3300005530 Ga0070679_100501004 Ga0070679_1005010041 162
61 3300005535 Ga0070684_100616036 Ga0070684_1006160362 162
62 3300005536 Ga0070697_101430015 Ga0070697_1014300151 162
63 3300005539 Ga0068853_100977342 Ga0068853_1009773421 162
64 3300005544 Ga0070686_100447943 Ga0070686_1004479432 162
65 3300005547 Ga0070693_100003642 Ga0070693_1000036428 162
66 3300005548 Ga0070665_100079122 Ga0070665_1000791222 162
67 3300005564 Ga0070664_100653340 Ga0070664_1006533402 162
68 3300005577 Ga0068857_100635847 Ga0068857_1006358472 162
69 3300005578 Ga0068854_100425001 Ga0068854_1004250012 162
70 3300005614 Ga0068856_100022369 Ga0068856_1000223697 162
71 3300005614 Ga0068856_100099071 Ga0068856_1000990712 162
72 3300005614 Ga0068856_100587025 Ga0068856_1005870252 162
73 3300005614 Ga0068856_101305631 Ga0068856_1013056312 162
74 3300005615 Ga0070702_100011239 Ga0070702_1000112395 162
75 3300005615 Ga0070702_100076891 Ga0070702_1000768912 162
76 3300005616 Ga0068852_100043957 Ga0068852_1000439571 162
77 3300005618 Ga0068864_100033409 Ga0068864_1000334097 162
78 3300005618 Ga0068864_100153856 Ga0068864_1001538563 162
79 3300005834 Ga0068851_10519524 Ga0068851_105195241 162
80 3300005840 Ga0068870_10005633 Ga0068870_100056337 162
81 3300005841 Ga0068863_100045066 Ga0068863_1000450664 162
82 3300005841 Ga0068863_100045100 Ga0068863_1000451003 162
83 3300005841 Ga0068863_100567240 Ga0068863_1005672402 162
84 3300005842 Ga0068858_100021168 Ga0068858_1000211685 162
85 3300005937 Ga0081455_10000112 Ga0081455_1000011215 162
86 3300005985 Ga0081539_10000417 Ga0081539_1000041718 162
87 3300006028 Ga0070717_10062409 Ga0070717_100624092 162
88 3300006028 Ga0070717_10305605 Ga0070717_103056052 162
89 3300006028 Ga0070717_10528098 Ga0070717_105280981 162
90 3300006028 Ga0070717_11202188 Ga0070717_112021881 162
91 3300006038 Ga0075365_10032360 Ga0075365_100323604 162
92 3300006048 Ga0075363_100020237 Ga0075363_1000202373 162
93 3300006048 Ga0075363_100231665 Ga0075363_1002316652 162
94 3300006051 Ga0075364_10236582 Ga0075364_102365821 162
95 3300006058 Ga0075432_10075403 Ga0075432_100754032 162
96 3300006163 Ga0070715_10159448 Ga0070715_101594482 162
97 3300006175 Ga0070712_100065485 Ga0070712_1000654852 162
98 3300006178 Ga0075367_10087339 Ga0075367_100873392 162
99 3300006178 Ga0075367_10531029 Ga0075367_105310291 162
100 3300006186 Ga0075369_10049567 Ga0075369_100495672 162
101 3300006237 Ga0097621_100044452 Ga0097621_1000444523 162
102 3300006353 Ga0075370_10110482 Ga0075370_101104822 162
103 3300006353 Ga0075370_10382380 Ga0075370_103823802 162
104 3300006358 Ga0068871_100034451 Ga0068871_1000344512 162
105 3300006358 Ga0068871_100101384 Ga0068871_1001013841 162
106 3300006844 Ga0075428_100855611 Ga0075428_1008556112 162
107 3300006852 Ga0075433_10034214 Ga0075433_100342144 162
108 3300006914 Ga0075436_100004718 Ga0075436_1000047182 162
109 3300007076 Ga0075435_100481069 Ga0075435_1004810692 162
110 3300009094 Ga0111539_10185986 Ga0111539_101859862 162
111 3300009098 Ga0105245_10024376 Ga0105245_100243762 162
112 3300009098 Ga0105245_10883605 Ga0105245_108836051 162
113 3300009147 Ga0114129_10678678 Ga0114129_106786781 162
114 3300009148 Ga0105243_10348262 Ga0105243_103482621 162
115 3300009174 Ga0105241_10440076 Ga0105241_104400762 162
116 3300009177 Ga0105248_10112801 Ga0105248_101128012 162
117 3300009177 Ga0105248_10188794 Ga0105248_101887943 162
118 3300009545 Ga0105237_10247018 Ga0105237_102470182 162
119 3300009551 Ga0105238_10150719 Ga0105238_101507192 162
120 3300010375 Ga0105239_10124927 Ga0105239_101249272 162
121 3300010375 Ga0105239_10265692 Ga0105239_102656922 162
122 3300010375 Ga0105239_10839214 Ga0105239_108392142 162
123 3300011119 Ga0105246_10004760 Ga0105246_100047606 162
124 3300012503 Ga0157313_1011581 Ga0157313_10115811 162
125 3300013100 Ga0157373_10029646 Ga0157373_100296463 162
126 3300013102 Ga0157371_10099868 Ga0157371_100998682 162
127 3300013104 Ga0157370_10059246 Ga0157370_100592462 162
128 3300013104 Ga0157370_10167821 Ga0157370_101678211 162
129 3300013104 Ga0157370_10271781 Ga0157370_102717811 162
130 3300013105 Ga0157369_10029298 Ga0157369_100292987 162
131 3300013105 Ga0157369_10120886 Ga0157369_101208862 162
132 3300013105 Ga0157369_10352452 Ga0157369_103524522 162
133 3300013105 Ga0157369_10567396 Ga0157369_105673962 162
134 3300013105 Ga0157369_10573477 Ga0157369_105734772 162
135 3300013105 Ga0157369_10910826 Ga0157369_109108261 162
136 3300013296 Ga0157374_10097991 Ga0157374_100979912 162
137 3300013296 Ga0157374_10780301 Ga0157374_107803012 162
138 3300013306 Ga0163162_10216950 Ga0163162_102169502 162
139 3300013307 Ga0157372_10058337 Ga0157372_100583373 162
140 3300013307 Ga0157372_10061049 Ga0157372_100610492 162
141 3300013308 Ga0157375_10041386 Ga0157375_100413862 162
142 3300014325 Ga0163163_10024547 Ga0163163_100245473 162
143 3300014325 Ga0163163_10165552 Ga0163163_101655522 162
144 3300014325 Ga0163163_10830422 Ga0163163_108304222 162
145 3300014497 Ga0182008_10082452 Ga0182008_100824522 162
146 3300014745 Ga0157377_10003853 Ga0157377_100038532 162
147 3300014968 Ga0157379_10028595 Ga0157379_100285956 162
148 3300014968 Ga0157379_10126152 Ga0157379_101261523 162
149 3300014969 Ga0157376_10044482 Ga0157376_100444823 162
150 3300014969 Ga0157376_10190061 Ga0157376_101900612 162
151 3300014969 Ga0157376_12061311 Ga0157376_120613111 162
152 3300017792 Ga0163161_10056268 Ga0163161_100562683 162
153 3300020069 Ga0197907_11109537 Ga0197907_111095372 162
154 3300020070 Ga0206356_10615563 Ga0206356_106155631 162
155 3300020075 Ga0206349_1672554 Ga0206349_16725542 162
156 3300020075 Ga0206349_1791822 Ga0206349_17918222 162
157 3300020075 Ga0206349_1905463 Ga0206349_19054631 162
158 3300020078 Ga0206352_10509604 Ga0206352_105096041 162
159 3300020081 Ga0206354_11531839 Ga0206354_115318392 162
160 3300020082 Ga0206353_11064492 Ga0206353_110644922 162
161 3300020082 Ga0206353_11722789 Ga0206353_117227892 162
162 3300021388 Ga0213875_10001884 Ga0213875_100018843 162
163 3300022467 Ga0224712_10040877 Ga0224712_100408773 162
164 3300022467 Ga0224712_10339153 Ga0224712_103391531 162
165 3300022467 Ga0224712_10345686 Ga0224712_103456861 162
166 3300025321 Ga0207656_10124637 Ga0207656_101246372 162
167 3300025898 Ga0207692_10052050 Ga0207692_100520502 162
168 3300025898 Ga0207692_10067245 Ga0207692_100672452 162
169 3300025898 Ga0207692_10117212 Ga0207692_101172121 162
170 3300025901 Ga0207688_10414636 Ga0207688_104146361 162
171 3300025904 Ga0207647_10071749 Ga0207647_100717492 162
172 3300025906 Ga0207699_10040121 Ga0207699_100401213 162
173 3300025906 Ga0207699_10064303 Ga0207699_100643033 162
174 3300025908 Ga0207643_10000039 Ga0207643_100000398 162
175 3300025909 Ga0207705_10039796 Ga0207705_100397962 162
176 3300025909 Ga0207705_10570056 Ga0207705_105700561 162
177 3300025909 Ga0207705_10867313 Ga0207705_108673131 162
178 3300025910 Ga0207684_10002293 Ga0207684_100022939 162
179 3300025910 Ga0207684_10268814 Ga0207684_102688142 162
180 3300025910 Ga0207684_10285072 Ga0207684_102850722 162
181 3300025911 Ga0207654_10007978 Ga0207654_100079785 162
182 3300025912 Ga0207707_10205762 Ga0207707_102057622 162
183 3300025914 Ga0207671_10217023 Ga0207671_102170231 162
184 3300025915 Ga0207693_10022527 Ga0207693_100225271 162
185 3300025915 Ga0207693_10037089 Ga0207693_100370892 162
186 3300025915 Ga0207693_10090274 Ga0207693_100902742 162
187 3300025916 Ga0207663_10359961 Ga0207663_103599612 162
188 3300025917 Ga0207660_10031660 Ga0207660_100316603 162
189 3300025919 Ga0207657_10022954 Ga0207657_100229542 162
190 3300025920 Ga0207649_10362972 Ga0207649_103629722 162
191 3300025921 Ga0207652_10081687 Ga0207652_100816872 162
192 3300025921 Ga0207652_10387601 Ga0207652_103876012 162
193 3300025922 Ga0207646_10027431 Ga0207646_100274313 162
194 3300025922 Ga0207646_10509724 Ga0207646_105097242 162
195 3300025924 Ga0207694_10412817 Ga0207694_104128171 162
196 3300025925 Ga0207650_10021059 Ga0207650_100210592 162
197 3300025926 Ga0207659_10488354 Ga0207659_104883542 162
198 3300025927 Ga0207687_10093558 Ga0207687_100935583 162
199 3300025927 Ga0207687_10201867 Ga0207687_102018672 162
200 3300025928 Ga0207700_10039306 Ga0207700_100393063 162
201 3300025929 Ga0207664_10133982 Ga0207664_101339822 162
202 3300025929 Ga0207664_10224969 Ga0207664_102249693 162
203 3300025929 Ga0207664_11207215 Ga0207664_112072152 162
204 3300025931 Ga0207644_10096153 Ga0207644_100961532 162
205 3300025935 Ga0207709_10149513 Ga0207709_101495132 162
206 3300025935 Ga0207709_10216463 Ga0207709_102164631 162
207 3300025936 Ga0207670_10009525 Ga0207670_100095252 162
208 3300025941 Ga0207711_10146655 Ga0207711_101466551 162
209 3300025941 Ga0207711_10417079 Ga0207711_104170791 162
210 3300025942 Ga0207689_10004582 Ga0207689_100045827 162
211 3300025944 Ga0207661_10075267 Ga0207661_100752671 162
212 3300025944 Ga0207661_10220673 Ga0207661_102206731 162
213 3300025944 Ga0207661_10267456 Ga0207661_102674561 162
214 3300025945 Ga0207679_10022595 Ga0207679_100225957 162
215 3300025945 Ga0207679_11034076 Ga0207679_110340761 162
216 3300025981 Ga0207640_10027186 Ga0207640_100271864 162
217 3300026023 Ga0207677_10038846 Ga0207677_100388463 162
218 3300026035 Ga0207703_10056001 Ga0207703_100560014 162
219 3300026035 Ga0207703_10429769 Ga0207703_104297692 162
220 3300026035 Ga0207703_11686984 Ga0207703_116869841 162
221 3300026041 Ga0207639_10102241 Ga0207639_101022413 162
222 3300026067 Ga0207678_10001338 Ga0207678_1000133818 162
223 3300026075 Ga0207708_10043866 Ga0207708_100438661 162
224 3300026078 Ga0207702_10003837 Ga0207702_1000383711 162
225 3300026078 Ga0207702_10040119 Ga0207702_100401192 162
226 3300026078 Ga0207702_10223973 Ga0207702_102239732 162
227 3300026078 Ga0207702_10283693 Ga0207702_102836931 162
228 3300026078 Ga0207702_10941630 Ga0207702_109416302 162
229 3300026088 Ga0207641_10118247 Ga0207641_101182472 162
230 3300026088 Ga0207641_10152581 Ga0207641_101525812 162
231 3300026095 Ga0207676_10177361 Ga0207676_101773612 162
232 3300026116 Ga0207674_10061677 Ga0207674_100616773 162
233 3300026116 Ga0207674_10078182 Ga0207674_100781822 162
234 3300026116 Ga0207674_10758245 Ga0207674_107582452 162
235 3300026116 Ga0207674_11039366 Ga0207674_110393661 162
236 3300026121 Ga0207683_10036359 Ga0207683_100363593 162
237 3300026142 Ga0207698_10118684 Ga0207698_101186842 162
238 3300027907 Ga0207428_10014004 Ga0207428_100140042 162
239 3300028379 Ga0268266_10202511 Ga0268266_102025111 162
240 3300028379 Ga0268266_10573509 Ga0268266_105735091 162
241 3300028381 Ga0268264_10063293 Ga0268264_100632932 162
242 3300028556 Ga0265337_1005578 Ga0265337_10055784 162
243 3300028558 Ga0265326_10009317 Ga0265326_100093172 162
244 3300028563 Ga0265319_1016937 Ga0265319_10169373 162
245 3300028573 Ga0265334_10001541 Ga0265334_1000154110 162
246 3300028577 Ga0265318_10115913 Ga0265318_101159132 162
247 3300028653 Ga0265323_10022009 Ga0265323_100220093 162
248 3300028654 Ga0265322_10015885 Ga0265322_100158852 162
249 3300028666 Ga0265336_10019609 Ga0265336_100196092 162
250 3300028794 Ga0307515_10054619 Ga0307515_100546196 162
251 3300028800 Ga0265338_10054489 Ga0265338_100544894 162
252 3300028800 Ga0265338_10098405 Ga0265338_100984051 162
253 3300028800 Ga0265338_10107380 Ga0265338_101073802 162
254 3300029957 Ga0265324_10023583 Ga0265324_100235833 162
255 3300031238 Ga0265332_10020522 Ga0265332_100205222 162
256 3300031240 Ga0265320_10028769 Ga0265320_100287692 162
257 3300031241 Ga0265325_10051086 Ga0265325_100510862 162
258 3300031247 Ga0265340_10008327 Ga0265340_100083272 162
259 3300031249 Ga0265339_10018443 Ga0265339_100184431 162
260 3300031344 Ga0265316_10108575 Ga0265316_101085751 162
261 3300031507 Ga0307509_10265069 Ga0307509_102650693 162
262 3300031507 Ga0307509_10498324 Ga0307509_104983242 162
263 3300031665 Ga0316575_10000001 Ga0316575_1000000159 162
264 3300031711 Ga0265314_10003585 Ga0265314_1000358515 162
265 3300031712 Ga0265342_10002630 Ga0265342_100026303 162
266 3300031852 Ga0307410_10321987 Ga0307410_103219872 162
267 3300032002 Ga0307416_100296216 Ga0307416_1002962162 162
268 3300033545 Ga0316214_1013213 Ga0316214_10132132 162
269 3300033547 Ga0316212_1002673 Ga0316212_10026734 162
270 3300033548 Ga0316216_1007766 Ga0316216_10077661 162
271 3300035083 Ga0373926_0004623 Ga0373926_0004623_3008_3496 162
272 3300035111 Ga0373923_0394520 Ga0373923_0394520_88_576 162
273 3300035116 Ga0373945_0199939 Ga0373945_0199939_127_615 162
274 3300035118 Ga0373954_0045894 Ga0373954_0045894_260_748 162
275 3300035118 Ga0373954_0053334 Ga0373954_0053334_94_582 162
276 3300035119 Ga0373956_0078521 Ga0373956_0078521_439_927 162
277 3300035170 Ga0373943_0134004 Ga0373943_0134004_553_1041 162
278 3300035691 Ga0373931_0303866 Ga0373931_0303866_465_953 162
279 3300035692 Ga0373935_0000373 Ga0373935_0000373_2386_2874 162
280 3300035692 Ga0373935_0166276 Ga0373935_0166276_430_918 162
281 3300035692 Ga0373935_0665407 Ga0373935_0665407_51_539 162
282 3300035695 Ga0373927_0113197 Ga0373927_0113197_866_1354 162
283 3300035724 Ga0373933_0969795 Ga0373933_0969795_17_505 162
284 3300035725 Ga0373947_0000007 Ga0373947_0000007_60580_61068 162
285 3300035725 Ga0373947_0198598 Ga0373947_0198598_49_537 162
286 3300035725 Ga0373947_1026277 Ga0373947_1026277_13_501 162
287 3300036401 Ga0373937_0165210 Ga0373937_0165210_976_1464 162
288 3300036401 Ga0373937_0255360 Ga0373937_0255360_1032_1520 162
289 3300036401 Ga0373937_0541307 Ga0373937_0541307_305_793 162
290 3300036459 Ga0372808_053776 Ga0372808_053776_78_566 162
291 3300037068 Ga0373925_0002082 Ga0373925_0002082_970_1458 162
292 3300037466 Ga0395898_0119822 Ga0395898_0119822_559_1047 162
293 3300037853 Ga0436364_0183141 Ga0436364_0183141_3778_4266 162
294 3300041459 Ga0451800_1285469 Ga0451800_1285469_21_518 162
295 3300042137 Ga0450902_016473 Ga0450902_016473_196_684 162
296 3300042157 Ga0439458_0045826 Ga0439458_0045826_86_574 162
297 3300042438 Ga0439459_0048730 Ga0439459_0048730_166_654 162
298 3300044684 Ga0466966_0416913 Ga0466966_0416913_58_549 162
299 3300044693 Ga0466961_0079250 Ga0466961_0079250_1429_1920 162
300 3300044694 Ga0466963_0120627 Ga0466963_0120627_1192_1680 162
301 3300044735 Ga0466968_0030687 Ga0466968_0030687_60_551 162
302 3300044901 Ga0466960_0022426 Ga0466960_0022426_278_766 162
303 3300045836 Ga0466958_0305781 Ga0466958_0305781_44_532 162
304 3300045836 Ga0466958_0578341 Ga0466958_0578341_100_588 162
305 3300045836 Ga0466958_0771375 Ga0466958_0771375_23_514 162
306 3300045976 Ga0466967_0074046 Ga0466967_0074046_56_547 162
307 3300045976 Ga0466967_0118190 Ga0466967_0118190_783_1271 162
308 3300045976 Ga0466967_0409182 Ga0466967_0409182_682_1170 162
309 3300045976 Ga0466967_0940552 Ga0466967_0940552_106_597 162
310 3300046455 Ga0495603_0257194 Ga0495603_0257194_496_984 162
311 3300046459 Ga0495629_0007464 Ga0495629_0007464_5381_5869 162
312 3300046461 Ga0495641_0025197 Ga0495641_0025197_2028_2516 162
313 3300046473 Ga0495582_0006325 Ga0495582_0006325_1230_1718 162
314 3300046473 Ga0495582_0424310 Ga0495582_0424310_245_733 162
315 3300046477 Ga0495664_0335399 Ga0495664_0335399_75_563 162
316 3300046511 Ga0495608_0377958 Ga0495608_0377958_78_566 162
317 3300046514 Ga0495618_0083083 Ga0495618_0083083_1263_1751 162
318 3300046516 Ga0495628_0177033 Ga0495628_0177033_766_1254 162
319 3300046516 Ga0495628_0223520 Ga0495628_0223520_702_1190 162
320 3300046517 Ga0495630_0060562 Ga0495630_0060562_2053_2541 162
321 3300046517 Ga0495630_0371399 Ga0495630_0371399_363_851 162
322 3300046517 Ga0495630_1228883 Ga0495630_1228883_29_517 162
323 3300046526 Ga0495666_0023955 Ga0495666_0023955_485_973 162
324 3300046529 Ga0495652_0156633 Ga0495652_0156633_558_1046 162
325 3300046529 Ga0495652_0241795 Ga0495652_0241795_361_849 162
326 3300046531 Ga0495665_0068005 Ga0495665_0068005_386_874 162
327 3300046533 Ga0495640_0044601 Ga0495640_0044601_2359_2847 162
328 3300046535 Ga0495586_0121114 Ga0495586_0121114_136_624 162
329 3300046536 Ga0495587_0678325 Ga0495587_0678325_31_519 162
330 3300046616 Ga0495668_0000455 Ga0495668_0000455_9448_9942 162
331 3300046642 Ga0495634_0137722 Ga0495634_0137722_219_707 162
332 3300046642 Ga0495634_0185279 Ga0495634_0185279_15_503 162
333 3300046663 Ga0495635_0104224 Ga0495635_0104224_118_606 162
334 3300046674 Ga0495588_0072996 Ga0495588_0072996_857_1351 162
335 3300046680 Ga0495646_0154220 Ga0495646_0154220_114_602 162
336 3300046681 Ga0495647_0013112 Ga0495647_0013112_2312_2800 162
337 3300046683 Ga0495658_0013334 Ga0495658_0013334_80_568 162
338 3300046683 Ga0495658_0204148 Ga0495658_0204148_160_648 162
339 3300046690 Ga0495624_0083776 Ga0495624_0083776_379_867 162
340 3300046809 Ga0495600_0056048 Ga0495600_0056048_1227_1715 162
341 3300047315 Ga0495581_0008653 Ga0495581_0008653_3569_4057 162
342 3300047317 Ga0495604_0007148 Ga0495604_0007148_7820_8308 162
343 3300047317 Ga0495604_0331973 Ga0495604_0331973_500_988 162
344 3300047319 Ga0495674_0255361 Ga0495674_0255361_702_1190 162
345 3300047319 Ga0495674_0340281 Ga0495674_0340281_699_1187 162
346 3300047321 Ga0495676_0048186 Ga0495676_0048186_1772_2260 162
347 3300047322 Ga0495680_0025378 Ga0495680_0025378_2315_2803 162
348 3300047471 Ga0495684_0028308 Ga0495684_0028308_193_681 162
349 3300047471 Ga0495684_0312185 Ga0495684_0312185_489_977 162
350 3300047673 Ga0495593_0010122 Ga0495593_0010122_4309_4797 162
351 3300047673 Ga0495593_0051728 Ga0495593_0051728_538_1026 162
352 3300048088 Ga0495602_0101228 Ga0495602_0101228_896_1384 162
353 3300048905 Ga0496102_0048132 Ga0496102_0048132_3105_3593 162
354 3300048907 Ga0496104_0041631 Ga0496104_0041631_549_1037 162
355 3300048907 Ga0496104_0055880 Ga0496104_0055880_315_803 162
356 3300048907 Ga0496104_1506119 Ga0496104_1506119_32_523 162
357 3300048908 Ga0496105_0003546 Ga0496105_0003546_3093_3581 162
358 3300048908 Ga0496105_0018272 Ga0496105_0018272_1950_2438 162
359 3300048908 Ga0496105_1051267 Ga0496105_1051267_85_576 162
360 3300048909 Ga0496106_0007409 Ga0496106_0007409_4850_5338 162
361 3300048910 Ga0496107_0112542 Ga0496107_0112542_169_657 162
362 3300048911 Ga0496108_0029522 Ga0496108_0029522_3089_3583 162
363 3300048911 Ga0496108_0132278 Ga0496108_0132278_792_1280 162
364 3300048911 Ga0496108_0244680 Ga0496108_0244680_1007_1501 162
365 3300048911 Ga0496108_0701595 Ga0496108_0701595_91_579 162
366 3300048912 Ga0496109_0028922 Ga0496109_0028922_4112_4600 162
367 3300048912 Ga0496109_0051534 Ga0496109_0051534_2021_2515 162
368 3300048912 Ga0496109_1623248 Ga0496109_1623248_42_536 162
369 3300048913 Ga0496110_0016744 Ga0496110_0016744_1885_2379 162
370 3300048913 Ga0496110_0030265 Ga0496110_0030265_3355_3843 162
371 3300048914 Ga0496111_0008023 Ga0496111_0008023_2782_3270 162
372 3300048914 Ga0496111_0236287 Ga0496111_0236287_613_1101 162
373 3300048915 Ga0496112_0465701 Ga0496112_0465701_51_539 162
374 3300048915 Ga0496112_0502019 Ga0496112_0502019_193_681 162
375 3300048915 Ga0496112_0527313 Ga0496112_0527313_473_961 162
376 3300048916 Ga0496113_0047128 Ga0496113_0047128_2534_3022 162
377 3300048917 Ga0496114_0059656 Ga0496114_0059656_2614_3108 162
378 3300048917 Ga0496114_0300897 Ga0496114_0300897_900_1388 162
379 3300048928 Ga0496125_0015483 Ga0496125_0015483_3458_3952 162
380 3300048929 Ga0496126_0007302 Ga0496126_0007302_10853_11365 162
381 3300049588 Ga0501072_0211906 Ga0501072_0211906_698_1186 162
382 3300050489 nmdc:mga03683_292572_c1 nmdc:mga03683_292572_c1_45_539 162
383 3300050490 nmdc:mga03n38_15964_c1 nmdc:mga03n38_15964_c1_847_1341 162
384 3300050490 nmdc:mga03n38_260798_c1 nmdc:mga03n38_260798_c1_220_711 162
385 3300050491 nmdc:mga00v17_75876_c1 nmdc:mga00v17_75876_c1_356_847 162
386 3300050492 nmdc:mga0yw44_289117_c1 nmdc:mga0yw44_289117_c1_428_937 162
387 3300050492 nmdc:mga0yw44_37095_c1 nmdc:mga0yw44_37095_c1_10_501 162
388 3300050494 nmdc:mga06z11_66806_c1 nmdc:mga06z11_66806_c1_308_799 162
389 3300050496 nmdc:mga07m45_4002_c1 nmdc:mga07m45_4002_c1_796_1287 162
390 3300050496 nmdc:mga07m45_89945_c1 nmdc:mga07m45_89945_c1_206_700 162
391 3300050507 nmdc:mga05p37_1166024_c1 nmdc:mga05p37_1166024_c1_43_531 162
392 3300050508 nmdc:mga09592_167511_c1 nmdc:mga09592_167511_c1_1290_1778 162
393 3300050511 nmdc:mga08y16_157449_c1 nmdc:mga08y16_157449_c1_1512_2000 162
394 3300050512 nmdc:mga0n895_117364_c1 nmdc:mga0n895_117364_c1_379_867 162
395 3300050512 nmdc:mga0n895_32349_c1 nmdc:mga0n895_32349_c1_666_1154 162
396 3300050513 nmdc:mga0rr50_226116_c1 nmdc:mga0rr50_226116_c1_901_1389 162
397 3300050514 nmdc:mga08x19_7459_c1 nmdc:mga08x19_7459_c1_730_1218 162
398 3300050515 nmdc:mga0a205_218415_c1 nmdc:mga0a205_218415_c1_768_1256 162
399 3300050515 nmdc:mga0a205_996140_c1 nmdc:mga0a205_996140_c1_32_520 162
400 3300050516 nmdc:mga0sz30_23875_c1 nmdc:mga0sz30_23875_c1_1633_2124 162
401 3300053085 Ga0495619_0123324 Ga0495619_0123324_1019_1507 162
402 3300053088 Ga0500644_0025899 Ga0500644_0025899_1208_1696 162
403 3300053140 Ga0500573_0152892 Ga0500573_0152892_190_741 162
404 3300061719 Ga0466962_0199342 Ga0466962_0199342_459_947 162
405 iso_pu_bacteria 2751185725 2753035381 162
406 iso_pu_bacteria 2751185792 2753326593 162
407 3300002075 JGI24738J21930_10064511 JGI24738J21930_100645112 163
408 3300003373 JGI25407J50210_10001230 JGI25407J50210_100012306 163
409 3300005327 Ga0070658_10191274 Ga0070658_101912743 163
410 3300005329 Ga0070683_100000645 Ga0070683_1000006455 163
411 3300005329 Ga0070683_100008181 Ga0070683_1000081813 163
412 3300005331 Ga0070670_101794019 Ga0070670_1017940191 163
413 3300005334 Ga0068869_100013296 Ga0068869_1000132965 163
414 3300005337 Ga0070682_100007182 Ga0070682_1000071827 163
415 3300005337 Ga0070682_100007928 Ga0070682_1000079287 163
416 3300005338 Ga0068868_100016666 Ga0068868_1000166665 163
417 3300005339 Ga0070660_100102593 Ga0070660_1001025934 163
418 3300005341 Ga0070691_10045552 Ga0070691_100455522 163
419 3300005341 Ga0070691_10477458 Ga0070691_104774581 163
420 3300005344 Ga0070661_100012025 Ga0070661_1000120257 163
421 3300005347 Ga0070668_100358589 Ga0070668_1003585892 163
422 3300005354 Ga0070675_100074866 Ga0070675_1000748663 163
423 3300005354 Ga0070675_100336247 Ga0070675_1003362471 163
424 3300005355 Ga0070671_100097460 Ga0070671_1000974603 163
425 3300005356 Ga0070674_100622438 Ga0070674_1006224382 163
426 3300005364 Ga0070673_100351819 Ga0070673_1003518193 163
427 3300005365 Ga0070688_100033036 Ga0070688_1000330363 163
428 3300005366 Ga0070659_100078634 Ga0070659_1000786342 163
429 3300005367 Ga0070667_100358745 Ga0070667_1003587452 163
430 3300005441 Ga0070700_100008738 Ga0070700_1000087382 163
431 3300005455 Ga0070663_100144532 Ga0070663_1001445322 163
432 3300005456 Ga0070678_100016305 Ga0070678_1000163055 163
433 3300005457 Ga0070662_100171939 Ga0070662_1001719392 163
434 3300005458 Ga0070681_10004229 Ga0070681_1000422912 163
435 3300005466 Ga0070685_10168581 Ga0070685_101685812 163
436 3300005530 Ga0070679_100009544 Ga0070679_10000954410 163
437 3300005530 Ga0070679_100657368 Ga0070679_1006573681 163
438 3300005535 Ga0070684_100003617 Ga0070684_1000036173 163
439 3300005535 Ga0070684_100046824 Ga0070684_1000468244 163
440 3300005539 Ga0068853_100103857 Ga0068853_1001038572 163
441 3300005545 Ga0070695_100545892 Ga0070695_1005458921 163
442 3300005548 Ga0070665_100109040 Ga0070665_1001090404 163
443 3300005564 Ga0070664_100003373 Ga0070664_10000337313 163
444 3300005564 Ga0070664_100004267 Ga0070664_1000042677 163
445 3300005577 Ga0068857_100113374 Ga0068857_1001133741 163
446 3300005578 Ga0068854_100112119 Ga0068854_1001121193 163
447 3300005614 Ga0068856_100005907 Ga0068856_10000590710 163
448 3300005614 Ga0068856_100014656 Ga0068856_1000146566 163
449 3300005615 Ga0070702_100749298 Ga0070702_1007492981 163
450 3300005617 Ga0068859_101673156 Ga0068859_1016731561 163
451 3300005618 Ga0068864_100075568 Ga0068864_1000755683 163
452 3300005718 Ga0068866_10148215 Ga0068866_101482152 163
453 3300005842 Ga0068858_100810391 Ga0068858_1008103913 163
454 3300005843 Ga0068860_100467415 Ga0068860_1004674152 163
455 3300005843 Ga0068860_102095375 Ga0068860_1020953751 163
456 3300005981 Ga0081538_10001711 Ga0081538_100017114 163
457 3300006175 Ga0070712_100306531 Ga0070712_1003065312 163
458 3300006847 Ga0075431_100534283 Ga0075431_1005342833 163
459 3300006852 Ga0075433_10257675 Ga0075433_102576751 163
460 3300006871 Ga0075434_101584206 Ga0075434_1015842062 163
461 3300006881 Ga0068865_100052661 Ga0068865_1000526612 163
462 3300006931 Ga0097620_101673132 Ga0097620_1016731321 163
463 3300009098 Ga0105245_10004181 Ga0105245_100041815 163
464 3300009147 Ga0114129_12041070 Ga0114129_120410701 163
465 3300009174 Ga0105241_10091554 Ga0105241_100915541 163
466 3300009177 Ga0105248_11240191 Ga0105248_112401911 163
467 3300009545 Ga0105237_10142080 Ga0105237_101420802 163
468 3300009545 Ga0105237_10316468 Ga0105237_103164682 163
469 3300009551 Ga0105238_10143677 Ga0105238_101436772 163
470 3300009551 Ga0105238_11119585 Ga0105238_111195851 163
471 3300010375 Ga0105239_10051102 Ga0105239_100511025 163
472 3300010375 Ga0105239_10339748 Ga0105239_103397481 163
473 3300011119 Ga0105246_10007691 Ga0105246_100076913 163
474 3300013100 Ga0157373_10177090 Ga0157373_101770902 163
475 3300013102 Ga0157371_10080858 Ga0157371_100808581 163
476 3300013105 Ga0157369_10074949 Ga0157369_100749494 163
477 3300013296 Ga0157374_10007098 Ga0157374_1000709810 163
478 3300013296 Ga0157374_10030772 Ga0157374_100307721 163
479 3300013297 Ga0157378_10268853 Ga0157378_102688532 163
480 3300013307 Ga0157372_10007491 Ga0157372_100074913 163
481 3300013307 Ga0157372_10012336 Ga0157372_100123363 163
482 3300013308 Ga0157375_10017301 Ga0157375_100173017 163
483 3300013308 Ga0157375_10292475 Ga0157375_102924754 163
484 3300014325 Ga0163163_10562139 Ga0163163_105621392 163
485 3300014326 Ga0157380_10057796 Ga0157380_100577962 163
486 3300014745 Ga0157377_10000822 Ga0157377_100008224 163
487 3300014745 Ga0157377_10004097 Ga0157377_100040974 163
488 3300014968 Ga0157379_10477852 Ga0157379_104778522 163
489 3300014969 Ga0157376_10025716 Ga0157376_100257166 163
490 3300017792 Ga0163161_11696552 Ga0163161_116965521 163
491 3300020070 Ga0206356_11021213 Ga0206356_110212132 163
492 3300020082 Ga0206353_11048529 Ga0206353_110485291 163
493 3300022467 Ga0224712_10199793 Ga0224712_101997933 163
494 3300025901 Ga0207688_10000691 Ga0207688_1000069110 163
495 3300025904 Ga0207647_10206504 Ga0207647_102065042 163
496 3300025907 Ga0207645_10258558 Ga0207645_102585581 163
497 3300025909 Ga0207705_10327046 Ga0207705_103270462 163
498 3300025915 Ga0207693_10106583 Ga0207693_101065833 163
499 3300025915 Ga0207693_10145393 Ga0207693_101453933 163
500 3300025919 Ga0207657_10054199 Ga0207657_100541991 163
501 3300025919 Ga0207657_10066688 Ga0207657_100666883 163
502 3300025920 Ga0207649_10127350 Ga0207649_101273502 163
503 3300025921 Ga0207652_10397810 Ga0207652_103978102 163
504 3300025925 Ga0207650_11464015 Ga0207650_114640151 163
505 3300025926 Ga0207659_10039209 Ga0207659_100392092 163
506 3300025927 Ga0207687_10115745 Ga0207687_101157452 163
507 3300025931 Ga0207644_10031153 Ga0207644_100311532 163
508 3300025932 Ga0207690_10071828 Ga0207690_100718282 163
509 3300025935 Ga0207709_10032271 Ga0207709_100322713 163
510 3300025937 Ga0207669_10149399 Ga0207669_101493991 163
511 3300025940 Ga0207691_10836918 Ga0207691_108369182 163
512 3300025941 Ga0207711_10044758 Ga0207711_100447582 163
513 3300025942 Ga0207689_10040643 Ga0207689_100406434 163
514 3300025944 Ga0207661_10000277 Ga0207661_1000027722 163
515 3300025944 Ga0207661_10056730 Ga0207661_100567304 163
516 3300025961 Ga0207712_10136107 Ga0207712_101361072 163
517 3300025981 Ga0207640_10102043 Ga0207640_101020434 163
518 3300025986 Ga0207658_10299078 Ga0207658_102990782 163
519 3300026023 Ga0207677_10370233 Ga0207677_103702332 163
520 3300026035 Ga0207703_10425696 Ga0207703_104256962 163
521 3300026067 Ga0207678_10053507 Ga0207678_100535074 163
522 3300026075 Ga0207708_10001612 Ga0207708_100016122 163
523 3300026078 Ga0207702_10059280 Ga0207702_100592805 163
524 3300026088 Ga0207641_10058565 Ga0207641_100585653 163
525 3300026089 Ga0207648_10187483 Ga0207648_101874831 163
526 3300026095 Ga0207676_10018388 Ga0207676_100183887 163
527 3300026116 Ga0207674_10398887 Ga0207674_103988873 163
528 3300026121 Ga0207683_10391261 Ga0207683_103912612 163
529 3300026142 Ga0207698_10055350 Ga0207698_100553503 163
530 3300028381 Ga0268264_10410038 Ga0268264_104100382 163
531 3300031456 Ga0307513_10002569 Ga0307513_100025699 163
532 3300031616 Ga0307508_10141722 Ga0307508_101417222 163
533 3300035089 Ga0373944_0026988 Ga0373944_0026988_326_826 163
534 3300035116 Ga0373945_0059918 Ga0373945_0059918_338_838 163
535 3300035118 Ga0373954_0070231 Ga0373954_0070231_605_1105 163
536 3300035170 Ga0373943_0011580 Ga0373943_0011580_1335_1835 163
537 3300035171 Ga0373946_0066247 Ga0373946_0066247_789_1289 163
538 3300035172 Ga0373955_0139767 Ga0373955_0139767_230_730 163
539 3300035410 Ga0373924_0041898 Ga0373924_0041898_810_1310 163
540 3300035724 Ga0373933_0075850 Ga0373933_0075850_874_1374 163
541 3300035725 Ga0373947_0015886 Ga0373947_0015886_3022_3522 163
542 3300036401 Ga0373937_0011172 Ga0373937_0011172_3773_4273 163
543 3300037068 Ga0373925_0025135 Ga0373925_0025135_2827_3327 163
544 3300044694 Ga0466963_0398797 Ga0466963_0398797_164_655 163
545 3300044719 Ga0466971_0162254 Ga0466971_0162254_352_843 163
546 3300045836 Ga0466958_0040795 Ga0466958_0040795_1087_1578 163
547 3300045836 Ga0466958_0474518 Ga0466958_0474518_285_776 163
548 3300046454 Ga0495592_0166421 Ga0495592_0166421_325_825 163
549 3300046455 Ga0495603_0097156 Ga0495603_0097156_809_1309 163
550 3300046461 Ga0495641_0013609 Ga0495641_0013609_2230_2730 163
551 3300046463 Ga0495653_0004538 Ga0495653_0004538_1167_1667 163
552 3300046472 Ga0495580_0047205 Ga0495580_0047205_2216_2716 163
553 3300046475 Ga0495639_0003200 Ga0495639_0003200_4787_5287 163
554 3300046499 Ga0495594_0013348 Ga0495594_0013348_192_692 163
555 3300046511 Ga0495608_0013885 Ga0495608_0013885_4995_5528 163
556 3300046514 Ga0495618_0008168 Ga0495618_0008168_4852_5352 163
557 3300046517 Ga0495630_0025918 Ga0495630_0025918_609_1109 163
558 3300046526 Ga0495666_0129169 Ga0495666_0129169_344_844 163
559 3300046529 Ga0495652_0182782 Ga0495652_0182782_982_1482 163
560 3300046533 Ga0495640_0039620 Ga0495640_0039620_1952_2452 163
561 3300046535 Ga0495586_0063868 Ga0495586_0063868_439_939 163
562 3300046536 Ga0495587_0088942 Ga0495587_0088942_242_742 163
563 3300046559 Ga0495667_0001764 Ga0495667_0001764_10228_10728 163
564 3300046642 Ga0495634_0023344 Ga0495634_0023344_3524_4024 163
565 3300046674 Ga0495588_0017724 Ga0495588_0017724_1924_2424 163
566 3300046675 Ga0495657_0002947 Ga0495657_0002947_9720_10220 163
567 3300046680 Ga0495646_0117664 Ga0495646_0117664_81_581 163
568 3300046680 Ga0495646_0506797 Ga0495646_0506797_26_526 163
569 3300046681 Ga0495647_0034373 Ga0495647_0034373_633_1133 163
570 3300046683 Ga0495658_0003530 Ga0495658_0003530_3596_4096 163
571 3300046689 Ga0495613_0010160 Ga0495613_0010160_3684_4184 163
572 3300046690 Ga0495624_0011009 Ga0495624_0011009_3527_4060 163
573 3300046690 Ga0495624_0356740 Ga0495624_0356740_158_685 163
574 3300046809 Ga0495600_0017157 Ga0495600_0017157_1023_1523 163
575 3300047315 Ga0495581_0017634 Ga0495581_0017634_3312_3812 163
576 3300047317 Ga0495604_0013106 Ga0495604_0013106_1519_2019 163
577 3300047319 Ga0495674_0024837 Ga0495674_0024837_688_1215 163
578 3300047319 Ga0495674_0034269 Ga0495674_0034269_4008_4508 163
579 3300047321 Ga0495676_0005830 Ga0495676_0005830_9440_9940 163
580 3300047322 Ga0495680_0009868 Ga0495680_0009868_1273_1773 163
581 3300047471 Ga0495684_0004208 Ga0495684_0004208_2785_3285 163
582 3300047673 Ga0495593_0013915 Ga0495593_0013915_3477_3977 163
583 3300048088 Ga0495602_0730676 Ga0495602_0730676_113_613 163
584 3300048903 Ga0496100_0029937 Ga0496100_0029937_1141_1632 163
585 3300048903 Ga0496100_0229885 Ga0496100_0229885_420_926 163
586 3300048904 Ga0496101_0017662 Ga0496101_0017662_873_1364 163
587 3300048905 Ga0496102_0089693 Ga0496102_0089693_1060_1551 163
588 3300048905 Ga0496102_0740709 Ga0496102_0740709_175_666 163
589 3300048906 Ga0496103_0018758 Ga0496103_0018758_1249_1740 163
590 3300048907 Ga0496104_0023168 Ga0496104_0023168_707_1198 163
591 3300048907 Ga0496104_0117648 Ga0496104_0117648_121_612 163
592 3300048908 Ga0496105_0018448 Ga0496105_0018448_1642_2133 163
593 3300048909 Ga0496106_0021970 Ga0496106_0021970_1167_1658 163
594 3300048910 Ga0496107_0127629 Ga0496107_0127629_1079_1570 163
595 3300048911 Ga0496108_0005484 Ga0496108_0005484_4985_5476 163
596 3300048912 Ga0496109_0018316 Ga0496109_0018316_4179_4670 163
597 3300048912 Ga0496109_0050143 Ga0496109_0050143_975_1466 163
598 3300048913 Ga0496110_0003522 Ga0496110_0003522_8799_9290 163
599 3300048913 Ga0496110_0022592 Ga0496110_0022592_3709_4200 163
600 3300048914 Ga0496111_0006940 Ga0496111_0006940_2193_2684 163
601 3300048915 Ga0496112_0025202 Ga0496112_0025202_1239_1730 163
602 3300048916 Ga0496113_0022346 Ga0496113_0022346_1822_2313 163
603 3300048916 Ga0496113_0180956 Ga0496113_0180956_264_755 163
604 3300048917 Ga0496114_0825259 Ga0496114_0825259_248_739 163
605 3300048918 Ga0496115_0188317 Ga0496115_0188317_414_905 163
606 3300049584 Ga0501068_0486623 Ga0501068_0486623_65_556 163
607 3300050510 nmdc:mga06r32_1177145_c1 nmdc:mga06r32_1177145_c1_69_560 163
608 3300050510 nmdc:mga06r32_1276631_c1 nmdc:mga06r32_1276631_c1_17_508 163
609 3300050512 nmdc:mga0n895_794615_c1 nmdc:mga0n895_794615_c1_229_720 163
610 3300050513 nmdc:mga0rr50_913049_c1 nmdc:mga0rr50_913049_c1_75_566 163
611 3300053077 Ga0495601_0268474 Ga0495601_0268474_385_912 163
612 3300053078 Ga0495612_0096718 Ga0495612_0096718_302_829 163
613 3300053084 Ga0495595_0022864 Ga0495595_0022864_699_1199 163
614 3300053085 Ga0495619_0017914 Ga0495619_0017914_2216_2716 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

57

185

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yf5-assembly1.cif.gz_A crystal structure of rv1284 in the presence of polycarpine at acidic ph 0.968 1 163
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.9333 1 163
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.9279 1 163
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.9264 1 163
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.9233 1 163
ID Description Score Start End Superfamily
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9699 1 163 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9571 1 163 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9513 1 163 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9333 1 163 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9279 1 163 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A5N0UMF2-F1-model_v4 Carbonic anhydrase 0.998 37 163 GO:0004089
GO:0008270
AF-A0A7X3VUN9-F1-model_v4 Carbonic anhydrase 0.9938 37 163 GO:0004089
GO:0008270
AF-X8C1Z8-F1-model_v4 deleted 0.9921 34 149
AF-A0A7L7MHV6-F1-model_v4 Carbonic anhydrase 0.9911 26 163 GO:0004089
GO:0008270
AF-A0A5N0UMF2-F1-model_v4 Carbonic anhydrase 0.9902 37 163 GO:0004089
GO:0008270

Feature Viewer

pLDDT pTM Quality
95.84 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map