F469403
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 614 | 338 | 596 | 163 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2751185725|2753035381 |
| Length | 189 |
| Sequence | LIMAADCVGITVAATLSARSCTHEHECMTVTDEYLDNNRAYAADFSGPLPLPPSKHVAVVACMDARLNIYGILGLEDGEAHVIRNAGGVITDDEIRSLAISQRLLGTTEIILIHHTDCGMLTFTDDDFKRAIQDEVGVKPAWSAEAFSDLDEDVRQSLARIEKSPFITKTTSLRGFVFDVATGKLNEVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 4 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 5 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 6 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 7 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 8 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 9 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 10 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 11 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 12 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 13 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 14 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 15 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 16 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 17 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 22 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 222 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 223 | 3300033548 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 | Metagenome | Unclassified |
| 224 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 225 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 245 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 246 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 247 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 251 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 252 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 253 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 302 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 317 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 318 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 319 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 321 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 337 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 338 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.46 |
| Metatranscriptomes | 2.61 |
| Isolates | 2.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.42 |
| Nodule | 0 |
| Rhizoplane | 7.98 |
| Rhizosphere | 84.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10064511 | 3300002075 | Bacteria | 754 |
| 2 | JGI24033J26618_1027155 | 3300002155 | Bacteria | 757 |
| 3 | JGI24751J29686_10003840 | 3300002459 | Bacteria | 3032 |
| 4 | JGI25406J46586_10002057 | 3300003203 | Bacteria | 9500 |
| 5 | JGI25407J50210_10001230 | 3300003373 | Bacteria | 5719 |
| 6 | JGI25405J52794_10019198 | 3300003911 | Bacteria | 1369 |
| 7 | Ga0070658_10024804 | 3300005327 | Bacteria | 4809 |
| 8 | Ga0070658_10191274 | 3300005327 | Bacteria | 1725 |
| 9 | Ga0070658_10641174 | 3300005327 | Bacteria | 921 |
| 10 | Ga0070676_10052877 | 3300005328 | Bacteria | 2390 |
| 11 | Ga0070683_100000645 | 3300005329 | Bacteria | 25129 |
| 12 | Ga0070683_100008181 | 3300005329 | Bacteria | 8885 |
| 13 | Ga0070683_101001103 | 3300005329 | Bacteria | 802 |
| 14 | Ga0070683_101008147 | 3300005329 | Bacteria | 799 |
| 15 | Ga0070690_100791185 | 3300005330 | Bacteria | 735 |
| 16 | Ga0070670_101794019 | 3300005331 | Bacteria | 565 |
| 17 | Ga0068869_100013076 | 3300005334 | Bacteria | 5508 |
| 18 | Ga0068869_100013296 | 3300005334 | Bacteria | 5471 |
| 19 | Ga0068869_100257909 | 3300005334 | Bacteria | 1395 |
| 20 | Ga0070666_10317715 | 3300005335 | Bacteria | 1111 |
| 21 | Ga0070680_100065730 | 3300005336 | Bacteria | 2972 |
| 22 | Ga0070682_100007182 | 3300005337 | Bacteria | 6274 |
| 23 | Ga0070682_100007928 | 3300005337 | Bacteria | 5974 |
| 24 | Ga0070682_100216067 | 3300005337 | Bacteria | 1362 |
| 25 | Ga0068868_100016666 | 3300005338 | Bacteria | 5463 |
| 26 | Ga0068868_100055286 | 3300005338 | Bacteria | 3131 |
| 27 | Ga0070660_100032361 | 3300005339 | Bacteria | 3934 |
| 28 | Ga0070660_100102593 | 3300005339 | Bacteria | 2267 |
| 29 | Ga0070689_100064431 | 3300005340 | Bacteria | 2853 |
| 30 | Ga0070691_10045552 | 3300005341 | Bacteria | 2082 |
| 31 | Ga0070691_10477458 | 3300005341 | Bacteria | 717 |
| 32 | Ga0070661_100012025 | 3300005344 | Bacteria | 6047 |
| 33 | Ga0070692_10118059 | 3300005345 | Bacteria | 1475 |
| 34 | Ga0070668_100358589 | 3300005347 | Bacteria | 1236 |
| 35 | Ga0070675_100074866 | 3300005354 | Bacteria | 2814 |
| 36 | Ga0070675_100079377 | 3300005354 | Bacteria | 2734 |
| 37 | Ga0070675_100336247 | 3300005354 | Bacteria | 1337 |
| 38 | Ga0070671_100000635 | 3300005355 | Bacteria | 25088 |
| 39 | Ga0070671_100097460 | 3300005355 | Bacteria | 2466 |
| 40 | Ga0070674_100622438 | 3300005356 | Bacteria | 915 |
| 41 | Ga0070673_100099907 | 3300005364 | Bacteria | 2388 |
| 42 | Ga0070673_100351819 | 3300005364 | Bacteria | 1308 |
| 43 | Ga0070688_100033036 | 3300005365 | Bacteria | 3125 |
| 44 | Ga0070659_100078634 | 3300005366 | Bacteria | 2631 |
| 45 | Ga0070667_100358745 | 3300005367 | Bacteria | 1321 |
| 46 | Ga0070709_10041051 | 3300005434 | Bacteria | 2848 |
| 47 | Ga0070709_10083245 | 3300005434 | Bacteria | 2092 |
| 48 | Ga0070714_100061206 | 3300005435 | Bacteria | 3233 |
| 49 | Ga0070714_101642811 | 3300005435 | Bacteria | 628 |
| 50 | Ga0070713_100002466 | 3300005436 | Bacteria | 12073 |
| 51 | Ga0070710_10070565 | 3300005437 | Bacteria | 2012 |
| 52 | Ga0070710_10182468 | 3300005437 | Bacteria | 1315 |
| 53 | Ga0070711_100046256 | 3300005439 | Bacteria | 2964 |
| 54 | Ga0070711_100463541 | 3300005439 | Bacteria | 1039 |
| 55 | Ga0070705_100178902 | 3300005440 | Bacteria | 1435 |
| 56 | Ga0070700_100008738 | 3300005441 | Bacteria | 5528 |
| 57 | Ga0070700_100032739 | 3300005441 | Bacteria | 3127 |
| 58 | Ga0070708_100111783 | 3300005445 | Bacteria | 2511 |
| 59 | Ga0070663_100059236 | 3300005455 | Bacteria | 2752 |
| 60 | Ga0070663_100144532 | 3300005455 | Bacteria | 1819 |
| 61 | Ga0070678_100016305 | 3300005456 | Bacteria | 4751 |
| 62 | Ga0070678_100017872 | 3300005456 | Bacteria | 4579 |
| 63 | Ga0070662_100171939 | 3300005457 | Bacteria | 1702 |
| 64 | Ga0070681_10004229 | 3300005458 | Bacteria | 13603 |
| 65 | Ga0070685_10168581 | 3300005466 | Bacteria | 1402 |
| 66 | Ga0070706_100003943 | 3300005467 | Bacteria | 14457 |
| 67 | Ga0070706_100008907 | 3300005467 | Bacteria | 9345 |
| 68 | Ga0070706_100674069 | 3300005467 | Bacteria | 959 |
| 69 | Ga0070707_100124620 | 3300005468 | Bacteria | 2502 |
| 70 | Ga0070707_100423405 | 3300005468 | Bacteria | 1292 |
| 71 | Ga0070698_100007953 | 3300005471 | Bacteria | 11471 |
| 72 | Ga0070679_100009544 | 3300005530 | Bacteria | 9179 |
| 73 | Ga0070679_100415050 | 3300005530 | Bacteria | 1292 |
| 74 | Ga0070679_100501004 | 3300005530 | Bacteria | 1158 |
| 75 | Ga0070679_100657368 | 3300005530 | Bacteria | 991 |
| 76 | Ga0070684_100003617 | 3300005535 | Bacteria | 11636 |
| 77 | Ga0070684_100046824 | 3300005535 | Bacteria | 3747 |
| 78 | Ga0070684_100616036 | 3300005535 | Bacteria | 1010 |
| 79 | Ga0070697_101430015 | 3300005536 | Bacteria | 618 |
| 80 | Ga0068853_100103857 | 3300005539 | Bacteria | 2516 |
| 81 | Ga0068853_100977342 | 3300005539 | Bacteria | 815 |
| 82 | Ga0070686_100447943 | 3300005544 | Bacteria | 992 |
| 83 | Ga0070695_100545892 | 3300005545 | Bacteria | 903 |
| 84 | Ga0070693_100003642 | 3300005547 | Bacteria | 7202 |
| 85 | Ga0070665_100079122 | 3300005548 | Bacteria | 3293 |
| 86 | Ga0070665_100109040 | 3300005548 | Bacteria | 2771 |
| 87 | Ga0070664_100003373 | 3300005564 | Bacteria | 12904 |
| 88 | Ga0070664_100004267 | 3300005564 | Bacteria | 11491 |
| 89 | Ga0070664_100653340 | 3300005564 | Bacteria | 977 |
| 90 | Ga0068857_100113374 | 3300005577 | Bacteria | 2437 |
| 91 | Ga0068857_100635847 | 3300005577 | Bacteria | 1010 |
| 92 | Ga0068854_100112119 | 3300005578 | Bacteria | 2059 |
| 93 | Ga0068854_100425001 | 3300005578 | Bacteria | 1104 |
| 94 | Ga0068856_100005907 | 3300005614 | Bacteria | 12057 |
| 95 | Ga0068856_100014656 | 3300005614 | Bacteria | 7570 |
| 96 | Ga0068856_100022369 | 3300005614 | Bacteria | 6145 |
| 97 | Ga0068856_100099071 | 3300005614 | Bacteria | 2905 |
| 98 | Ga0068856_100587025 | 3300005614 | Bacteria | 1135 |
| 99 | Ga0068856_101305631 | 3300005614 | Bacteria | 741 |
| 100 | Ga0070702_100011239 | 3300005615 | Bacteria | 4447 |
| 101 | Ga0070702_100076891 | 3300005615 | Bacteria | 1988 |
| 102 | Ga0070702_100749298 | 3300005615 | Bacteria | 750 |
| 103 | Ga0068852_100043957 | 3300005616 | Bacteria | 3791 |
| 104 | Ga0068859_101673156 | 3300005617 | Bacteria | 703 |
| 105 | Ga0068864_100033409 | 3300005618 | Bacteria | 4373 |
| 106 | Ga0068864_100075568 | 3300005618 | Bacteria | 2942 |
| 107 | Ga0068864_100153856 | 3300005618 | Bacteria | 2086 |
| 108 | Ga0068866_10148215 | 3300005718 | Bacteria | 1356 |
| 109 | Ga0068851_10519524 | 3300005834 | Bacteria | 716 |
| 110 | Ga0068870_10005633 | 3300005840 | Bacteria | 5478 |
| 111 | Ga0068863_100045066 | 3300005841 | Bacteria | 4185 |
| 112 | Ga0068863_100045100 | 3300005841 | Bacteria | 4184 |
| 113 | Ga0068863_100567240 | 3300005841 | Bacteria | 1122 |
| 114 | Ga0068858_100021168 | 3300005842 | Bacteria | 6072 |
| 115 | Ga0068858_100810391 | 3300005842 | Bacteria | 914 |
| 116 | Ga0068860_100467415 | 3300005843 | Bacteria | 1256 |
| 117 | Ga0068860_102095375 | 3300005843 | Bacteria | 587 |
| 118 | Ga0081455_10000112 | 3300005937 | Bacteria | 92158 |
| 119 | Ga0081538_10001711 | 3300005981 | Bacteria | 22362 |
| 120 | Ga0081539_10000417 | 3300005985 | Bacteria | 90642 |
| 121 | Ga0070717_10062409 | 3300006028 | Bacteria | 3090 |
| 122 | Ga0070717_10305605 | 3300006028 | Bacteria | 1414 |
| 123 | Ga0070717_10528098 | 3300006028 | Bacteria | 1068 |
| 124 | Ga0070717_11202188 | 3300006028 | Bacteria | 690 |
| 125 | Ga0075365_10032360 | 3300006038 | Bacteria | 3361 |
| 126 | Ga0075363_100020237 | 3300006048 | Bacteria | 3335 |
| 127 | Ga0075363_100231665 | 3300006048 | Bacteria | 1060 |
| 128 | Ga0075364_10236582 | 3300006051 | Bacteria | 1240 |
| 129 | Ga0075432_10075403 | 3300006058 | Bacteria | 1216 |
| 130 | Ga0070715_10159448 | 3300006163 | Bacteria | 1113 |
| 131 | Ga0070712_100065485 | 3300006175 | Bacteria | 2579 |
| 132 | Ga0070712_100306531 | 3300006175 | Bacteria | 1287 |
| 133 | Ga0075367_10087339 | 3300006178 | Bacteria | 1894 |
| 134 | Ga0075367_10531029 | 3300006178 | Bacteria | 747 |
| 135 | Ga0075369_10049567 | 3300006186 | Bacteria | 1814 |
| 136 | Ga0097621_100044452 | 3300006237 | Bacteria | 3583 |
| 137 | Ga0075370_10110482 | 3300006353 | Bacteria | 1596 |
| 138 | Ga0075370_10382380 | 3300006353 | Bacteria | 843 |
| 139 | Ga0068871_100034451 | 3300006358 | Bacteria | 4018 |
| 140 | Ga0068871_100101384 | 3300006358 | Bacteria | 2413 |
| 141 | Ga0075428_100855611 | 3300006844 | Bacteria | 965 |
| 142 | Ga0075431_100534283 | 3300006847 | Bacteria | 1161 |
| 143 | Ga0075433_10034214 | 3300006852 | Bacteria | 4362 |
| 144 | Ga0075433_10257675 | 3300006852 | Bacteria | 1547 |
| 145 | Ga0075434_101584206 | 3300006871 | Bacteria | 664 |
| 146 | Ga0068865_100052661 | 3300006881 | Bacteria | 2822 |
| 147 | Ga0075436_100004718 | 3300006914 | Bacteria | 9350 |
| 148 | Ga0097620_101673132 | 3300006931 | Bacteria | 703 |
| 149 | Ga0075435_100481069 | 3300007076 | Bacteria | 1072 |
| 150 | Ga0111539_10185986 | 3300009094 | Bacteria | 2426 |
| 151 | Ga0105245_10004181 | 3300009098 | Bacteria | 12821 |
| 152 | Ga0105245_10024376 | 3300009098 | Bacteria | 5312 |
| 153 | Ga0105245_10883605 | 3300009098 | Bacteria | 935 |
| 154 | Ga0114129_10678678 | 3300009147 | Bacteria | 1327 |
| 155 | Ga0114129_12041070 | 3300009147 | Bacteria | 693 |
| 156 | Ga0105243_10348262 | 3300009148 | Bacteria | 1359 |
| 157 | Ga0105241_10091554 | 3300009174 | Bacteria | 2400 |
| 158 | Ga0105241_10440076 | 3300009174 | Bacteria | 1151 |
| 159 | Ga0105248_10112801 | 3300009177 | Bacteria | 3066 |
| 160 | Ga0105248_10188794 | 3300009177 | Bacteria | 2322 |
| 161 | Ga0105248_11240191 | 3300009177 | Bacteria | 843 |
| 162 | Ga0105237_10142080 | 3300009545 | Bacteria | 2395 |
| 163 | Ga0105237_10247018 | 3300009545 | Bacteria | 1786 |
| 164 | Ga0105237_10316468 | 3300009545 | Bacteria | 1564 |
| 165 | Ga0105238_10143677 | 3300009551 | Bacteria | 2363 |
| 166 | Ga0105238_10150719 | 3300009551 | Bacteria | 2301 |
| 167 | Ga0105238_11119585 | 3300009551 | Bacteria | 810 |
| 168 | Ga0105239_10051102 | 3300010375 | Bacteria | 4532 |
| 169 | Ga0105239_10124927 | 3300010375 | Bacteria | 2859 |
| 170 | Ga0105239_10265692 | 3300010375 | Bacteria | 1929 |
| 171 | Ga0105239_10339748 | 3300010375 | Bacteria | 1694 |
| 172 | Ga0105239_10839214 | 3300010375 | Bacteria | 1053 |
| 173 | Ga0105246_10004760 | 3300011119 | Bacteria | 8265 |
| 174 | Ga0105246_10007691 | 3300011119 | Bacteria | 6614 |
| 175 | Ga0157313_1011581 | 3300012503 | Bacteria | 769 |
| 176 | Ga0157373_10029646 | 3300013100 | Bacteria | 3940 |
| 177 | Ga0157373_10177090 | 3300013100 | Bacteria | 1501 |
| 178 | Ga0157371_10080858 | 3300013102 | Bacteria | 2301 |
| 179 | Ga0157371_10099868 | 3300013102 | Bacteria | 2058 |
| 180 | Ga0157370_10059246 | 3300013104 | Bacteria | 3639 |
| 181 | Ga0157370_10167821 | 3300013104 | Bacteria | 2041 |
| 182 | Ga0157370_10271781 | 3300013104 | Bacteria | 1566 |
| 183 | Ga0157369_10029298 | 3300013105 | Bacteria | 6085 |
| 184 | Ga0157369_10074949 | 3300013105 | Bacteria | 3628 |
| 185 | Ga0157369_10120886 | 3300013105 | Bacteria | 2779 |
| 186 | Ga0157369_10352452 | 3300013105 | Bacteria | 1528 |
| 187 | Ga0157369_10567396 | 3300013105 | Bacteria | 1172 |
| 188 | Ga0157369_10573477 | 3300013105 | Bacteria | 1165 |
| 189 | Ga0157369_10910826 | 3300013105 | Bacteria | 902 |
| 190 | Ga0157374_10007098 | 3300013296 | Bacteria | 9536 |
| 191 | Ga0157374_10030772 | 3300013296 | Bacteria | 4875 |
| 192 | Ga0157374_10097991 | 3300013296 | Bacteria | 2806 |
| 193 | Ga0157374_10780301 | 3300013296 | Bacteria | 971 |
| 194 | Ga0157378_10268853 | 3300013297 | Bacteria | 1639 |
| 195 | Ga0163162_10216950 | 3300013306 | Bacteria | 2043 |
| 196 | Ga0157372_10007491 | 3300013307 | Bacteria | 11606 |
| 197 | Ga0157372_10012336 | 3300013307 | Bacteria | 9107 |
| 198 | Ga0157372_10058337 | 3300013307 | Bacteria | 4314 |
| 199 | Ga0157372_10061049 | 3300013307 | Bacteria | 4220 |
| 200 | Ga0157375_10017301 | 3300013308 | Bacteria | 6503 |
| 201 | Ga0157375_10041386 | 3300013308 | Bacteria | 4449 |
| 202 | Ga0157375_10292475 | 3300013308 | Bacteria | 1792 |
| 203 | Ga0163163_10024547 | 3300014325 | Bacteria | 5738 |
| 204 | Ga0163163_10165552 | 3300014325 | Bacteria | 2257 |
| 205 | Ga0163163_10562139 | 3300014325 | Bacteria | 1203 |
| 206 | Ga0163163_10830422 | 3300014325 | Bacteria | 987 |
| 207 | Ga0157380_10057796 | 3300014326 | Bacteria | 3090 |
| 208 | Ga0182008_10082452 | 3300014497 | Bacteria | 1583 |
| 209 | Ga0157377_10000822 | 3300014745 | Bacteria | 12885 |
| 210 | Ga0157377_10003853 | 3300014745 | Bacteria | 6827 |
| 211 | Ga0157377_10004097 | 3300014745 | Bacteria | 6657 |
| 212 | Ga0157379_10028595 | 3300014968 | Bacteria | 4958 |
| 213 | Ga0157379_10126152 | 3300014968 | Bacteria | 2303 |
| 214 | Ga0157379_10477852 | 3300014968 | Bacteria | 1153 |
| 215 | Ga0157376_10025716 | 3300014969 | Bacteria | 4639 |
| 216 | Ga0157376_10044482 | 3300014969 | Bacteria | 3650 |
| 217 | Ga0157376_10190061 | 3300014969 | Bacteria | 1882 |
| 218 | Ga0157376_12061311 | 3300014969 | Bacteria | 608 |
| 219 | Ga0163161_10056268 | 3300017792 | Bacteria | 2857 |
| 220 | Ga0163161_11696552 | 3300017792 | Bacteria | 559 |
| 221 | Ga0197907_11109537 | 3300020069 | Bacteria | 1202 |
| 222 | Ga0206356_10615563 | 3300020070 | Bacteria | 827 |
| 223 | Ga0206356_11021213 | 3300020070 | Bacteria | 887 |
| 224 | Ga0206349_1672554 | 3300020075 | Bacteria | 787 |
| 225 | Ga0206349_1791822 | 3300020075 | Bacteria | 956 |
| 226 | Ga0206349_1905463 | 3300020075 | Bacteria | 561 |
| 227 | Ga0206352_10509604 | 3300020078 | Bacteria | 626 |
| 228 | Ga0206354_11531839 | 3300020081 | Bacteria | 640 |
| 229 | Ga0206353_11048529 | 3300020082 | Bacteria | 636 |
| 230 | Ga0206353_11064492 | 3300020082 | Bacteria | 1500 |
| 231 | Ga0206353_11722789 | 3300020082 | Bacteria | 756 |
| 232 | Ga0213875_10001884 | 3300021388 | Bacteria | 12993 |
| 233 | Ga0224712_10040877 | 3300022467 | Bacteria | 1747 |
| 234 | Ga0224712_10199793 | 3300022467 | Bacteria | 908 |
| 235 | Ga0224712_10339153 | 3300022467 | Bacteria | 709 |
| 236 | Ga0224712_10345686 | 3300022467 | Bacteria | 702 |
| 237 | Ga0207656_10124637 | 3300025321 | Bacteria | 1202 |
| 238 | Ga0207692_10052050 | 3300025898 | Bacteria | 2079 |
| 239 | Ga0207692_10067245 | 3300025898 | Bacteria | 1875 |
| 240 | Ga0207692_10117212 | 3300025898 | Bacteria | 1486 |
| 241 | Ga0207688_10000691 | 3300025901 | Bacteria | 16661 |
| 242 | Ga0207688_10414636 | 3300025901 | Bacteria | 836 |
| 243 | Ga0207647_10071749 | 3300025904 | Bacteria | 2089 |
| 244 | Ga0207647_10206504 | 3300025904 | Bacteria | 1135 |
| 245 | Ga0207699_10040121 | 3300025906 | Bacteria | 2696 |
| 246 | Ga0207699_10064303 | 3300025906 | Bacteria | 2219 |
| 247 | Ga0207645_10258558 | 3300025907 | Bacteria | 1153 |
| 248 | Ga0207643_10000039 | 3300025908 | Bacteria | 86154 |
| 249 | Ga0207705_10039796 | 3300025909 | Bacteria | 3369 |
| 250 | Ga0207705_10327046 | 3300025909 | Bacteria | 1178 |
| 251 | Ga0207705_10570056 | 3300025909 | Bacteria | 880 |
| 252 | Ga0207705_10867313 | 3300025909 | Bacteria | 700 |
| 253 | Ga0207684_10002293 | 3300025910 | Bacteria | 19463 |
| 254 | Ga0207684_10268814 | 3300025910 | Bacteria | 1471 |
| 255 | Ga0207684_10285072 | 3300025910 | Bacteria | 1424 |
| 256 | Ga0207654_10007978 | 3300025911 | Bacteria | 5338 |
| 257 | Ga0207707_10205762 | 3300025912 | Bacteria | 1715 |
| 258 | Ga0207671_10217023 | 3300025914 | Bacteria | 1498 |
| 259 | Ga0207693_10022527 | 3300025915 | Bacteria | 5006 |
| 260 | Ga0207693_10037089 | 3300025915 | Bacteria | 3841 |
| 261 | Ga0207693_10090274 | 3300025915 | Bacteria | 2402 |
| 262 | Ga0207693_10106583 | 3300025915 | Bacteria | 2199 |
| 263 | Ga0207693_10145393 | 3300025915 | Bacteria | 1864 |
| 264 | Ga0207663_10359961 | 3300025916 | Bacteria | 1104 |
| 265 | Ga0207660_10031660 | 3300025917 | Bacteria | 3645 |
| 266 | Ga0207657_10022954 | 3300025919 | Bacteria | 5822 |
| 267 | Ga0207657_10054199 | 3300025919 | Bacteria | 3469 |
| 268 | Ga0207657_10066688 | 3300025919 | Bacteria | 3063 |
| 269 | Ga0207649_10127350 | 3300025920 | Bacteria | 1725 |
| 270 | Ga0207649_10362972 | 3300025920 | Bacteria | 1075 |
| 271 | Ga0207652_10081687 | 3300025921 | Bacteria | 2827 |
| 272 | Ga0207652_10387601 | 3300025921 | Bacteria | 1261 |
| 273 | Ga0207652_10397810 | 3300025921 | Bacteria | 1243 |
| 274 | Ga0207646_10027431 | 3300025922 | Bacteria | 5193 |
| 275 | Ga0207646_10509724 | 3300025922 | Bacteria | 1083 |
| 276 | Ga0207694_10412817 | 3300025924 | Bacteria | 1124 |
| 277 | Ga0207650_10021059 | 3300025925 | Bacteria | 4606 |
| 278 | Ga0207650_11464015 | 3300025925 | Bacteria | 581 |
| 279 | Ga0207659_10039209 | 3300025926 | Bacteria | 3302 |
| 280 | Ga0207659_10488354 | 3300025926 | Bacteria | 1041 |
| 281 | Ga0207687_10093558 | 3300025927 | Bacteria | 2198 |
| 282 | Ga0207687_10115745 | 3300025927 | Bacteria | 1998 |
| 283 | Ga0207687_10201867 | 3300025927 | Bacteria | 1555 |
| 284 | Ga0207700_10039306 | 3300025928 | Bacteria | 3443 |
| 285 | Ga0207664_10133982 | 3300025929 | Bacteria | 2088 |
| 286 | Ga0207664_10224969 | 3300025929 | Bacteria | 1629 |
| 287 | Ga0207664_11207215 | 3300025929 | Bacteria | 674 |
| 288 | Ga0207644_10031153 | 3300025931 | Bacteria | 3714 |
| 289 | Ga0207644_10096153 | 3300025931 | Bacteria | 2216 |
| 290 | Ga0207690_10071828 | 3300025932 | Bacteria | 2388 |
| 291 | Ga0207709_10032271 | 3300025935 | Bacteria | 3065 |
| 292 | Ga0207709_10149513 | 3300025935 | Bacteria | 1616 |
| 293 | Ga0207709_10216463 | 3300025935 | Bacteria | 1378 |
| 294 | Ga0207670_10009525 | 3300025936 | Bacteria | 5546 |
| 295 | Ga0207669_10149399 | 3300025937 | Bacteria | 1634 |
| 296 | Ga0207691_10836918 | 3300025940 | Bacteria | 772 |
| 297 | Ga0207711_10044758 | 3300025941 | Bacteria | 3780 |
| 298 | Ga0207711_10146655 | 3300025941 | Bacteria | 2127 |
| 299 | Ga0207711_10417079 | 3300025941 | Bacteria | 1248 |
| 300 | Ga0207689_10004582 | 3300025942 | Bacteria | 12514 |
| 301 | Ga0207689_10040643 | 3300025942 | Bacteria | 3849 |
| 302 | Ga0207661_10000277 | 3300025944 | Bacteria | 32727 |
| 303 | Ga0207661_10056730 | 3300025944 | Bacteria | 3145 |
| 304 | Ga0207661_10075267 | 3300025944 | Bacteria | 2769 |
| 305 | Ga0207661_10220673 | 3300025944 | Bacteria | 1675 |
| 306 | Ga0207661_10267456 | 3300025944 | Bacteria | 1525 |
| 307 | Ga0207679_10022595 | 3300025945 | Bacteria | 4285 |
| 308 | Ga0207679_11034076 | 3300025945 | Bacteria | 753 |
| 309 | Ga0207712_10136107 | 3300025961 | Bacteria | 1879 |
| 310 | Ga0207640_10027186 | 3300025981 | Bacteria | 3483 |
| 311 | Ga0207640_10102043 | 3300025981 | Bacteria | 2014 |
| 312 | Ga0207658_10299078 | 3300025986 | Bacteria | 1386 |
| 313 | Ga0207677_10038846 | 3300026023 | Bacteria | 3124 |
| 314 | Ga0207677_10370233 | 3300026023 | Bacteria | 1206 |
| 315 | Ga0207703_10056001 | 3300026035 | Bacteria | 3209 |
| 316 | Ga0207703_10425696 | 3300026035 | Bacteria | 1236 |
| 317 | Ga0207703_10429769 | 3300026035 | Bacteria | 1230 |
| 318 | Ga0207703_11686984 | 3300026035 | Bacteria | 609 |
| 319 | Ga0207639_10102241 | 3300026041 | Bacteria | 2319 |
| 320 | Ga0207678_10001338 | 3300026067 | Bacteria | 22707 |
| 321 | Ga0207678_10053507 | 3300026067 | Bacteria | 3478 |
| 322 | Ga0207708_10001612 | 3300026075 | Bacteria | 16825 |
| 323 | Ga0207708_10043866 | 3300026075 | Bacteria | 3408 |
| 324 | Ga0207702_10003837 | 3300026078 | Bacteria | 13562 |
| 325 | Ga0207702_10040119 | 3300026078 | Bacteria | 3924 |
| 326 | Ga0207702_10059280 | 3300026078 | Bacteria | 3260 |
| 327 | Ga0207702_10223973 | 3300026078 | Bacteria | 1754 |
| 328 | Ga0207702_10283693 | 3300026078 | Bacteria | 1566 |
| 329 | Ga0207702_10941630 | 3300026078 | Bacteria | 856 |
| 330 | Ga0207641_10058565 | 3300026088 | Bacteria | 3279 |
| 331 | Ga0207641_10118247 | 3300026088 | Bacteria | 2361 |
| 332 | Ga0207641_10152581 | 3300026088 | Bacteria | 2093 |
| 333 | Ga0207648_10187483 | 3300026089 | Bacteria | 1832 |
| 334 | Ga0207676_10018388 | 3300026095 | Bacteria | 5080 |
| 335 | Ga0207676_10177361 | 3300026095 | Bacteria | 1862 |
| 336 | Ga0207674_10061677 | 3300026116 | Bacteria | 3788 |
| 337 | Ga0207674_10078182 | 3300026116 | Bacteria | 3314 |
| 338 | Ga0207674_10398887 | 3300026116 | Bacteria | 1329 |
| 339 | Ga0207674_10758245 | 3300026116 | Bacteria | 937 |
| 340 | Ga0207674_11039366 | 3300026116 | Bacteria | 788 |
| 341 | Ga0207683_10036359 | 3300026121 | Bacteria | 4288 |
| 342 | Ga0207683_10391261 | 3300026121 | Bacteria | 1278 |
| 343 | Ga0207698_10055350 | 3300026142 | Bacteria | 3057 |
| 344 | Ga0207698_10118684 | 3300026142 | Bacteria | 2234 |
| 345 | Ga0207428_10014004 | 3300027907 | Bacteria | 6985 |
| 346 | Ga0268266_10202511 | 3300028379 | Bacteria | 1817 |
| 347 | Ga0268266_10573509 | 3300028379 | Bacteria | 1082 |
| 348 | Ga0268264_10063293 | 3300028381 | Bacteria | 3109 |
| 349 | Ga0268264_10410038 | 3300028381 | Bacteria | 1304 |
| 350 | Ga0265337_1005578 | 3300028556 | Bacteria | 4978 |
| 351 | Ga0265326_10009317 | 3300028558 | Bacteria | 2934 |
| 352 | Ga0265319_1016937 | 3300028563 | Bacteria | 2784 |
| 353 | Ga0265334_10001541 | 3300028573 | Bacteria | 11128 |
| 354 | Ga0265318_10115913 | 3300028577 | Bacteria | 984 |
| 355 | Ga0265323_10022009 | 3300028653 | Bacteria | 2438 |
| 356 | Ga0265322_10015885 | 3300028654 | Bacteria | 2173 |
| 357 | Ga0265336_10019609 | 3300028666 | Bacteria | 2180 |
| 358 | Ga0307515_10054619 | 3300028794 | Bacteria | 5859 |
| 359 | Ga0265338_10054489 | 3300028800 | Bacteria | 3565 |
| 360 | Ga0265338_10098405 | 3300028800 | Bacteria | 2393 |
| 361 | Ga0265338_10107380 | 3300028800 | Bacteria | 2257 |
| 362 | Ga0265324_10023583 | 3300029957 | Bacteria | 2191 |
| 363 | Ga0265332_10020522 | 3300031238 | Bacteria | 2916 |
| 364 | Ga0265320_10028769 | 3300031240 | Bacteria | 2882 |
| 365 | Ga0265325_10051086 | 3300031241 | Bacteria | 2126 |
| 366 | Ga0265340_10008327 | 3300031247 | Bacteria | 5602 |
| 367 | Ga0265339_10018443 | 3300031249 | Bacteria | 4113 |
| 368 | Ga0265316_10108575 | 3300031344 | Bacteria | 2103 |
| 369 | Ga0307513_10002569 | 3300031456 | Bacteria | 25080 |
| 370 | Ga0307509_10265069 | 3300031507 | Bacteria | 1490 |
| 371 | Ga0307509_10498324 | 3300031507 | Bacteria | 903 |
| 372 | Ga0307508_10141722 | 3300031616 | Bacteria | 2008 |
| 373 | Ga0316575_10000001 | 3300031665 | Bacteria | 151281 |
| 374 | Ga0265314_10003585 | 3300031711 | Bacteria | 14949 |
| 375 | Ga0265342_10002630 | 3300031712 | Bacteria | 15363 |
| 376 | Ga0307410_10321987 | 3300031852 | Bacteria | 1227 |
| 377 | Ga0307416_100296216 | 3300032002 | Bacteria | 1605 |
| 378 | Ga0316214_1013213 | 3300033545 | Bacteria | 1130 |
| 379 | Ga0316212_1002673 | 3300033547 | Bacteria | 2545 |
| 380 | Ga0316216_1007766 | 3300033548 | Bacteria | 808 |
| 381 | Ga0373926_0004623 | 3300035083 | Bacteria | 4521 |
| 382 | Ga0373944_0026988 | 3300035089 | Bacteria | 1700 |
| 383 | Ga0373923_0394520 | 3300035111 | Bacteria | 665 |
| 384 | Ga0373945_0059918 | 3300035116 | Bacteria | 1418 |
| 385 | Ga0373945_0199939 | 3300035116 | Bacteria | 829 |
| 386 | Ga0373954_0045894 | 3300035118 | Bacteria | 2042 |
| 387 | Ga0373954_0053334 | 3300035118 | Bacteria | 1901 |
| 388 | Ga0373954_0070231 | 3300035118 | Bacteria | 1664 |
| 389 | Ga0373956_0078521 | 3300035119 | Bacteria | 1512 |
| 390 | Ga0373943_0011580 | 3300035170 | Bacteria | 3970 |
| 391 | Ga0373943_0134004 | 3300035170 | Bacteria | 1328 |
| 392 | Ga0373946_0066247 | 3300035171 | Bacteria | 1548 |
| 393 | Ga0373955_0139767 | 3300035172 | Bacteria | 1419 |
| 394 | Ga0373924_0041898 | 3300035410 | Bacteria | 1877 |
| 395 | Ga0373931_0303866 | 3300035691 | Bacteria | 986 |
| 396 | Ga0373935_0000373 | 3300035692 | Bacteria | 22971 |
| 397 | Ga0373935_0166276 | 3300035692 | Bacteria | 1506 |
| 398 | Ga0373935_0665407 | 3300035692 | Bacteria | 764 |
| 399 | Ga0373927_0113197 | 3300035695 | Bacteria | 1768 |
| 400 | Ga0373933_0075850 | 3300035724 | Bacteria | 2053 |
| 401 | Ga0373933_0969795 | 3300035724 | Bacteria | 560 |
| 402 | Ga0373947_0000007 | 3300035725 | Bacteria | 192259 |
| 403 | Ga0373947_0015886 | 3300035725 | Bacteria | 4323 |
| 404 | Ga0373947_0198598 | 3300035725 | Bacteria | 1311 |
| 405 | Ga0373947_1026277 | 3300035725 | Bacteria | 562 |
| 406 | Ga0373937_0011172 | 3300036401 | Bacteria | 7871 |
| 407 | Ga0373937_0165210 | 3300036401 | Bacteria | 2075 |
| 408 | Ga0373937_0255360 | 3300036401 | Bacteria | 1652 |
| 409 | Ga0373937_0541307 | 3300036401 | Bacteria | 1106 |
| 410 | Ga0372808_053776 | 3300036459 | Bacteria | 577 |
| 411 | Ga0373925_0002082 | 3300037068 | Bacteria | 16451 |
| 412 | Ga0373925_0025135 | 3300037068 | Bacteria | 4349 |
| 413 | Ga0395898_0119822 | 3300037466 | Bacteria | 2521 |
| 414 | Ga0436364_0183141 | 3300037853 | Bacteria | 23094 |
| 415 | Ga0451800_1285469 | 3300041459 | Bacteria | 710 |
| 416 | Ga0450902_016473 | 3300042137 | Bacteria | 1205 |
| 417 | Ga0439458_0045826 | 3300042157 | Bacteria | 1070 |
| 418 | Ga0439459_0048730 | 3300042438 | Bacteria | 923 |
| 419 | Ga0466966_0416913 | 3300044684 | Bacteria | 807 |
| 420 | Ga0466961_0079250 | 3300044693 | Bacteria | 2080 |
| 421 | Ga0466963_0120627 | 3300044694 | Bacteria | 1804 |
| 422 | Ga0466963_0398797 | 3300044694 | Bacteria | 970 |
| 423 | Ga0466971_0162254 | 3300044719 | Bacteria | 1046 |
| 424 | Ga0466968_0030687 | 3300044735 | Bacteria | 2228 |
| 425 | Ga0466960_0022426 | 3300044901 | Bacteria | 2823 |
| 426 | Ga0466958_0040795 | 3300045836 | Bacteria | 2790 |
| 427 | Ga0466958_0305781 | 3300045836 | Bacteria | 1021 |
| 428 | Ga0466958_0474518 | 3300045836 | Bacteria | 811 |
| 429 | Ga0466958_0578341 | 3300045836 | Bacteria | 730 |
| 430 | Ga0466958_0771375 | 3300045836 | Bacteria | 627 |
| 431 | Ga0466967_0074046 | 3300045976 | Bacteria | 3057 |
| 432 | Ga0466967_0118190 | 3300045976 | Bacteria | 2445 |
| 433 | Ga0466967_0409182 | 3300045976 | Bacteria | 1321 |
| 434 | Ga0466967_0940552 | 3300045976 | Bacteria | 860 |
| 435 | Ga0495592_0166421 | 3300046454 | Bacteria | 1513 |
| 436 | Ga0495603_0097156 | 3300046455 | Bacteria | 1720 |
| 437 | Ga0495603_0257194 | 3300046455 | Bacteria | 1005 |
| 438 | Ga0495629_0007464 | 3300046459 | Bacteria | 8056 |
| 439 | Ga0495641_0013609 | 3300046461 | Bacteria | 4457 |
| 440 | Ga0495641_0025197 | 3300046461 | Bacteria | 2921 |
| 441 | Ga0495653_0004538 | 3300046463 | Bacteria | 11222 |
| 442 | Ga0495580_0047205 | 3300046472 | Bacteria | 3053 |
| 443 | Ga0495582_0006325 | 3300046473 | Bacteria | 6585 |
| 444 | Ga0495582_0424310 | 3300046473 | Bacteria | 767 |
| 445 | Ga0495639_0003200 | 3300046475 | Bacteria | 7113 |
| 446 | Ga0495664_0335399 | 3300046477 | Bacteria | 911 |
| 447 | Ga0495594_0013348 | 3300046499 | Bacteria | 4288 |
| 448 | Ga0495608_0013885 | 3300046511 | Bacteria | 5591 |
| 449 | Ga0495608_0377958 | 3300046511 | Bacteria | 869 |
| 450 | Ga0495618_0008168 | 3300046514 | Bacteria | 6341 |
| 451 | Ga0495618_0083083 | 3300046514 | Bacteria | 2046 |
| 452 | Ga0495628_0177033 | 3300046516 | Bacteria | 1615 |
| 453 | Ga0495628_0223520 | 3300046516 | Bacteria | 1413 |
| 454 | Ga0495630_0025918 | 3300046517 | Bacteria | 4338 |
| 455 | Ga0495630_0060562 | 3300046517 | Bacteria | 2841 |
| 456 | Ga0495630_0371399 | 3300046517 | Bacteria | 1095 |
| 457 | Ga0495630_1228883 | 3300046517 | Bacteria | 566 |
| 458 | Ga0495666_0023955 | 3300046526 | Bacteria | 3019 |
| 459 | Ga0495666_0129169 | 3300046526 | Bacteria | 1181 |
| 460 | Ga0495652_0156633 | 3300046529 | Bacteria | 1773 |
| 461 | Ga0495652_0182782 | 3300046529 | Bacteria | 1607 |
| 462 | Ga0495652_0241795 | 3300046529 | Bacteria | 1342 |
| 463 | Ga0495665_0068005 | 3300046531 | Bacteria | 1878 |
| 464 | Ga0495640_0039620 | 3300046533 | Bacteria | 3304 |
| 465 | Ga0495640_0044601 | 3300046533 | Bacteria | 3082 |
| 466 | Ga0495586_0063868 | 3300046535 | Bacteria | 2006 |
| 467 | Ga0495586_0121114 | 3300046535 | Bacteria | 1462 |
| 468 | Ga0495587_0088942 | 3300046536 | Bacteria | 1785 |
| 469 | Ga0495587_0678325 | 3300046536 | Bacteria | 565 |
| 470 | Ga0495667_0001764 | 3300046559 | Bacteria | 14367 |
| 471 | Ga0495668_0000455 | 3300046616 | Bacteria | 52372 |
| 472 | Ga0495634_0023344 | 3300046642 | Bacteria | 4349 |
| 473 | Ga0495634_0137722 | 3300046642 | Bacteria | 1552 |
| 474 | Ga0495634_0185279 | 3300046642 | Bacteria | 1301 |
| 475 | Ga0495635_0104224 | 3300046663 | Bacteria | 1938 |
| 476 | Ga0495588_0017724 | 3300046674 | Bacteria | 3463 |
| 477 | Ga0495588_0072996 | 3300046674 | Bacteria | 1786 |
| 478 | Ga0495657_0002947 | 3300046675 | Bacteria | 14105 |
| 479 | Ga0495646_0117664 | 3300046680 | Bacteria | 1506 |
| 480 | Ga0495646_0154220 | 3300046680 | Bacteria | 1275 |
| 481 | Ga0495646_0506797 | 3300046680 | Bacteria | 619 |
| 482 | Ga0495647_0013112 | 3300046681 | Bacteria | 2866 |
| 483 | Ga0495647_0034373 | 3300046681 | Bacteria | 1898 |
| 484 | Ga0495658_0003530 | 3300046683 | Bacteria | 7735 |
| 485 | Ga0495658_0013334 | 3300046683 | Bacteria | 4182 |
| 486 | Ga0495658_0204148 | 3300046683 | Bacteria | 1233 |
| 487 | Ga0495613_0010160 | 3300046689 | Bacteria | 6993 |
| 488 | Ga0495624_0011009 | 3300046690 | Bacteria | 6226 |
| 489 | Ga0495624_0083776 | 3300046690 | Bacteria | 1971 |
| 490 | Ga0495624_0356740 | 3300046690 | Bacteria | 879 |
| 491 | Ga0495600_0017157 | 3300046809 | Bacteria | 4602 |
| 492 | Ga0495600_0056048 | 3300046809 | Bacteria | 2574 |
| 493 | Ga0495581_0008653 | 3300047315 | Bacteria | 5895 |
| 494 | Ga0495581_0017634 | 3300047315 | Bacteria | 4147 |
| 495 | Ga0495604_0007148 | 3300047317 | Bacteria | 8843 |
| 496 | Ga0495604_0013106 | 3300047317 | Bacteria | 6603 |
| 497 | Ga0495604_0331973 | 3300047317 | Bacteria | 1014 |
| 498 | Ga0495674_0024837 | 3300047319 | Bacteria | 5501 |
| 499 | Ga0495674_0034269 | 3300047319 | Bacteria | 4592 |
| 500 | Ga0495674_0255361 | 3300047319 | Bacteria | 1441 |
| 501 | Ga0495674_0340281 | 3300047319 | Bacteria | 1219 |
| 502 | Ga0495676_0005830 | 3300047321 | Bacteria | 11305 |
| 503 | Ga0495676_0048186 | 3300047321 | Bacteria | 3438 |
| 504 | Ga0495680_0009868 | 3300047322 | Bacteria | 8558 |
| 505 | Ga0495680_0025378 | 3300047322 | Bacteria | 4906 |
| 506 | Ga0495684_0004208 | 3300047471 | Bacteria | 11242 |
| 507 | Ga0495684_0028308 | 3300047471 | Bacteria | 4302 |
| 508 | Ga0495684_0312185 | 3300047471 | Bacteria | 1126 |
| 509 | Ga0495593_0010122 | 3300047673 | Bacteria | 5457 |
| 510 | Ga0495593_0013915 | 3300047673 | Bacteria | 4583 |
| 511 | Ga0495593_0051728 | 3300047673 | Bacteria | 2173 |
| 512 | Ga0495602_0101228 | 3300048088 | Bacteria | 2364 |
| 513 | Ga0495602_0730676 | 3300048088 | Bacteria | 670 |
| 514 | Ga0496100_0029937 | 3300048903 | Bacteria | 3372 |
| 515 | Ga0496100_0229885 | 3300048903 | Bacteria | 1364 |
| 516 | Ga0496101_0017662 | 3300048904 | Bacteria | 4839 |
| 517 | Ga0496102_0048132 | 3300048905 | Bacteria | 3876 |
| 518 | Ga0496102_0089693 | 3300048905 | Bacteria | 2844 |
| 519 | Ga0496102_0740709 | 3300048905 | Bacteria | 906 |
| 520 | Ga0496103_0018758 | 3300048906 | Bacteria | 4152 |
| 521 | Ga0496104_0023168 | 3300048907 | Bacteria | 5708 |
| 522 | Ga0496104_0041631 | 3300048907 | Bacteria | 4308 |
| 523 | Ga0496104_0055880 | 3300048907 | Bacteria | 3732 |
| 524 | Ga0496104_0117648 | 3300048907 | Bacteria | 2551 |
| 525 | Ga0496104_1506119 | 3300048907 | Bacteria | 576 |
| 526 | Ga0496105_0003546 | 3300048908 | Bacteria | 11566 |
| 527 | Ga0496105_0018272 | 3300048908 | Bacteria | 5631 |
| 528 | Ga0496105_0018448 | 3300048908 | Bacteria | 5608 |
| 529 | Ga0496105_1051267 | 3300048908 | Bacteria | 607 |
| 530 | Ga0496106_0007409 | 3300048909 | Bacteria | 8109 |
| 531 | Ga0496106_0021970 | 3300048909 | Bacteria | 4741 |
| 532 | Ga0496107_0112542 | 3300048910 | Bacteria | 2001 |
| 533 | Ga0496107_0127629 | 3300048910 | Bacteria | 1876 |
| 534 | Ga0496108_0005484 | 3300048911 | Bacteria | 10261 |
| 535 | Ga0496108_0029522 | 3300048911 | Bacteria | 4542 |
| 536 | Ga0496108_0132278 | 3300048911 | Bacteria | 2144 |
| 537 | Ga0496108_0244680 | 3300048911 | Bacteria | 1560 |
| 538 | Ga0496108_0701595 | 3300048911 | Bacteria | 877 |
| 539 | Ga0496109_0018316 | 3300048912 | Bacteria | 6151 |
| 540 | Ga0496109_0028922 | 3300048912 | Bacteria | 4961 |
| 541 | Ga0496109_0050143 | 3300048912 | Bacteria | 3802 |
| 542 | Ga0496109_0051534 | 3300048912 | Bacteria | 3749 |
| 543 | Ga0496109_1623248 | 3300048912 | Bacteria | 581 |
| 544 | Ga0496110_0003522 | 3300048913 | Bacteria | 12016 |
| 545 | Ga0496110_0016744 | 3300048913 | Bacteria | 6124 |
| 546 | Ga0496110_0022592 | 3300048913 | Bacteria | 5343 |
| 547 | Ga0496110_0030265 | 3300048913 | Bacteria | 4665 |
| 548 | Ga0496111_0006940 | 3300048914 | Bacteria | 7391 |
| 549 | Ga0496111_0008023 | 3300048914 | Bacteria | 6963 |
| 550 | Ga0496111_0236287 | 3300048914 | Bacteria | 1357 |
| 551 | Ga0496112_0025202 | 3300048915 | Bacteria | 5709 |
| 552 | Ga0496112_0465701 | 3300048915 | Bacteria | 1201 |
| 553 | Ga0496112_0502019 | 3300048915 | Bacteria | 1148 |
| 554 | Ga0496112_0527313 | 3300048915 | Bacteria | 1115 |
| 555 | Ga0496113_0022346 | 3300048916 | Bacteria | 4472 |
| 556 | Ga0496113_0047128 | 3300048916 | Bacteria | 3202 |
| 557 | Ga0496113_0180956 | 3300048916 | Bacteria | 1671 |
| 558 | Ga0496114_0059656 | 3300048917 | Bacteria | 3187 |
| 559 | Ga0496114_0300897 | 3300048917 | Bacteria | 1416 |
| 560 | Ga0496114_0825259 | 3300048917 | Bacteria | 807 |
| 561 | Ga0496115_0188317 | 3300048918 | Bacteria | 1705 |
| 562 | Ga0496125_0015483 | 3300048928 | Bacteria | 7371 |
| 563 | Ga0496126_0007302 | 3300048929 | Bacteria | 12137 |
| 564 | Ga0501068_0486623 | 3300049584 | Bacteria | 800 |
| 565 | Ga0501072_0211906 | 3300049588 | Bacteria | 1544 |
| 566 | nmdc:mga03683_292572_c1 | 3300050489 | Bacteria | 762 |
| 567 | nmdc:mga03n38_15964_c1 | 3300050490 | Bacteria | 2912 |
| 568 | nmdc:mga03n38_260798_c1 | 3300050490 | Bacteria | 919 |
| 569 | nmdc:mga00v17_75876_c1 | 3300050491 | Bacteria | 2091 |
| 570 | nmdc:mga0yw44_289117_c1 | 3300050492 | Bacteria | 1097 |
| 571 | nmdc:mga0yw44_37095_c1 | 3300050492 | Bacteria | 2876 |
| 572 | nmdc:mga06z11_66806_c1 | 3300050494 | Bacteria | 1891 |
| 573 | nmdc:mga07m45_4002_c1 | 3300050496 | Bacteria | 7171 |
| 574 | nmdc:mga07m45_89945_c1 | 3300050496 | Bacteria | 788 |
| 575 | nmdc:mga05p37_1166024_c1 | 3300050507 | Bacteria | 800 |
| 576 | nmdc:mga09592_167511_c1 | 3300050508 | Bacteria | 1899 |
| 577 | nmdc:mga06r32_1177145_c1 | 3300050510 | Bacteria | 713 |
| 578 | nmdc:mga06r32_1276631_c1 | 3300050510 | Bacteria | 679 |
| 579 | nmdc:mga08y16_157449_c1 | 3300050511 | Bacteria | 2361 |
| 580 | nmdc:mga0n895_117364_c1 | 3300050512 | Bacteria | 2680 |
| 581 | nmdc:mga0n895_32349_c1 | 3300050512 | Bacteria | 5020 |
| 582 | nmdc:mga0n895_794615_c1 | 3300050512 | Bacteria | 937 |
| 583 | nmdc:mga0rr50_226116_c1 | 3300050513 | Bacteria | 1547 |
| 584 | nmdc:mga0rr50_913049_c1 | 3300050513 | Bacteria | 749 |
| 585 | nmdc:mga08x19_7459_c1 | 3300050514 | Bacteria | 6496 |
| 586 | nmdc:mga0a205_218415_c1 | 3300050515 | Bacteria | 1793 |
| 587 | nmdc:mga0a205_996140_c1 | 3300050515 | Bacteria | 685 |
| 588 | nmdc:mga0sz30_23875_c1 | 3300050516 | Bacteria | 2492 |
| 589 | Ga0495601_0268474 | 3300053077 | Bacteria | 1113 |
| 590 | Ga0495612_0096718 | 3300053078 | Bacteria | 1255 |
| 591 | Ga0495595_0022864 | 3300053084 | Bacteria | 2747 |
| 592 | Ga0495619_0017914 | 3300053085 | Bacteria | 4489 |
| 593 | Ga0495619_0123324 | 3300053085 | Bacteria | 1777 |
| 594 | Ga0500644_0025899 | 3300053088 | Bacteria | 1810 |
| 595 | Ga0500573_0152892 | 3300053140 | Bacteria | 1262 |
| 596 | Ga0466962_0199342 | 3300061719 | Bacteria | 978 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2547132424 | 2548695357 | 158 |
| 2 | iso_pu_bacteria | 2565956761 | 2566994269 | 158 |
| 3 | iso_pu_bacteria | 2585427649 | 2586062191 | 158 |
| 4 | iso_pu_bacteria | 2643221692 | 2644516467 | 158 |
| 5 | iso_pu_bacteria | 2738541308 | 2738887142 | 158 |
| 6 | iso_pu_bacteria | 2738543034 | 2739367256 | 158 |
| 7 | iso_pu_bacteria | 2791354901 | 2791912184 | 158 |
| 8 | iso_pu_bacteria | 2808606522 | 2809588640 | 158 |
| 9 | iso_pu_bacteria | 2904535858 | 2904538773 | 158 |
| 10 | iso_pu_bacteria | 2915768154 | 2915770006 | 158 |
| 11 | iso_pu_bacteria | 2919713450 | 2919717241 | 158 |
| 12 | iso_pu_bacteria | 2922554459 | 2922559501 | 158 |
| 13 | iso_pu_bacteria | 2939582691 | 2939584178 | 158 |
| 14 | iso_pu_bacteria | 8047710418 | 8047718059 | 158 |
| 15 | iso_pu_bacteria | 2675903059 | 2676485899 | 159 |
| 16 | iso_pu_bacteria | 2751185782 | 2753266537 | 159 |
| 17 | 3300002155 | JGI24033J26618_1027155 | JGI24033J26618_10271552 | 162 |
| 18 | 3300002459 | JGI24751J29686_10003840 | JGI24751J29686_100038403 | 162 |
| 19 | 3300003203 | JGI25406J46586_10002057 | JGI25406J46586_100020575 | 162 |
| 20 | 3300003911 | JGI25405J52794_10019198 | JGI25405J52794_100191981 | 162 |
| 21 | 3300005327 | Ga0070658_10024804 | Ga0070658_100248044 | 162 |
| 22 | 3300005327 | Ga0070658_10641174 | Ga0070658_106411742 | 162 |
| 23 | 3300005328 | Ga0070676_10052877 | Ga0070676_100528772 | 162 |
| 24 | 3300005329 | Ga0070683_101001103 | Ga0070683_1010011032 | 162 |
| 25 | 3300005329 | Ga0070683_101008147 | Ga0070683_1010081471 | 162 |
| 26 | 3300005330 | Ga0070690_100791185 | Ga0070690_1007911851 | 162 |
| 27 | 3300005334 | Ga0068869_100013076 | Ga0068869_1000130768 | 162 |
| 28 | 3300005334 | Ga0068869_100257909 | Ga0068869_1002579092 | 162 |
| 29 | 3300005335 | Ga0070666_10317715 | Ga0070666_103177152 | 162 |
| 30 | 3300005336 | Ga0070680_100065730 | Ga0070680_1000657301 | 162 |
| 31 | 3300005337 | Ga0070682_100216067 | Ga0070682_1002160672 | 162 |
| 32 | 3300005338 | Ga0068868_100055286 | Ga0068868_1000552862 | 162 |
| 33 | 3300005339 | Ga0070660_100032361 | Ga0070660_1000323612 | 162 |
| 34 | 3300005340 | Ga0070689_100064431 | Ga0070689_1000644312 | 162 |
| 35 | 3300005345 | Ga0070692_10118059 | Ga0070692_101180592 | 162 |
| 36 | 3300005354 | Ga0070675_100079377 | Ga0070675_1000793772 | 162 |
| 37 | 3300005355 | Ga0070671_100000635 | Ga0070671_1000006352 | 162 |
| 38 | 3300005364 | Ga0070673_100099907 | Ga0070673_1000999073 | 162 |
| 39 | 3300005434 | Ga0070709_10041051 | Ga0070709_100410512 | 162 |
| 40 | 3300005434 | Ga0070709_10083245 | Ga0070709_100832452 | 162 |
| 41 | 3300005435 | Ga0070714_100061206 | Ga0070714_1000612063 | 162 |
| 42 | 3300005435 | Ga0070714_101642811 | Ga0070714_1016428111 | 162 |
| 43 | 3300005436 | Ga0070713_100002466 | Ga0070713_10000246614 | 162 |
| 44 | 3300005437 | Ga0070710_10070565 | Ga0070710_100705651 | 162 |
| 45 | 3300005437 | Ga0070710_10182468 | Ga0070710_101824682 | 162 |
| 46 | 3300005439 | Ga0070711_100046256 | Ga0070711_1000462562 | 162 |
| 47 | 3300005439 | Ga0070711_100463541 | Ga0070711_1004635412 | 162 |
| 48 | 3300005440 | Ga0070705_100178902 | Ga0070705_1001789022 | 162 |
| 49 | 3300005441 | Ga0070700_100032739 | Ga0070700_1000327392 | 162 |
| 50 | 3300005445 | Ga0070708_100111783 | Ga0070708_1001117833 | 162 |
| 51 | 3300005455 | Ga0070663_100059236 | Ga0070663_1000592362 | 162 |
| 52 | 3300005456 | Ga0070678_100017872 | Ga0070678_1000178722 | 162 |
| 53 | 3300005467 | Ga0070706_100003943 | Ga0070706_10000394312 | 162 |
| 54 | 3300005467 | Ga0070706_100008907 | Ga0070706_10000890711 | 162 |
| 55 | 3300005467 | Ga0070706_100674069 | Ga0070706_1006740692 | 162 |
| 56 | 3300005468 | Ga0070707_100124620 | Ga0070707_1001246203 | 162 |
| 57 | 3300005468 | Ga0070707_100423405 | Ga0070707_1004234052 | 162 |
| 58 | 3300005471 | Ga0070698_100007953 | Ga0070698_1000079535 | 162 |
| 59 | 3300005530 | Ga0070679_100415050 | Ga0070679_1004150502 | 162 |
| 60 | 3300005530 | Ga0070679_100501004 | Ga0070679_1005010041 | 162 |
| 61 | 3300005535 | Ga0070684_100616036 | Ga0070684_1006160362 | 162 |
| 62 | 3300005536 | Ga0070697_101430015 | Ga0070697_1014300151 | 162 |
| 63 | 3300005539 | Ga0068853_100977342 | Ga0068853_1009773421 | 162 |
| 64 | 3300005544 | Ga0070686_100447943 | Ga0070686_1004479432 | 162 |
| 65 | 3300005547 | Ga0070693_100003642 | Ga0070693_1000036428 | 162 |
| 66 | 3300005548 | Ga0070665_100079122 | Ga0070665_1000791222 | 162 |
| 67 | 3300005564 | Ga0070664_100653340 | Ga0070664_1006533402 | 162 |
| 68 | 3300005577 | Ga0068857_100635847 | Ga0068857_1006358472 | 162 |
| 69 | 3300005578 | Ga0068854_100425001 | Ga0068854_1004250012 | 162 |
| 70 | 3300005614 | Ga0068856_100022369 | Ga0068856_1000223697 | 162 |
| 71 | 3300005614 | Ga0068856_100099071 | Ga0068856_1000990712 | 162 |
| 72 | 3300005614 | Ga0068856_100587025 | Ga0068856_1005870252 | 162 |
| 73 | 3300005614 | Ga0068856_101305631 | Ga0068856_1013056312 | 162 |
| 74 | 3300005615 | Ga0070702_100011239 | Ga0070702_1000112395 | 162 |
| 75 | 3300005615 | Ga0070702_100076891 | Ga0070702_1000768912 | 162 |
| 76 | 3300005616 | Ga0068852_100043957 | Ga0068852_1000439571 | 162 |
| 77 | 3300005618 | Ga0068864_100033409 | Ga0068864_1000334097 | 162 |
| 78 | 3300005618 | Ga0068864_100153856 | Ga0068864_1001538563 | 162 |
| 79 | 3300005834 | Ga0068851_10519524 | Ga0068851_105195241 | 162 |
| 80 | 3300005840 | Ga0068870_10005633 | Ga0068870_100056337 | 162 |
| 81 | 3300005841 | Ga0068863_100045066 | Ga0068863_1000450664 | 162 |
| 82 | 3300005841 | Ga0068863_100045100 | Ga0068863_1000451003 | 162 |
| 83 | 3300005841 | Ga0068863_100567240 | Ga0068863_1005672402 | 162 |
| 84 | 3300005842 | Ga0068858_100021168 | Ga0068858_1000211685 | 162 |
| 85 | 3300005937 | Ga0081455_10000112 | Ga0081455_1000011215 | 162 |
| 86 | 3300005985 | Ga0081539_10000417 | Ga0081539_1000041718 | 162 |
| 87 | 3300006028 | Ga0070717_10062409 | Ga0070717_100624092 | 162 |
| 88 | 3300006028 | Ga0070717_10305605 | Ga0070717_103056052 | 162 |
| 89 | 3300006028 | Ga0070717_10528098 | Ga0070717_105280981 | 162 |
| 90 | 3300006028 | Ga0070717_11202188 | Ga0070717_112021881 | 162 |
| 91 | 3300006038 | Ga0075365_10032360 | Ga0075365_100323604 | 162 |
| 92 | 3300006048 | Ga0075363_100020237 | Ga0075363_1000202373 | 162 |
| 93 | 3300006048 | Ga0075363_100231665 | Ga0075363_1002316652 | 162 |
| 94 | 3300006051 | Ga0075364_10236582 | Ga0075364_102365821 | 162 |
| 95 | 3300006058 | Ga0075432_10075403 | Ga0075432_100754032 | 162 |
| 96 | 3300006163 | Ga0070715_10159448 | Ga0070715_101594482 | 162 |
| 97 | 3300006175 | Ga0070712_100065485 | Ga0070712_1000654852 | 162 |
| 98 | 3300006178 | Ga0075367_10087339 | Ga0075367_100873392 | 162 |
| 99 | 3300006178 | Ga0075367_10531029 | Ga0075367_105310291 | 162 |
| 100 | 3300006186 | Ga0075369_10049567 | Ga0075369_100495672 | 162 |
| 101 | 3300006237 | Ga0097621_100044452 | Ga0097621_1000444523 | 162 |
| 102 | 3300006353 | Ga0075370_10110482 | Ga0075370_101104822 | 162 |
| 103 | 3300006353 | Ga0075370_10382380 | Ga0075370_103823802 | 162 |
| 104 | 3300006358 | Ga0068871_100034451 | Ga0068871_1000344512 | 162 |
| 105 | 3300006358 | Ga0068871_100101384 | Ga0068871_1001013841 | 162 |
| 106 | 3300006844 | Ga0075428_100855611 | Ga0075428_1008556112 | 162 |
| 107 | 3300006852 | Ga0075433_10034214 | Ga0075433_100342144 | 162 |
| 108 | 3300006914 | Ga0075436_100004718 | Ga0075436_1000047182 | 162 |
| 109 | 3300007076 | Ga0075435_100481069 | Ga0075435_1004810692 | 162 |
| 110 | 3300009094 | Ga0111539_10185986 | Ga0111539_101859862 | 162 |
| 111 | 3300009098 | Ga0105245_10024376 | Ga0105245_100243762 | 162 |
| 112 | 3300009098 | Ga0105245_10883605 | Ga0105245_108836051 | 162 |
| 113 | 3300009147 | Ga0114129_10678678 | Ga0114129_106786781 | 162 |
| 114 | 3300009148 | Ga0105243_10348262 | Ga0105243_103482621 | 162 |
| 115 | 3300009174 | Ga0105241_10440076 | Ga0105241_104400762 | 162 |
| 116 | 3300009177 | Ga0105248_10112801 | Ga0105248_101128012 | 162 |
| 117 | 3300009177 | Ga0105248_10188794 | Ga0105248_101887943 | 162 |
| 118 | 3300009545 | Ga0105237_10247018 | Ga0105237_102470182 | 162 |
| 119 | 3300009551 | Ga0105238_10150719 | Ga0105238_101507192 | 162 |
| 120 | 3300010375 | Ga0105239_10124927 | Ga0105239_101249272 | 162 |
| 121 | 3300010375 | Ga0105239_10265692 | Ga0105239_102656922 | 162 |
| 122 | 3300010375 | Ga0105239_10839214 | Ga0105239_108392142 | 162 |
| 123 | 3300011119 | Ga0105246_10004760 | Ga0105246_100047606 | 162 |
| 124 | 3300012503 | Ga0157313_1011581 | Ga0157313_10115811 | 162 |
| 125 | 3300013100 | Ga0157373_10029646 | Ga0157373_100296463 | 162 |
| 126 | 3300013102 | Ga0157371_10099868 | Ga0157371_100998682 | 162 |
| 127 | 3300013104 | Ga0157370_10059246 | Ga0157370_100592462 | 162 |
| 128 | 3300013104 | Ga0157370_10167821 | Ga0157370_101678211 | 162 |
| 129 | 3300013104 | Ga0157370_10271781 | Ga0157370_102717811 | 162 |
| 130 | 3300013105 | Ga0157369_10029298 | Ga0157369_100292987 | 162 |
| 131 | 3300013105 | Ga0157369_10120886 | Ga0157369_101208862 | 162 |
| 132 | 3300013105 | Ga0157369_10352452 | Ga0157369_103524522 | 162 |
| 133 | 3300013105 | Ga0157369_10567396 | Ga0157369_105673962 | 162 |
| 134 | 3300013105 | Ga0157369_10573477 | Ga0157369_105734772 | 162 |
| 135 | 3300013105 | Ga0157369_10910826 | Ga0157369_109108261 | 162 |
| 136 | 3300013296 | Ga0157374_10097991 | Ga0157374_100979912 | 162 |
| 137 | 3300013296 | Ga0157374_10780301 | Ga0157374_107803012 | 162 |
| 138 | 3300013306 | Ga0163162_10216950 | Ga0163162_102169502 | 162 |
| 139 | 3300013307 | Ga0157372_10058337 | Ga0157372_100583373 | 162 |
| 140 | 3300013307 | Ga0157372_10061049 | Ga0157372_100610492 | 162 |
| 141 | 3300013308 | Ga0157375_10041386 | Ga0157375_100413862 | 162 |
| 142 | 3300014325 | Ga0163163_10024547 | Ga0163163_100245473 | 162 |
| 143 | 3300014325 | Ga0163163_10165552 | Ga0163163_101655522 | 162 |
| 144 | 3300014325 | Ga0163163_10830422 | Ga0163163_108304222 | 162 |
| 145 | 3300014497 | Ga0182008_10082452 | Ga0182008_100824522 | 162 |
| 146 | 3300014745 | Ga0157377_10003853 | Ga0157377_100038532 | 162 |
| 147 | 3300014968 | Ga0157379_10028595 | Ga0157379_100285956 | 162 |
| 148 | 3300014968 | Ga0157379_10126152 | Ga0157379_101261523 | 162 |
| 149 | 3300014969 | Ga0157376_10044482 | Ga0157376_100444823 | 162 |
| 150 | 3300014969 | Ga0157376_10190061 | Ga0157376_101900612 | 162 |
| 151 | 3300014969 | Ga0157376_12061311 | Ga0157376_120613111 | 162 |
| 152 | 3300017792 | Ga0163161_10056268 | Ga0163161_100562683 | 162 |
| 153 | 3300020069 | Ga0197907_11109537 | Ga0197907_111095372 | 162 |
| 154 | 3300020070 | Ga0206356_10615563 | Ga0206356_106155631 | 162 |
| 155 | 3300020075 | Ga0206349_1672554 | Ga0206349_16725542 | 162 |
| 156 | 3300020075 | Ga0206349_1791822 | Ga0206349_17918222 | 162 |
| 157 | 3300020075 | Ga0206349_1905463 | Ga0206349_19054631 | 162 |
| 158 | 3300020078 | Ga0206352_10509604 | Ga0206352_105096041 | 162 |
| 159 | 3300020081 | Ga0206354_11531839 | Ga0206354_115318392 | 162 |
| 160 | 3300020082 | Ga0206353_11064492 | Ga0206353_110644922 | 162 |
| 161 | 3300020082 | Ga0206353_11722789 | Ga0206353_117227892 | 162 |
| 162 | 3300021388 | Ga0213875_10001884 | Ga0213875_100018843 | 162 |
| 163 | 3300022467 | Ga0224712_10040877 | Ga0224712_100408773 | 162 |
| 164 | 3300022467 | Ga0224712_10339153 | Ga0224712_103391531 | 162 |
| 165 | 3300022467 | Ga0224712_10345686 | Ga0224712_103456861 | 162 |
| 166 | 3300025321 | Ga0207656_10124637 | Ga0207656_101246372 | 162 |
| 167 | 3300025898 | Ga0207692_10052050 | Ga0207692_100520502 | 162 |
| 168 | 3300025898 | Ga0207692_10067245 | Ga0207692_100672452 | 162 |
| 169 | 3300025898 | Ga0207692_10117212 | Ga0207692_101172121 | 162 |
| 170 | 3300025901 | Ga0207688_10414636 | Ga0207688_104146361 | 162 |
| 171 | 3300025904 | Ga0207647_10071749 | Ga0207647_100717492 | 162 |
| 172 | 3300025906 | Ga0207699_10040121 | Ga0207699_100401213 | 162 |
| 173 | 3300025906 | Ga0207699_10064303 | Ga0207699_100643033 | 162 |
| 174 | 3300025908 | Ga0207643_10000039 | Ga0207643_100000398 | 162 |
| 175 | 3300025909 | Ga0207705_10039796 | Ga0207705_100397962 | 162 |
| 176 | 3300025909 | Ga0207705_10570056 | Ga0207705_105700561 | 162 |
| 177 | 3300025909 | Ga0207705_10867313 | Ga0207705_108673131 | 162 |
| 178 | 3300025910 | Ga0207684_10002293 | Ga0207684_100022939 | 162 |
| 179 | 3300025910 | Ga0207684_10268814 | Ga0207684_102688142 | 162 |
| 180 | 3300025910 | Ga0207684_10285072 | Ga0207684_102850722 | 162 |
| 181 | 3300025911 | Ga0207654_10007978 | Ga0207654_100079785 | 162 |
| 182 | 3300025912 | Ga0207707_10205762 | Ga0207707_102057622 | 162 |
| 183 | 3300025914 | Ga0207671_10217023 | Ga0207671_102170231 | 162 |
| 184 | 3300025915 | Ga0207693_10022527 | Ga0207693_100225271 | 162 |
| 185 | 3300025915 | Ga0207693_10037089 | Ga0207693_100370892 | 162 |
| 186 | 3300025915 | Ga0207693_10090274 | Ga0207693_100902742 | 162 |
| 187 | 3300025916 | Ga0207663_10359961 | Ga0207663_103599612 | 162 |
| 188 | 3300025917 | Ga0207660_10031660 | Ga0207660_100316603 | 162 |
| 189 | 3300025919 | Ga0207657_10022954 | Ga0207657_100229542 | 162 |
| 190 | 3300025920 | Ga0207649_10362972 | Ga0207649_103629722 | 162 |
| 191 | 3300025921 | Ga0207652_10081687 | Ga0207652_100816872 | 162 |
| 192 | 3300025921 | Ga0207652_10387601 | Ga0207652_103876012 | 162 |
| 193 | 3300025922 | Ga0207646_10027431 | Ga0207646_100274313 | 162 |
| 194 | 3300025922 | Ga0207646_10509724 | Ga0207646_105097242 | 162 |
| 195 | 3300025924 | Ga0207694_10412817 | Ga0207694_104128171 | 162 |
| 196 | 3300025925 | Ga0207650_10021059 | Ga0207650_100210592 | 162 |
| 197 | 3300025926 | Ga0207659_10488354 | Ga0207659_104883542 | 162 |
| 198 | 3300025927 | Ga0207687_10093558 | Ga0207687_100935583 | 162 |
| 199 | 3300025927 | Ga0207687_10201867 | Ga0207687_102018672 | 162 |
| 200 | 3300025928 | Ga0207700_10039306 | Ga0207700_100393063 | 162 |
| 201 | 3300025929 | Ga0207664_10133982 | Ga0207664_101339822 | 162 |
| 202 | 3300025929 | Ga0207664_10224969 | Ga0207664_102249693 | 162 |
| 203 | 3300025929 | Ga0207664_11207215 | Ga0207664_112072152 | 162 |
| 204 | 3300025931 | Ga0207644_10096153 | Ga0207644_100961532 | 162 |
| 205 | 3300025935 | Ga0207709_10149513 | Ga0207709_101495132 | 162 |
| 206 | 3300025935 | Ga0207709_10216463 | Ga0207709_102164631 | 162 |
| 207 | 3300025936 | Ga0207670_10009525 | Ga0207670_100095252 | 162 |
| 208 | 3300025941 | Ga0207711_10146655 | Ga0207711_101466551 | 162 |
| 209 | 3300025941 | Ga0207711_10417079 | Ga0207711_104170791 | 162 |
| 210 | 3300025942 | Ga0207689_10004582 | Ga0207689_100045827 | 162 |
| 211 | 3300025944 | Ga0207661_10075267 | Ga0207661_100752671 | 162 |
| 212 | 3300025944 | Ga0207661_10220673 | Ga0207661_102206731 | 162 |
| 213 | 3300025944 | Ga0207661_10267456 | Ga0207661_102674561 | 162 |
| 214 | 3300025945 | Ga0207679_10022595 | Ga0207679_100225957 | 162 |
| 215 | 3300025945 | Ga0207679_11034076 | Ga0207679_110340761 | 162 |
| 216 | 3300025981 | Ga0207640_10027186 | Ga0207640_100271864 | 162 |
| 217 | 3300026023 | Ga0207677_10038846 | Ga0207677_100388463 | 162 |
| 218 | 3300026035 | Ga0207703_10056001 | Ga0207703_100560014 | 162 |
| 219 | 3300026035 | Ga0207703_10429769 | Ga0207703_104297692 | 162 |
| 220 | 3300026035 | Ga0207703_11686984 | Ga0207703_116869841 | 162 |
| 221 | 3300026041 | Ga0207639_10102241 | Ga0207639_101022413 | 162 |
| 222 | 3300026067 | Ga0207678_10001338 | Ga0207678_1000133818 | 162 |
| 223 | 3300026075 | Ga0207708_10043866 | Ga0207708_100438661 | 162 |
| 224 | 3300026078 | Ga0207702_10003837 | Ga0207702_1000383711 | 162 |
| 225 | 3300026078 | Ga0207702_10040119 | Ga0207702_100401192 | 162 |
| 226 | 3300026078 | Ga0207702_10223973 | Ga0207702_102239732 | 162 |
| 227 | 3300026078 | Ga0207702_10283693 | Ga0207702_102836931 | 162 |
| 228 | 3300026078 | Ga0207702_10941630 | Ga0207702_109416302 | 162 |
| 229 | 3300026088 | Ga0207641_10118247 | Ga0207641_101182472 | 162 |
| 230 | 3300026088 | Ga0207641_10152581 | Ga0207641_101525812 | 162 |
| 231 | 3300026095 | Ga0207676_10177361 | Ga0207676_101773612 | 162 |
| 232 | 3300026116 | Ga0207674_10061677 | Ga0207674_100616773 | 162 |
| 233 | 3300026116 | Ga0207674_10078182 | Ga0207674_100781822 | 162 |
| 234 | 3300026116 | Ga0207674_10758245 | Ga0207674_107582452 | 162 |
| 235 | 3300026116 | Ga0207674_11039366 | Ga0207674_110393661 | 162 |
| 236 | 3300026121 | Ga0207683_10036359 | Ga0207683_100363593 | 162 |
| 237 | 3300026142 | Ga0207698_10118684 | Ga0207698_101186842 | 162 |
| 238 | 3300027907 | Ga0207428_10014004 | Ga0207428_100140042 | 162 |
| 239 | 3300028379 | Ga0268266_10202511 | Ga0268266_102025111 | 162 |
| 240 | 3300028379 | Ga0268266_10573509 | Ga0268266_105735091 | 162 |
| 241 | 3300028381 | Ga0268264_10063293 | Ga0268264_100632932 | 162 |
| 242 | 3300028556 | Ga0265337_1005578 | Ga0265337_10055784 | 162 |
| 243 | 3300028558 | Ga0265326_10009317 | Ga0265326_100093172 | 162 |
| 244 | 3300028563 | Ga0265319_1016937 | Ga0265319_10169373 | 162 |
| 245 | 3300028573 | Ga0265334_10001541 | Ga0265334_1000154110 | 162 |
| 246 | 3300028577 | Ga0265318_10115913 | Ga0265318_101159132 | 162 |
| 247 | 3300028653 | Ga0265323_10022009 | Ga0265323_100220093 | 162 |
| 248 | 3300028654 | Ga0265322_10015885 | Ga0265322_100158852 | 162 |
| 249 | 3300028666 | Ga0265336_10019609 | Ga0265336_100196092 | 162 |
| 250 | 3300028794 | Ga0307515_10054619 | Ga0307515_100546196 | 162 |
| 251 | 3300028800 | Ga0265338_10054489 | Ga0265338_100544894 | 162 |
| 252 | 3300028800 | Ga0265338_10098405 | Ga0265338_100984051 | 162 |
| 253 | 3300028800 | Ga0265338_10107380 | Ga0265338_101073802 | 162 |
| 254 | 3300029957 | Ga0265324_10023583 | Ga0265324_100235833 | 162 |
| 255 | 3300031238 | Ga0265332_10020522 | Ga0265332_100205222 | 162 |
| 256 | 3300031240 | Ga0265320_10028769 | Ga0265320_100287692 | 162 |
| 257 | 3300031241 | Ga0265325_10051086 | Ga0265325_100510862 | 162 |
| 258 | 3300031247 | Ga0265340_10008327 | Ga0265340_100083272 | 162 |
| 259 | 3300031249 | Ga0265339_10018443 | Ga0265339_100184431 | 162 |
| 260 | 3300031344 | Ga0265316_10108575 | Ga0265316_101085751 | 162 |
| 261 | 3300031507 | Ga0307509_10265069 | Ga0307509_102650693 | 162 |
| 262 | 3300031507 | Ga0307509_10498324 | Ga0307509_104983242 | 162 |
| 263 | 3300031665 | Ga0316575_10000001 | Ga0316575_1000000159 | 162 |
| 264 | 3300031711 | Ga0265314_10003585 | Ga0265314_1000358515 | 162 |
| 265 | 3300031712 | Ga0265342_10002630 | Ga0265342_100026303 | 162 |
| 266 | 3300031852 | Ga0307410_10321987 | Ga0307410_103219872 | 162 |
| 267 | 3300032002 | Ga0307416_100296216 | Ga0307416_1002962162 | 162 |
| 268 | 3300033545 | Ga0316214_1013213 | Ga0316214_10132132 | 162 |
| 269 | 3300033547 | Ga0316212_1002673 | Ga0316212_10026734 | 162 |
| 270 | 3300033548 | Ga0316216_1007766 | Ga0316216_10077661 | 162 |
| 271 | 3300035083 | Ga0373926_0004623 | Ga0373926_0004623_3008_3496 | 162 |
| 272 | 3300035111 | Ga0373923_0394520 | Ga0373923_0394520_88_576 | 162 |
| 273 | 3300035116 | Ga0373945_0199939 | Ga0373945_0199939_127_615 | 162 |
| 274 | 3300035118 | Ga0373954_0045894 | Ga0373954_0045894_260_748 | 162 |
| 275 | 3300035118 | Ga0373954_0053334 | Ga0373954_0053334_94_582 | 162 |
| 276 | 3300035119 | Ga0373956_0078521 | Ga0373956_0078521_439_927 | 162 |
| 277 | 3300035170 | Ga0373943_0134004 | Ga0373943_0134004_553_1041 | 162 |
| 278 | 3300035691 | Ga0373931_0303866 | Ga0373931_0303866_465_953 | 162 |
| 279 | 3300035692 | Ga0373935_0000373 | Ga0373935_0000373_2386_2874 | 162 |
| 280 | 3300035692 | Ga0373935_0166276 | Ga0373935_0166276_430_918 | 162 |
| 281 | 3300035692 | Ga0373935_0665407 | Ga0373935_0665407_51_539 | 162 |
| 282 | 3300035695 | Ga0373927_0113197 | Ga0373927_0113197_866_1354 | 162 |
| 283 | 3300035724 | Ga0373933_0969795 | Ga0373933_0969795_17_505 | 162 |
| 284 | 3300035725 | Ga0373947_0000007 | Ga0373947_0000007_60580_61068 | 162 |
| 285 | 3300035725 | Ga0373947_0198598 | Ga0373947_0198598_49_537 | 162 |
| 286 | 3300035725 | Ga0373947_1026277 | Ga0373947_1026277_13_501 | 162 |
| 287 | 3300036401 | Ga0373937_0165210 | Ga0373937_0165210_976_1464 | 162 |
| 288 | 3300036401 | Ga0373937_0255360 | Ga0373937_0255360_1032_1520 | 162 |
| 289 | 3300036401 | Ga0373937_0541307 | Ga0373937_0541307_305_793 | 162 |
| 290 | 3300036459 | Ga0372808_053776 | Ga0372808_053776_78_566 | 162 |
| 291 | 3300037068 | Ga0373925_0002082 | Ga0373925_0002082_970_1458 | 162 |
| 292 | 3300037466 | Ga0395898_0119822 | Ga0395898_0119822_559_1047 | 162 |
| 293 | 3300037853 | Ga0436364_0183141 | Ga0436364_0183141_3778_4266 | 162 |
| 294 | 3300041459 | Ga0451800_1285469 | Ga0451800_1285469_21_518 | 162 |
| 295 | 3300042137 | Ga0450902_016473 | Ga0450902_016473_196_684 | 162 |
| 296 | 3300042157 | Ga0439458_0045826 | Ga0439458_0045826_86_574 | 162 |
| 297 | 3300042438 | Ga0439459_0048730 | Ga0439459_0048730_166_654 | 162 |
| 298 | 3300044684 | Ga0466966_0416913 | Ga0466966_0416913_58_549 | 162 |
| 299 | 3300044693 | Ga0466961_0079250 | Ga0466961_0079250_1429_1920 | 162 |
| 300 | 3300044694 | Ga0466963_0120627 | Ga0466963_0120627_1192_1680 | 162 |
| 301 | 3300044735 | Ga0466968_0030687 | Ga0466968_0030687_60_551 | 162 |
| 302 | 3300044901 | Ga0466960_0022426 | Ga0466960_0022426_278_766 | 162 |
| 303 | 3300045836 | Ga0466958_0305781 | Ga0466958_0305781_44_532 | 162 |
| 304 | 3300045836 | Ga0466958_0578341 | Ga0466958_0578341_100_588 | 162 |
| 305 | 3300045836 | Ga0466958_0771375 | Ga0466958_0771375_23_514 | 162 |
| 306 | 3300045976 | Ga0466967_0074046 | Ga0466967_0074046_56_547 | 162 |
| 307 | 3300045976 | Ga0466967_0118190 | Ga0466967_0118190_783_1271 | 162 |
| 308 | 3300045976 | Ga0466967_0409182 | Ga0466967_0409182_682_1170 | 162 |
| 309 | 3300045976 | Ga0466967_0940552 | Ga0466967_0940552_106_597 | 162 |
| 310 | 3300046455 | Ga0495603_0257194 | Ga0495603_0257194_496_984 | 162 |
| 311 | 3300046459 | Ga0495629_0007464 | Ga0495629_0007464_5381_5869 | 162 |
| 312 | 3300046461 | Ga0495641_0025197 | Ga0495641_0025197_2028_2516 | 162 |
| 313 | 3300046473 | Ga0495582_0006325 | Ga0495582_0006325_1230_1718 | 162 |
| 314 | 3300046473 | Ga0495582_0424310 | Ga0495582_0424310_245_733 | 162 |
| 315 | 3300046477 | Ga0495664_0335399 | Ga0495664_0335399_75_563 | 162 |
| 316 | 3300046511 | Ga0495608_0377958 | Ga0495608_0377958_78_566 | 162 |
| 317 | 3300046514 | Ga0495618_0083083 | Ga0495618_0083083_1263_1751 | 162 |
| 318 | 3300046516 | Ga0495628_0177033 | Ga0495628_0177033_766_1254 | 162 |
| 319 | 3300046516 | Ga0495628_0223520 | Ga0495628_0223520_702_1190 | 162 |
| 320 | 3300046517 | Ga0495630_0060562 | Ga0495630_0060562_2053_2541 | 162 |
| 321 | 3300046517 | Ga0495630_0371399 | Ga0495630_0371399_363_851 | 162 |
| 322 | 3300046517 | Ga0495630_1228883 | Ga0495630_1228883_29_517 | 162 |
| 323 | 3300046526 | Ga0495666_0023955 | Ga0495666_0023955_485_973 | 162 |
| 324 | 3300046529 | Ga0495652_0156633 | Ga0495652_0156633_558_1046 | 162 |
| 325 | 3300046529 | Ga0495652_0241795 | Ga0495652_0241795_361_849 | 162 |
| 326 | 3300046531 | Ga0495665_0068005 | Ga0495665_0068005_386_874 | 162 |
| 327 | 3300046533 | Ga0495640_0044601 | Ga0495640_0044601_2359_2847 | 162 |
| 328 | 3300046535 | Ga0495586_0121114 | Ga0495586_0121114_136_624 | 162 |
| 329 | 3300046536 | Ga0495587_0678325 | Ga0495587_0678325_31_519 | 162 |
| 330 | 3300046616 | Ga0495668_0000455 | Ga0495668_0000455_9448_9942 | 162 |
| 331 | 3300046642 | Ga0495634_0137722 | Ga0495634_0137722_219_707 | 162 |
| 332 | 3300046642 | Ga0495634_0185279 | Ga0495634_0185279_15_503 | 162 |
| 333 | 3300046663 | Ga0495635_0104224 | Ga0495635_0104224_118_606 | 162 |
| 334 | 3300046674 | Ga0495588_0072996 | Ga0495588_0072996_857_1351 | 162 |
| 335 | 3300046680 | Ga0495646_0154220 | Ga0495646_0154220_114_602 | 162 |
| 336 | 3300046681 | Ga0495647_0013112 | Ga0495647_0013112_2312_2800 | 162 |
| 337 | 3300046683 | Ga0495658_0013334 | Ga0495658_0013334_80_568 | 162 |
| 338 | 3300046683 | Ga0495658_0204148 | Ga0495658_0204148_160_648 | 162 |
| 339 | 3300046690 | Ga0495624_0083776 | Ga0495624_0083776_379_867 | 162 |
| 340 | 3300046809 | Ga0495600_0056048 | Ga0495600_0056048_1227_1715 | 162 |
| 341 | 3300047315 | Ga0495581_0008653 | Ga0495581_0008653_3569_4057 | 162 |
| 342 | 3300047317 | Ga0495604_0007148 | Ga0495604_0007148_7820_8308 | 162 |
| 343 | 3300047317 | Ga0495604_0331973 | Ga0495604_0331973_500_988 | 162 |
| 344 | 3300047319 | Ga0495674_0255361 | Ga0495674_0255361_702_1190 | 162 |
| 345 | 3300047319 | Ga0495674_0340281 | Ga0495674_0340281_699_1187 | 162 |
| 346 | 3300047321 | Ga0495676_0048186 | Ga0495676_0048186_1772_2260 | 162 |
| 347 | 3300047322 | Ga0495680_0025378 | Ga0495680_0025378_2315_2803 | 162 |
| 348 | 3300047471 | Ga0495684_0028308 | Ga0495684_0028308_193_681 | 162 |
| 349 | 3300047471 | Ga0495684_0312185 | Ga0495684_0312185_489_977 | 162 |
| 350 | 3300047673 | Ga0495593_0010122 | Ga0495593_0010122_4309_4797 | 162 |
| 351 | 3300047673 | Ga0495593_0051728 | Ga0495593_0051728_538_1026 | 162 |
| 352 | 3300048088 | Ga0495602_0101228 | Ga0495602_0101228_896_1384 | 162 |
| 353 | 3300048905 | Ga0496102_0048132 | Ga0496102_0048132_3105_3593 | 162 |
| 354 | 3300048907 | Ga0496104_0041631 | Ga0496104_0041631_549_1037 | 162 |
| 355 | 3300048907 | Ga0496104_0055880 | Ga0496104_0055880_315_803 | 162 |
| 356 | 3300048907 | Ga0496104_1506119 | Ga0496104_1506119_32_523 | 162 |
| 357 | 3300048908 | Ga0496105_0003546 | Ga0496105_0003546_3093_3581 | 162 |
| 358 | 3300048908 | Ga0496105_0018272 | Ga0496105_0018272_1950_2438 | 162 |
| 359 | 3300048908 | Ga0496105_1051267 | Ga0496105_1051267_85_576 | 162 |
| 360 | 3300048909 | Ga0496106_0007409 | Ga0496106_0007409_4850_5338 | 162 |
| 361 | 3300048910 | Ga0496107_0112542 | Ga0496107_0112542_169_657 | 162 |
| 362 | 3300048911 | Ga0496108_0029522 | Ga0496108_0029522_3089_3583 | 162 |
| 363 | 3300048911 | Ga0496108_0132278 | Ga0496108_0132278_792_1280 | 162 |
| 364 | 3300048911 | Ga0496108_0244680 | Ga0496108_0244680_1007_1501 | 162 |
| 365 | 3300048911 | Ga0496108_0701595 | Ga0496108_0701595_91_579 | 162 |
| 366 | 3300048912 | Ga0496109_0028922 | Ga0496109_0028922_4112_4600 | 162 |
| 367 | 3300048912 | Ga0496109_0051534 | Ga0496109_0051534_2021_2515 | 162 |
| 368 | 3300048912 | Ga0496109_1623248 | Ga0496109_1623248_42_536 | 162 |
| 369 | 3300048913 | Ga0496110_0016744 | Ga0496110_0016744_1885_2379 | 162 |
| 370 | 3300048913 | Ga0496110_0030265 | Ga0496110_0030265_3355_3843 | 162 |
| 371 | 3300048914 | Ga0496111_0008023 | Ga0496111_0008023_2782_3270 | 162 |
| 372 | 3300048914 | Ga0496111_0236287 | Ga0496111_0236287_613_1101 | 162 |
| 373 | 3300048915 | Ga0496112_0465701 | Ga0496112_0465701_51_539 | 162 |
| 374 | 3300048915 | Ga0496112_0502019 | Ga0496112_0502019_193_681 | 162 |
| 375 | 3300048915 | Ga0496112_0527313 | Ga0496112_0527313_473_961 | 162 |
| 376 | 3300048916 | Ga0496113_0047128 | Ga0496113_0047128_2534_3022 | 162 |
| 377 | 3300048917 | Ga0496114_0059656 | Ga0496114_0059656_2614_3108 | 162 |
| 378 | 3300048917 | Ga0496114_0300897 | Ga0496114_0300897_900_1388 | 162 |
| 379 | 3300048928 | Ga0496125_0015483 | Ga0496125_0015483_3458_3952 | 162 |
| 380 | 3300048929 | Ga0496126_0007302 | Ga0496126_0007302_10853_11365 | 162 |
| 381 | 3300049588 | Ga0501072_0211906 | Ga0501072_0211906_698_1186 | 162 |
| 382 | 3300050489 | nmdc:mga03683_292572_c1 | nmdc:mga03683_292572_c1_45_539 | 162 |
| 383 | 3300050490 | nmdc:mga03n38_15964_c1 | nmdc:mga03n38_15964_c1_847_1341 | 162 |
| 384 | 3300050490 | nmdc:mga03n38_260798_c1 | nmdc:mga03n38_260798_c1_220_711 | 162 |
| 385 | 3300050491 | nmdc:mga00v17_75876_c1 | nmdc:mga00v17_75876_c1_356_847 | 162 |
| 386 | 3300050492 | nmdc:mga0yw44_289117_c1 | nmdc:mga0yw44_289117_c1_428_937 | 162 |
| 387 | 3300050492 | nmdc:mga0yw44_37095_c1 | nmdc:mga0yw44_37095_c1_10_501 | 162 |
| 388 | 3300050494 | nmdc:mga06z11_66806_c1 | nmdc:mga06z11_66806_c1_308_799 | 162 |
| 389 | 3300050496 | nmdc:mga07m45_4002_c1 | nmdc:mga07m45_4002_c1_796_1287 | 162 |
| 390 | 3300050496 | nmdc:mga07m45_89945_c1 | nmdc:mga07m45_89945_c1_206_700 | 162 |
| 391 | 3300050507 | nmdc:mga05p37_1166024_c1 | nmdc:mga05p37_1166024_c1_43_531 | 162 |
| 392 | 3300050508 | nmdc:mga09592_167511_c1 | nmdc:mga09592_167511_c1_1290_1778 | 162 |
| 393 | 3300050511 | nmdc:mga08y16_157449_c1 | nmdc:mga08y16_157449_c1_1512_2000 | 162 |
| 394 | 3300050512 | nmdc:mga0n895_117364_c1 | nmdc:mga0n895_117364_c1_379_867 | 162 |
| 395 | 3300050512 | nmdc:mga0n895_32349_c1 | nmdc:mga0n895_32349_c1_666_1154 | 162 |
| 396 | 3300050513 | nmdc:mga0rr50_226116_c1 | nmdc:mga0rr50_226116_c1_901_1389 | 162 |
| 397 | 3300050514 | nmdc:mga08x19_7459_c1 | nmdc:mga08x19_7459_c1_730_1218 | 162 |
| 398 | 3300050515 | nmdc:mga0a205_218415_c1 | nmdc:mga0a205_218415_c1_768_1256 | 162 |
| 399 | 3300050515 | nmdc:mga0a205_996140_c1 | nmdc:mga0a205_996140_c1_32_520 | 162 |
| 400 | 3300050516 | nmdc:mga0sz30_23875_c1 | nmdc:mga0sz30_23875_c1_1633_2124 | 162 |
| 401 | 3300053085 | Ga0495619_0123324 | Ga0495619_0123324_1019_1507 | 162 |
| 402 | 3300053088 | Ga0500644_0025899 | Ga0500644_0025899_1208_1696 | 162 |
| 403 | 3300053140 | Ga0500573_0152892 | Ga0500573_0152892_190_741 | 162 |
| 404 | 3300061719 | Ga0466962_0199342 | Ga0466962_0199342_459_947 | 162 |
| 405 | iso_pu_bacteria | 2751185725 | 2753035381 | 162 |
| 406 | iso_pu_bacteria | 2751185792 | 2753326593 | 162 |
| 407 | 3300002075 | JGI24738J21930_10064511 | JGI24738J21930_100645112 | 163 |
| 408 | 3300003373 | JGI25407J50210_10001230 | JGI25407J50210_100012306 | 163 |
| 409 | 3300005327 | Ga0070658_10191274 | Ga0070658_101912743 | 163 |
| 410 | 3300005329 | Ga0070683_100000645 | Ga0070683_1000006455 | 163 |
| 411 | 3300005329 | Ga0070683_100008181 | Ga0070683_1000081813 | 163 |
| 412 | 3300005331 | Ga0070670_101794019 | Ga0070670_1017940191 | 163 |
| 413 | 3300005334 | Ga0068869_100013296 | Ga0068869_1000132965 | 163 |
| 414 | 3300005337 | Ga0070682_100007182 | Ga0070682_1000071827 | 163 |
| 415 | 3300005337 | Ga0070682_100007928 | Ga0070682_1000079287 | 163 |
| 416 | 3300005338 | Ga0068868_100016666 | Ga0068868_1000166665 | 163 |
| 417 | 3300005339 | Ga0070660_100102593 | Ga0070660_1001025934 | 163 |
| 418 | 3300005341 | Ga0070691_10045552 | Ga0070691_100455522 | 163 |
| 419 | 3300005341 | Ga0070691_10477458 | Ga0070691_104774581 | 163 |
| 420 | 3300005344 | Ga0070661_100012025 | Ga0070661_1000120257 | 163 |
| 421 | 3300005347 | Ga0070668_100358589 | Ga0070668_1003585892 | 163 |
| 422 | 3300005354 | Ga0070675_100074866 | Ga0070675_1000748663 | 163 |
| 423 | 3300005354 | Ga0070675_100336247 | Ga0070675_1003362471 | 163 |
| 424 | 3300005355 | Ga0070671_100097460 | Ga0070671_1000974603 | 163 |
| 425 | 3300005356 | Ga0070674_100622438 | Ga0070674_1006224382 | 163 |
| 426 | 3300005364 | Ga0070673_100351819 | Ga0070673_1003518193 | 163 |
| 427 | 3300005365 | Ga0070688_100033036 | Ga0070688_1000330363 | 163 |
| 428 | 3300005366 | Ga0070659_100078634 | Ga0070659_1000786342 | 163 |
| 429 | 3300005367 | Ga0070667_100358745 | Ga0070667_1003587452 | 163 |
| 430 | 3300005441 | Ga0070700_100008738 | Ga0070700_1000087382 | 163 |
| 431 | 3300005455 | Ga0070663_100144532 | Ga0070663_1001445322 | 163 |
| 432 | 3300005456 | Ga0070678_100016305 | Ga0070678_1000163055 | 163 |
| 433 | 3300005457 | Ga0070662_100171939 | Ga0070662_1001719392 | 163 |
| 434 | 3300005458 | Ga0070681_10004229 | Ga0070681_1000422912 | 163 |
| 435 | 3300005466 | Ga0070685_10168581 | Ga0070685_101685812 | 163 |
| 436 | 3300005530 | Ga0070679_100009544 | Ga0070679_10000954410 | 163 |
| 437 | 3300005530 | Ga0070679_100657368 | Ga0070679_1006573681 | 163 |
| 438 | 3300005535 | Ga0070684_100003617 | Ga0070684_1000036173 | 163 |
| 439 | 3300005535 | Ga0070684_100046824 | Ga0070684_1000468244 | 163 |
| 440 | 3300005539 | Ga0068853_100103857 | Ga0068853_1001038572 | 163 |
| 441 | 3300005545 | Ga0070695_100545892 | Ga0070695_1005458921 | 163 |
| 442 | 3300005548 | Ga0070665_100109040 | Ga0070665_1001090404 | 163 |
| 443 | 3300005564 | Ga0070664_100003373 | Ga0070664_10000337313 | 163 |
| 444 | 3300005564 | Ga0070664_100004267 | Ga0070664_1000042677 | 163 |
| 445 | 3300005577 | Ga0068857_100113374 | Ga0068857_1001133741 | 163 |
| 446 | 3300005578 | Ga0068854_100112119 | Ga0068854_1001121193 | 163 |
| 447 | 3300005614 | Ga0068856_100005907 | Ga0068856_10000590710 | 163 |
| 448 | 3300005614 | Ga0068856_100014656 | Ga0068856_1000146566 | 163 |
| 449 | 3300005615 | Ga0070702_100749298 | Ga0070702_1007492981 | 163 |
| 450 | 3300005617 | Ga0068859_101673156 | Ga0068859_1016731561 | 163 |
| 451 | 3300005618 | Ga0068864_100075568 | Ga0068864_1000755683 | 163 |
| 452 | 3300005718 | Ga0068866_10148215 | Ga0068866_101482152 | 163 |
| 453 | 3300005842 | Ga0068858_100810391 | Ga0068858_1008103913 | 163 |
| 454 | 3300005843 | Ga0068860_100467415 | Ga0068860_1004674152 | 163 |
| 455 | 3300005843 | Ga0068860_102095375 | Ga0068860_1020953751 | 163 |
| 456 | 3300005981 | Ga0081538_10001711 | Ga0081538_100017114 | 163 |
| 457 | 3300006175 | Ga0070712_100306531 | Ga0070712_1003065312 | 163 |
| 458 | 3300006847 | Ga0075431_100534283 | Ga0075431_1005342833 | 163 |
| 459 | 3300006852 | Ga0075433_10257675 | Ga0075433_102576751 | 163 |
| 460 | 3300006871 | Ga0075434_101584206 | Ga0075434_1015842062 | 163 |
| 461 | 3300006881 | Ga0068865_100052661 | Ga0068865_1000526612 | 163 |
| 462 | 3300006931 | Ga0097620_101673132 | Ga0097620_1016731321 | 163 |
| 463 | 3300009098 | Ga0105245_10004181 | Ga0105245_100041815 | 163 |
| 464 | 3300009147 | Ga0114129_12041070 | Ga0114129_120410701 | 163 |
| 465 | 3300009174 | Ga0105241_10091554 | Ga0105241_100915541 | 163 |
| 466 | 3300009177 | Ga0105248_11240191 | Ga0105248_112401911 | 163 |
| 467 | 3300009545 | Ga0105237_10142080 | Ga0105237_101420802 | 163 |
| 468 | 3300009545 | Ga0105237_10316468 | Ga0105237_103164682 | 163 |
| 469 | 3300009551 | Ga0105238_10143677 | Ga0105238_101436772 | 163 |
| 470 | 3300009551 | Ga0105238_11119585 | Ga0105238_111195851 | 163 |
| 471 | 3300010375 | Ga0105239_10051102 | Ga0105239_100511025 | 163 |
| 472 | 3300010375 | Ga0105239_10339748 | Ga0105239_103397481 | 163 |
| 473 | 3300011119 | Ga0105246_10007691 | Ga0105246_100076913 | 163 |
| 474 | 3300013100 | Ga0157373_10177090 | Ga0157373_101770902 | 163 |
| 475 | 3300013102 | Ga0157371_10080858 | Ga0157371_100808581 | 163 |
| 476 | 3300013105 | Ga0157369_10074949 | Ga0157369_100749494 | 163 |
| 477 | 3300013296 | Ga0157374_10007098 | Ga0157374_1000709810 | 163 |
| 478 | 3300013296 | Ga0157374_10030772 | Ga0157374_100307721 | 163 |
| 479 | 3300013297 | Ga0157378_10268853 | Ga0157378_102688532 | 163 |
| 480 | 3300013307 | Ga0157372_10007491 | Ga0157372_100074913 | 163 |
| 481 | 3300013307 | Ga0157372_10012336 | Ga0157372_100123363 | 163 |
| 482 | 3300013308 | Ga0157375_10017301 | Ga0157375_100173017 | 163 |
| 483 | 3300013308 | Ga0157375_10292475 | Ga0157375_102924754 | 163 |
| 484 | 3300014325 | Ga0163163_10562139 | Ga0163163_105621392 | 163 |
| 485 | 3300014326 | Ga0157380_10057796 | Ga0157380_100577962 | 163 |
| 486 | 3300014745 | Ga0157377_10000822 | Ga0157377_100008224 | 163 |
| 487 | 3300014745 | Ga0157377_10004097 | Ga0157377_100040974 | 163 |
| 488 | 3300014968 | Ga0157379_10477852 | Ga0157379_104778522 | 163 |
| 489 | 3300014969 | Ga0157376_10025716 | Ga0157376_100257166 | 163 |
| 490 | 3300017792 | Ga0163161_11696552 | Ga0163161_116965521 | 163 |
| 491 | 3300020070 | Ga0206356_11021213 | Ga0206356_110212132 | 163 |
| 492 | 3300020082 | Ga0206353_11048529 | Ga0206353_110485291 | 163 |
| 493 | 3300022467 | Ga0224712_10199793 | Ga0224712_101997933 | 163 |
| 494 | 3300025901 | Ga0207688_10000691 | Ga0207688_1000069110 | 163 |
| 495 | 3300025904 | Ga0207647_10206504 | Ga0207647_102065042 | 163 |
| 496 | 3300025907 | Ga0207645_10258558 | Ga0207645_102585581 | 163 |
| 497 | 3300025909 | Ga0207705_10327046 | Ga0207705_103270462 | 163 |
| 498 | 3300025915 | Ga0207693_10106583 | Ga0207693_101065833 | 163 |
| 499 | 3300025915 | Ga0207693_10145393 | Ga0207693_101453933 | 163 |
| 500 | 3300025919 | Ga0207657_10054199 | Ga0207657_100541991 | 163 |
| 501 | 3300025919 | Ga0207657_10066688 | Ga0207657_100666883 | 163 |
| 502 | 3300025920 | Ga0207649_10127350 | Ga0207649_101273502 | 163 |
| 503 | 3300025921 | Ga0207652_10397810 | Ga0207652_103978102 | 163 |
| 504 | 3300025925 | Ga0207650_11464015 | Ga0207650_114640151 | 163 |
| 505 | 3300025926 | Ga0207659_10039209 | Ga0207659_100392092 | 163 |
| 506 | 3300025927 | Ga0207687_10115745 | Ga0207687_101157452 | 163 |
| 507 | 3300025931 | Ga0207644_10031153 | Ga0207644_100311532 | 163 |
| 508 | 3300025932 | Ga0207690_10071828 | Ga0207690_100718282 | 163 |
| 509 | 3300025935 | Ga0207709_10032271 | Ga0207709_100322713 | 163 |
| 510 | 3300025937 | Ga0207669_10149399 | Ga0207669_101493991 | 163 |
| 511 | 3300025940 | Ga0207691_10836918 | Ga0207691_108369182 | 163 |
| 512 | 3300025941 | Ga0207711_10044758 | Ga0207711_100447582 | 163 |
| 513 | 3300025942 | Ga0207689_10040643 | Ga0207689_100406434 | 163 |
| 514 | 3300025944 | Ga0207661_10000277 | Ga0207661_1000027722 | 163 |
| 515 | 3300025944 | Ga0207661_10056730 | Ga0207661_100567304 | 163 |
| 516 | 3300025961 | Ga0207712_10136107 | Ga0207712_101361072 | 163 |
| 517 | 3300025981 | Ga0207640_10102043 | Ga0207640_101020434 | 163 |
| 518 | 3300025986 | Ga0207658_10299078 | Ga0207658_102990782 | 163 |
| 519 | 3300026023 | Ga0207677_10370233 | Ga0207677_103702332 | 163 |
| 520 | 3300026035 | Ga0207703_10425696 | Ga0207703_104256962 | 163 |
| 521 | 3300026067 | Ga0207678_10053507 | Ga0207678_100535074 | 163 |
| 522 | 3300026075 | Ga0207708_10001612 | Ga0207708_100016122 | 163 |
| 523 | 3300026078 | Ga0207702_10059280 | Ga0207702_100592805 | 163 |
| 524 | 3300026088 | Ga0207641_10058565 | Ga0207641_100585653 | 163 |
| 525 | 3300026089 | Ga0207648_10187483 | Ga0207648_101874831 | 163 |
| 526 | 3300026095 | Ga0207676_10018388 | Ga0207676_100183887 | 163 |
| 527 | 3300026116 | Ga0207674_10398887 | Ga0207674_103988873 | 163 |
| 528 | 3300026121 | Ga0207683_10391261 | Ga0207683_103912612 | 163 |
| 529 | 3300026142 | Ga0207698_10055350 | Ga0207698_100553503 | 163 |
| 530 | 3300028381 | Ga0268264_10410038 | Ga0268264_104100382 | 163 |
| 531 | 3300031456 | Ga0307513_10002569 | Ga0307513_100025699 | 163 |
| 532 | 3300031616 | Ga0307508_10141722 | Ga0307508_101417222 | 163 |
| 533 | 3300035089 | Ga0373944_0026988 | Ga0373944_0026988_326_826 | 163 |
| 534 | 3300035116 | Ga0373945_0059918 | Ga0373945_0059918_338_838 | 163 |
| 535 | 3300035118 | Ga0373954_0070231 | Ga0373954_0070231_605_1105 | 163 |
| 536 | 3300035170 | Ga0373943_0011580 | Ga0373943_0011580_1335_1835 | 163 |
| 537 | 3300035171 | Ga0373946_0066247 | Ga0373946_0066247_789_1289 | 163 |
| 538 | 3300035172 | Ga0373955_0139767 | Ga0373955_0139767_230_730 | 163 |
| 539 | 3300035410 | Ga0373924_0041898 | Ga0373924_0041898_810_1310 | 163 |
| 540 | 3300035724 | Ga0373933_0075850 | Ga0373933_0075850_874_1374 | 163 |
| 541 | 3300035725 | Ga0373947_0015886 | Ga0373947_0015886_3022_3522 | 163 |
| 542 | 3300036401 | Ga0373937_0011172 | Ga0373937_0011172_3773_4273 | 163 |
| 543 | 3300037068 | Ga0373925_0025135 | Ga0373925_0025135_2827_3327 | 163 |
| 544 | 3300044694 | Ga0466963_0398797 | Ga0466963_0398797_164_655 | 163 |
| 545 | 3300044719 | Ga0466971_0162254 | Ga0466971_0162254_352_843 | 163 |
| 546 | 3300045836 | Ga0466958_0040795 | Ga0466958_0040795_1087_1578 | 163 |
| 547 | 3300045836 | Ga0466958_0474518 | Ga0466958_0474518_285_776 | 163 |
| 548 | 3300046454 | Ga0495592_0166421 | Ga0495592_0166421_325_825 | 163 |
| 549 | 3300046455 | Ga0495603_0097156 | Ga0495603_0097156_809_1309 | 163 |
| 550 | 3300046461 | Ga0495641_0013609 | Ga0495641_0013609_2230_2730 | 163 |
| 551 | 3300046463 | Ga0495653_0004538 | Ga0495653_0004538_1167_1667 | 163 |
| 552 | 3300046472 | Ga0495580_0047205 | Ga0495580_0047205_2216_2716 | 163 |
| 553 | 3300046475 | Ga0495639_0003200 | Ga0495639_0003200_4787_5287 | 163 |
| 554 | 3300046499 | Ga0495594_0013348 | Ga0495594_0013348_192_692 | 163 |
| 555 | 3300046511 | Ga0495608_0013885 | Ga0495608_0013885_4995_5528 | 163 |
| 556 | 3300046514 | Ga0495618_0008168 | Ga0495618_0008168_4852_5352 | 163 |
| 557 | 3300046517 | Ga0495630_0025918 | Ga0495630_0025918_609_1109 | 163 |
| 558 | 3300046526 | Ga0495666_0129169 | Ga0495666_0129169_344_844 | 163 |
| 559 | 3300046529 | Ga0495652_0182782 | Ga0495652_0182782_982_1482 | 163 |
| 560 | 3300046533 | Ga0495640_0039620 | Ga0495640_0039620_1952_2452 | 163 |
| 561 | 3300046535 | Ga0495586_0063868 | Ga0495586_0063868_439_939 | 163 |
| 562 | 3300046536 | Ga0495587_0088942 | Ga0495587_0088942_242_742 | 163 |
| 563 | 3300046559 | Ga0495667_0001764 | Ga0495667_0001764_10228_10728 | 163 |
| 564 | 3300046642 | Ga0495634_0023344 | Ga0495634_0023344_3524_4024 | 163 |
| 565 | 3300046674 | Ga0495588_0017724 | Ga0495588_0017724_1924_2424 | 163 |
| 566 | 3300046675 | Ga0495657_0002947 | Ga0495657_0002947_9720_10220 | 163 |
| 567 | 3300046680 | Ga0495646_0117664 | Ga0495646_0117664_81_581 | 163 |
| 568 | 3300046680 | Ga0495646_0506797 | Ga0495646_0506797_26_526 | 163 |
| 569 | 3300046681 | Ga0495647_0034373 | Ga0495647_0034373_633_1133 | 163 |
| 570 | 3300046683 | Ga0495658_0003530 | Ga0495658_0003530_3596_4096 | 163 |
| 571 | 3300046689 | Ga0495613_0010160 | Ga0495613_0010160_3684_4184 | 163 |
| 572 | 3300046690 | Ga0495624_0011009 | Ga0495624_0011009_3527_4060 | 163 |
| 573 | 3300046690 | Ga0495624_0356740 | Ga0495624_0356740_158_685 | 163 |
| 574 | 3300046809 | Ga0495600_0017157 | Ga0495600_0017157_1023_1523 | 163 |
| 575 | 3300047315 | Ga0495581_0017634 | Ga0495581_0017634_3312_3812 | 163 |
| 576 | 3300047317 | Ga0495604_0013106 | Ga0495604_0013106_1519_2019 | 163 |
| 577 | 3300047319 | Ga0495674_0024837 | Ga0495674_0024837_688_1215 | 163 |
| 578 | 3300047319 | Ga0495674_0034269 | Ga0495674_0034269_4008_4508 | 163 |
| 579 | 3300047321 | Ga0495676_0005830 | Ga0495676_0005830_9440_9940 | 163 |
| 580 | 3300047322 | Ga0495680_0009868 | Ga0495680_0009868_1273_1773 | 163 |
| 581 | 3300047471 | Ga0495684_0004208 | Ga0495684_0004208_2785_3285 | 163 |
| 582 | 3300047673 | Ga0495593_0013915 | Ga0495593_0013915_3477_3977 | 163 |
| 583 | 3300048088 | Ga0495602_0730676 | Ga0495602_0730676_113_613 | 163 |
| 584 | 3300048903 | Ga0496100_0029937 | Ga0496100_0029937_1141_1632 | 163 |
| 585 | 3300048903 | Ga0496100_0229885 | Ga0496100_0229885_420_926 | 163 |
| 586 | 3300048904 | Ga0496101_0017662 | Ga0496101_0017662_873_1364 | 163 |
| 587 | 3300048905 | Ga0496102_0089693 | Ga0496102_0089693_1060_1551 | 163 |
| 588 | 3300048905 | Ga0496102_0740709 | Ga0496102_0740709_175_666 | 163 |
| 589 | 3300048906 | Ga0496103_0018758 | Ga0496103_0018758_1249_1740 | 163 |
| 590 | 3300048907 | Ga0496104_0023168 | Ga0496104_0023168_707_1198 | 163 |
| 591 | 3300048907 | Ga0496104_0117648 | Ga0496104_0117648_121_612 | 163 |
| 592 | 3300048908 | Ga0496105_0018448 | Ga0496105_0018448_1642_2133 | 163 |
| 593 | 3300048909 | Ga0496106_0021970 | Ga0496106_0021970_1167_1658 | 163 |
| 594 | 3300048910 | Ga0496107_0127629 | Ga0496107_0127629_1079_1570 | 163 |
| 595 | 3300048911 | Ga0496108_0005484 | Ga0496108_0005484_4985_5476 | 163 |
| 596 | 3300048912 | Ga0496109_0018316 | Ga0496109_0018316_4179_4670 | 163 |
| 597 | 3300048912 | Ga0496109_0050143 | Ga0496109_0050143_975_1466 | 163 |
| 598 | 3300048913 | Ga0496110_0003522 | Ga0496110_0003522_8799_9290 | 163 |
| 599 | 3300048913 | Ga0496110_0022592 | Ga0496110_0022592_3709_4200 | 163 |
| 600 | 3300048914 | Ga0496111_0006940 | Ga0496111_0006940_2193_2684 | 163 |
| 601 | 3300048915 | Ga0496112_0025202 | Ga0496112_0025202_1239_1730 | 163 |
| 602 | 3300048916 | Ga0496113_0022346 | Ga0496113_0022346_1822_2313 | 163 |
| 603 | 3300048916 | Ga0496113_0180956 | Ga0496113_0180956_264_755 | 163 |
| 604 | 3300048917 | Ga0496114_0825259 | Ga0496114_0825259_248_739 | 163 |
| 605 | 3300048918 | Ga0496115_0188317 | Ga0496115_0188317_414_905 | 163 |
| 606 | 3300049584 | Ga0501068_0486623 | Ga0501068_0486623_65_556 | 163 |
| 607 | 3300050510 | nmdc:mga06r32_1177145_c1 | nmdc:mga06r32_1177145_c1_69_560 | 163 |
| 608 | 3300050510 | nmdc:mga06r32_1276631_c1 | nmdc:mga06r32_1276631_c1_17_508 | 163 |
| 609 | 3300050512 | nmdc:mga0n895_794615_c1 | nmdc:mga0n895_794615_c1_229_720 | 163 |
| 610 | 3300050513 | nmdc:mga0rr50_913049_c1 | nmdc:mga0rr50_913049_c1_75_566 | 163 |
| 611 | 3300053077 | Ga0495601_0268474 | Ga0495601_0268474_385_912 | 163 |
| 612 | 3300053078 | Ga0495612_0096718 | Ga0495612_0096718_302_829 | 163 |
| 613 | 3300053084 | Ga0495595_0022864 | Ga0495595_0022864_699_1199 | 163 |
| 614 | 3300053085 | Ga0495619_0017914 | Ga0495619_0017914_2216_2716 | 163 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yf5-assembly1.cif.gz_A | crystal structure of rv1284 in the presence of polycarpine at acidic ph | 0.968 | 1 | 163 |
| 3las-assembly1.cif.gz_B | crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution | 0.9333 | 1 | 163 |
| 3las-assembly1.cif.gz_B | crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution | 0.9279 | 1 | 163 |
| 6jqc-assembly1.cif.gz_B | the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus | 0.9264 | 1 | 163 |
| 6jqd-assembly1.cif.gz_B | the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus | 0.9233 | 1 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ylkA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9699 | 1 | 163 | 3.40.1050.10 |
| af_Q5A207_1_162_3.40.1050.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9571 | 1 | 163 | 3.40.1050.10 |
| af_Q5A207_1_162_3.40.1050.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9513 | 1 | 163 | 3.40.1050.10 |
| 3lasB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9333 | 1 | 163 | 3.40.1050.10 |
| 3lasB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9279 | 1 | 163 | 3.40.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N0UMF2-F1-model_v4 | Carbonic anhydrase | 0.998 | 37 | 163 |
GO:0004089
GO:0008270 |
| AF-A0A7X3VUN9-F1-model_v4 | Carbonic anhydrase | 0.9938 | 37 | 163 |
GO:0004089
GO:0008270 |
| AF-X8C1Z8-F1-model_v4 | deleted | 0.9921 | 34 | 149 |
|
| AF-A0A7L7MHV6-F1-model_v4 | Carbonic anhydrase | 0.9911 | 26 | 163 |
GO:0004089
GO:0008270 |
| AF-A0A5N0UMF2-F1-model_v4 | Carbonic anhydrase | 0.9902 | 37 | 163 |
GO:0004089
GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar