F469398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 614 | 263 | 1228 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300050514|nmdc:mga08x19_306953_c1|nmdc:mga08x19_306953_c1_599_877 |
| Length | 92 |
| Sequence | MSLHPHEQPPRXXXXSQFENFTASSLFCEKCKTATPVRERLLLVLPEKEIFDYLCTECGSSVGQREVTAGEKMVTEAMRPRQQVRIPLRSLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 159 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 184 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 189 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 190 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 191 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 192 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 193 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 194 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 195 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 196 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.96 |
| Rhizosphere | 89.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 37.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga08x19_306953_c1 | 3300050514 | Bacteria | 1103 |
| 2 | SwRhRL2b_contig_487712 | 2162886007 | Unclassified | 1639 |
| 3 | JGI25405J52794_10001154 | 3300003911 | Bacteria | 4258 |
| 4 | JGI25405J52794_10114037 | 3300003911 | Unclassified | 607 |
| 5 | Ga0065714_10261922 | 3300005288 | Bacteria | 755 |
| 6 | Ga0065704_10115402 | 3300005289 | Unclassified | 1872 |
| 7 | Ga0065704_10696436 | 3300005289 | Bacteria | 563 |
| 8 | Ga0065712_10003065 | 3300005290 | Bacteria | 6204 |
| 9 | Ga0065712_10010801 | 3300005290 | Bacteria | 4447 |
| 10 | Ga0065712_10037007 | 3300005290 | Bacteria | 1158 |
| 11 | Ga0065712_10081269 | 3300005290 | Bacteria | 3023 |
| 12 | Ga0065712_10158908 | 3300005290 | Bacteria | 1316 |
| 13 | Ga0065712_10270745 | 3300005290 | Bacteria | 916 |
| 14 | Ga0065712_10540651 | 3300005290 | Bacteria | 624 |
| 15 | Ga0065715_10016501 | 3300005293 | Unclassified | 3797 |
| 16 | Ga0065715_10021146 | 3300005293 | Bacteria | 1980 |
| 17 | Ga0065715_10052240 | 3300005293 | Unclassified | 1072 |
| 18 | Ga0065715_10091525 | 3300005293 | Bacteria | 5726 |
| 19 | Ga0065715_10324687 | 3300005293 | Unclassified | 995 |
| 20 | Ga0065715_10372717 | 3300005293 | Bacteria | 919 |
| 21 | Ga0065715_10577688 | 3300005293 | Unclassified | 722 |
| 22 | Ga0065715_10836330 | 3300005293 | Bacteria | 597 |
| 23 | Ga0065715_11041566 | 3300005293 | Unclassified | 526 |
| 24 | Ga0065707_10067356 | 3300005295 | Bacteria | 558 |
| 25 | Ga0065707_10075781 | 3300005295 | Bacteria | 509 |
| 26 | Ga0065707_10215638 | 3300005295 | Bacteria | 1246 |
| 27 | Ga0065707_10243477 | 3300005295 | Bacteria | 1138 |
| 28 | Ga0065707_10259383 | 3300005295 | Bacteria | 1102 |
| 29 | Ga0070676_10085172 | 3300005328 | Bacteria | 1925 |
| 30 | Ga0070676_11051733 | 3300005328 | Unclassified | 613 |
| 31 | Ga0070683_101486798 | 3300005329 | Bacteria | 651 |
| 32 | Ga0070690_100646375 | 3300005330 | Bacteria | 807 |
| 33 | Ga0070670_100339960 | 3300005331 | Bacteria | 1317 |
| 34 | Ga0070670_101449333 | 3300005331 | Bacteria | 630 |
| 35 | Ga0068869_100359995 | 3300005334 | Unclassified | 1188 |
| 36 | Ga0068869_100383853 | 3300005334 | Unclassified | 1152 |
| 37 | Ga0070680_100219233 | 3300005336 | Unclassified | 1606 |
| 38 | Ga0070682_100300714 | 3300005337 | Bacteria | 1177 |
| 39 | Ga0068868_100097921 | 3300005338 | Bacteria | 2371 |
| 40 | Ga0068868_101307261 | 3300005338 | Bacteria | 674 |
| 41 | Ga0070660_100057421 | 3300005339 | Bacteria | 3015 |
| 42 | Ga0070660_100735156 | 3300005339 | Bacteria | 828 |
| 43 | Ga0070660_101113105 | 3300005339 | Unclassified | 669 |
| 44 | Ga0070689_100087900 | 3300005340 | Bacteria | 2446 |
| 45 | Ga0070689_100327029 | 3300005340 | Unclassified | 1282 |
| 46 | Ga0070689_101357518 | 3300005340 | Unclassified | 641 |
| 47 | Ga0070687_100174912 | 3300005343 | Bacteria | 1281 |
| 48 | Ga0070687_100595681 | 3300005343 | Bacteria | 759 |
| 49 | Ga0070661_100152481 | 3300005344 | Bacteria | 1747 |
| 50 | Ga0070668_100037400 | 3300005347 | Bacteria | 3706 |
| 51 | Ga0070668_101842434 | 3300005347 | Unclassified | 557 |
| 52 | Ga0070669_100009942 | 3300005353 | Bacteria | 6770 |
| 53 | Ga0070675_100010797 | 3300005354 | Bacteria | 7142 |
| 54 | Ga0070675_100026530 | 3300005354 | Bacteria | 4650 |
| 55 | Ga0070675_100182827 | 3300005354 | Bacteria | 1813 |
| 56 | Ga0070675_100514618 | 3300005354 | Bacteria | 1079 |
| 57 | Ga0070675_101387309 | 3300005354 | Unclassified | 648 |
| 58 | Ga0070671_100389905 | 3300005355 | Unclassified | 1191 |
| 59 | Ga0070671_100442229 | 3300005355 | Unclassified | 1115 |
| 60 | Ga0070671_100704107 | 3300005355 | Bacteria | 876 |
| 61 | Ga0070671_100800582 | 3300005355 | Bacteria | 821 |
| 62 | Ga0070671_101332223 | 3300005355 | Bacteria | 633 |
| 63 | Ga0070674_102066612 | 3300005356 | Unclassified | 519 |
| 64 | Ga0070673_100113473 | 3300005364 | Bacteria | 2250 |
| 65 | Ga0070688_100002376 | 3300005365 | Bacteria | 9504 |
| 66 | Ga0070688_100018766 | 3300005365 | Bacteria | 3999 |
| 67 | Ga0070688_100211578 | 3300005365 | Bacteria | 1361 |
| 68 | Ga0070688_100456199 | 3300005365 | Unclassified | 956 |
| 69 | Ga0070659_100007384 | 3300005366 | Bacteria | 7984 |
| 70 | Ga0070659_100061699 | 3300005366 | Bacteria | 2963 |
| 71 | Ga0070659_100756088 | 3300005366 | Unclassified | 843 |
| 72 | Ga0070659_102092515 | 3300005366 | Unclassified | 509 |
| 73 | Ga0070667_100168843 | 3300005367 | Bacteria | 1930 |
| 74 | Ga0070667_100822872 | 3300005367 | Unclassified | 863 |
| 75 | Ga0070703_10033710 | 3300005406 | Unclassified | 1560 |
| 76 | Ga0070703_10175429 | 3300005406 | Unclassified | 824 |
| 77 | Ga0070709_10052815 | 3300005434 | Bacteria | 2556 |
| 78 | Ga0070714_100095258 | 3300005435 | Bacteria | 2614 |
| 79 | Ga0070713_100067358 | 3300005436 | Bacteria | 3014 |
| 80 | Ga0070713_100320294 | 3300005436 | Bacteria | 1432 |
| 81 | Ga0070713_101850290 | 3300005436 | Unclassified | 586 |
| 82 | Ga0070710_10088599 | 3300005437 | Bacteria | 1821 |
| 83 | Ga0070710_10160255 | 3300005437 | Bacteria | 1394 |
| 84 | Ga0070710_10467498 | 3300005437 | Bacteria | 858 |
| 85 | Ga0070710_11082467 | 3300005437 | Bacteria | 588 |
| 86 | Ga0070701_10230075 | 3300005438 | Unclassified | 1110 |
| 87 | Ga0070711_100719774 | 3300005439 | Bacteria | 841 |
| 88 | Ga0070705_100014916 | 3300005440 | Bacteria | 4008 |
| 89 | Ga0070705_100438717 | 3300005440 | Bacteria | 977 |
| 90 | Ga0070700_100070627 | 3300005441 | Unclassified | 2227 |
| 91 | Ga0070694_100106175 | 3300005444 | Bacteria | 1994 |
| 92 | Ga0070694_101966160 | 3300005444 | Unclassified | 500 |
| 93 | Ga0070708_100002881 | 3300005445 | Bacteria | 13354 |
| 94 | Ga0070708_100006600 | 3300005445 | Bacteria | 9237 |
| 95 | Ga0070708_100034509 | 3300005445 | Bacteria | 4402 |
| 96 | Ga0070708_100102832 | 3300005445 | Bacteria | 2618 |
| 97 | Ga0070708_100112692 | 3300005445 | Bacteria | 2502 |
| 98 | Ga0070708_100224520 | 3300005445 | Bacteria | 1762 |
| 99 | Ga0070708_100356893 | 3300005445 | Bacteria | 1378 |
| 100 | Ga0070708_100405283 | 3300005445 | Bacteria | 1286 |
| 101 | Ga0070708_101512084 | 3300005445 | Bacteria | 625 |
| 102 | Ga0070708_101921046 | 3300005445 | Unclassified | 549 |
| 103 | Ga0070662_100026771 | 3300005457 | Bacteria | 3996 |
| 104 | Ga0070662_100076944 | 3300005457 | Bacteria | 2475 |
| 105 | Ga0070662_100383282 | 3300005457 | Bacteria | 1157 |
| 106 | Ga0070662_100936906 | 3300005457 | Unclassified | 740 |
| 107 | Ga0070681_10338346 | 3300005458 | Unclassified | 1414 |
| 108 | Ga0070706_100020713 | 3300005467 | Bacteria | 6058 |
| 109 | Ga0070706_100101456 | 3300005467 | Bacteria | 2674 |
| 110 | Ga0070706_100170449 | 3300005467 | Bacteria | 2032 |
| 111 | Ga0070706_100336723 | 3300005467 | Bacteria | 1407 |
| 112 | Ga0070706_100414643 | 3300005467 | Bacteria | 1254 |
| 113 | Ga0070706_100921693 | 3300005467 | Bacteria | 807 |
| 114 | Ga0070706_101060489 | 3300005467 | Unclassified | 746 |
| 115 | Ga0070707_100000846 | 3300005468 | Bacteria | 30361 |
| 116 | Ga0070707_100023714 | 3300005468 | Bacteria | 5803 |
| 117 | Ga0070707_100026907 | 3300005468 | Bacteria | 5467 |
| 118 | Ga0070707_100043665 | 3300005468 | Bacteria | 4289 |
| 119 | Ga0070707_100108398 | 3300005468 | Bacteria | 2694 |
| 120 | Ga0070707_100110748 | 3300005468 | Bacteria | 2663 |
| 121 | Ga0070707_100185506 | 3300005468 | Bacteria | 2028 |
| 122 | Ga0070707_100211197 | 3300005468 | Bacteria | 1892 |
| 123 | Ga0070707_100219458 | 3300005468 | Bacteria | 1852 |
| 124 | Ga0070707_100811188 | 3300005468 | Unclassified | 900 |
| 125 | Ga0070707_100837756 | 3300005468 | Unclassified | 884 |
| 126 | Ga0070707_101173691 | 3300005468 | Unclassified | 734 |
| 127 | Ga0070707_101540407 | 3300005468 | Bacteria | 632 |
| 128 | Ga0070698_100005905 | 3300005471 | Bacteria | 13355 |
| 129 | Ga0070698_100007983 | 3300005471 | Bacteria | 11444 |
| 130 | Ga0070698_100038467 | 3300005471 | Bacteria | 4929 |
| 131 | Ga0070698_100060761 | 3300005471 | Bacteria | 3812 |
| 132 | Ga0070698_100620749 | 3300005471 | Unclassified | 1022 |
| 133 | Ga0070698_101980476 | 3300005471 | Unclassified | 536 |
| 134 | Ga0070699_100178700 | 3300005518 | Bacteria | 1883 |
| 135 | Ga0070699_100244776 | 3300005518 | Bacteria | 1601 |
| 136 | Ga0070699_100335856 | 3300005518 | Bacteria | 1359 |
| 137 | Ga0070699_100791394 | 3300005518 | Bacteria | 868 |
| 138 | Ga0070699_101294833 | 3300005518 | Unclassified | 668 |
| 139 | Ga0070699_102117501 | 3300005518 | Unclassified | 514 |
| 140 | Ga0070679_100298551 | 3300005530 | Unclassified | 1561 |
| 141 | Ga0070684_100001535 | 3300005535 | Bacteria | 16699 |
| 142 | Ga0070684_100706982 | 3300005535 | Bacteria | 940 |
| 143 | Ga0070697_100000863 | 3300005536 | Bacteria | 22791 |
| 144 | Ga0070697_100003442 | 3300005536 | Bacteria | 12164 |
| 145 | Ga0070697_100006005 | 3300005536 | Bacteria | 9392 |
| 146 | Ga0070697_100078405 | 3300005536 | Unclassified | 2718 |
| 147 | Ga0070697_100088819 | 3300005536 | Bacteria | 2553 |
| 148 | Ga0070697_100129616 | 3300005536 | Bacteria | 2115 |
| 149 | Ga0070697_100160611 | 3300005536 | Bacteria | 1898 |
| 150 | Ga0070697_101240437 | 3300005536 | Unclassified | 665 |
| 151 | Ga0068853_101004612 | 3300005539 | Unclassified | 803 |
| 152 | Ga0070672_101199276 | 3300005543 | Unclassified | 676 |
| 153 | Ga0070672_101246800 | 3300005543 | Unclassified | 663 |
| 154 | Ga0070672_101364844 | 3300005543 | Unclassified | 633 |
| 155 | Ga0070686_100614975 | 3300005544 | Bacteria | 858 |
| 156 | Ga0070695_101833327 | 3300005545 | Unclassified | 509 |
| 157 | Ga0070696_100898244 | 3300005546 | Unclassified | 735 |
| 158 | Ga0070665_100010897 | 3300005548 | Bacteria | 9196 |
| 159 | Ga0070665_100104721 | 3300005548 | Unclassified | 2831 |
| 160 | Ga0070665_100995071 | 3300005548 | Bacteria | 851 |
| 161 | Ga0070665_101187115 | 3300005548 | Bacteria | 774 |
| 162 | Ga0070665_101201219 | 3300005548 | Bacteria | 769 |
| 163 | Ga0070665_102271227 | 3300005548 | Bacteria | 546 |
| 164 | Ga0070704_100029226 | 3300005549 | Bacteria | 3677 |
| 165 | Ga0070704_100178755 | 3300005549 | Bacteria | 1695 |
| 166 | Ga0070704_102271317 | 3300005549 | Unclassified | 505 |
| 167 | Ga0070664_100184162 | 3300005564 | Unclassified | 1858 |
| 168 | Ga0068856_100400304 | 3300005614 | Bacteria | 1393 |
| 169 | Ga0068856_102076137 | 3300005614 | Unclassified | 578 |
| 170 | Ga0070702_100205983 | 3300005615 | Bacteria | 1306 |
| 171 | Ga0070702_100258861 | 3300005615 | Bacteria | 1184 |
| 172 | Ga0070702_100748357 | 3300005615 | Bacteria | 750 |
| 173 | Ga0070702_101692201 | 3300005615 | Unclassified | 526 |
| 174 | Ga0068852_100305516 | 3300005616 | Unclassified | 1541 |
| 175 | Ga0068866_10230084 | 3300005718 | Bacteria | 1124 |
| 176 | Ga0068861_100376412 | 3300005719 | Unclassified | 1253 |
| 177 | Ga0068860_100178221 | 3300005843 | Bacteria | 2054 |
| 178 | Ga0068862_100723345 | 3300005844 | Unclassified | 966 |
| 179 | Ga0081455_10001494 | 3300005937 | Bacteria | 28914 |
| 180 | Ga0081455_10022426 | 3300005937 | Bacteria | 5901 |
| 181 | Ga0081455_10053897 | 3300005937 | Bacteria | 3433 |
| 182 | Ga0081455_10174088 | 3300005937 | Bacteria | 1636 |
| 183 | Ga0081455_10334206 | 3300005937 | Bacteria | 1074 |
| 184 | Ga0081540_1000380 | 3300005983 | Bacteria | 44546 |
| 185 | Ga0081540_1064732 | 3300005983 | Bacteria | 1723 |
| 186 | Ga0081539_10158384 | 3300005985 | Bacteria | 1082 |
| 187 | Ga0081539_10423627 | 3300005985 | Unclassified | 552 |
| 188 | Ga0070717_10155762 | 3300006028 | Bacteria | 1979 |
| 189 | Ga0070717_10175171 | 3300006028 | Bacteria | 1867 |
| 190 | Ga0070717_10186488 | 3300006028 | Unclassified | 1811 |
| 191 | Ga0070717_10606153 | 3300006028 | Bacteria | 993 |
| 192 | Ga0070717_11397563 | 3300006028 | Unclassified | 636 |
| 193 | Ga0070716_100125331 | 3300006173 | Bacteria | 1615 |
| 194 | Ga0070716_100619223 | 3300006173 | Unclassified | 817 |
| 195 | Ga0070716_100965445 | 3300006173 | Unclassified | 672 |
| 196 | Ga0070716_101808088 | 3300006173 | Unclassified | 506 |
| 197 | Ga0070712_100032854 | 3300006175 | Bacteria | 3506 |
| 198 | Ga0070712_100256451 | 3300006175 | Unclassified | 1400 |
| 199 | Ga0070712_100738290 | 3300006175 | Bacteria | 842 |
| 200 | Ga0070712_101340385 | 3300006175 | Unclassified | 624 |
| 201 | Ga0070712_101580262 | 3300006175 | Unclassified | 574 |
| 202 | Ga0070712_102036898 | 3300006175 | Bacteria | 503 |
| 203 | Ga0070712_102060315 | 3300006175 | Bacteria | 500 |
| 204 | Ga0097621_100115074 | 3300006237 | Bacteria | 2276 |
| 205 | Ga0068871_100050156 | 3300006358 | Unclassified | 3376 |
| 206 | Ga0068871_100479285 | 3300006358 | Bacteria | 1119 |
| 207 | Ga0075428_100554172 | 3300006844 | Unclassified | 1229 |
| 208 | Ga0075428_101772363 | 3300006844 | Bacteria | 643 |
| 209 | Ga0075433_10528133 | 3300006852 | Unclassified | 1038 |
| 210 | Ga0075434_100194802 | 3300006871 | Bacteria | 2046 |
| 211 | Ga0075434_101019057 | 3300006871 | Bacteria | 842 |
| 212 | Ga0068865_101597682 | 3300006881 | Unclassified | 586 |
| 213 | Ga0099794_10196661 | 3300007265 | Bacteria | 1032 |
| 214 | Ga0099794_10716498 | 3300007265 | Bacteria | 533 |
| 215 | Ga0099795_10062080 | 3300007788 | Bacteria | 1389 |
| 216 | Ga0099795_10083267 | 3300007788 | Bacteria | 1228 |
| 217 | Ga0105240_10093626 | 3300009093 | Bacteria | 3667 |
| 218 | Ga0111539_10172553 | 3300009094 | Bacteria | 2526 |
| 219 | Ga0111539_12666383 | 3300009094 | Unclassified | 579 |
| 220 | Ga0105245_10577690 | 3300009098 | Bacteria | 1148 |
| 221 | Ga0114129_10010111 | 3300009147 | Bacteria | 13449 |
| 222 | Ga0114129_10156788 | 3300009147 | Bacteria | 3112 |
| 223 | Ga0114129_10246469 | 3300009147 | Bacteria | 2400 |
| 224 | Ga0114129_10611255 | 3300009147 | Bacteria | 1411 |
| 225 | Ga0114129_11821284 | 3300009147 | Bacteria | 740 |
| 226 | Ga0105243_10237903 | 3300009148 | Bacteria | 1619 |
| 227 | Ga0105241_12292380 | 3300009174 | Unclassified | 537 |
| 228 | Ga0105242_11561918 | 3300009176 | Bacteria | 692 |
| 229 | Ga0105248_10358801 | 3300009177 | Bacteria | 1641 |
| 230 | Ga0105248_13175556 | 3300009177 | Unclassified | 523 |
| 231 | Ga0105237_10081858 | 3300009545 | Bacteria | 3219 |
| 232 | Ga0105237_11268000 | 3300009545 | Unclassified | 743 |
| 233 | Ga0105249_10016016 | 3300009553 | Bacteria | 6645 |
| 234 | Ga0105249_10029932 | 3300009553 | Bacteria | 4918 |
| 235 | Ga0105249_12767848 | 3300009553 | Unclassified | 562 |
| 236 | Ga0099796_10155600 | 3300010159 | Bacteria | 903 |
| 237 | Ga0099796_10174592 | 3300010159 | Bacteria | 859 |
| 238 | Ga0099796_10250069 | 3300010159 | Bacteria | 736 |
| 239 | Ga0099796_10267643 | 3300010159 | Unclassified | 715 |
| 240 | Ga0105239_10018427 | 3300010375 | Bacteria | 7712 |
| 241 | Ga0105239_10043040 | 3300010375 | Bacteria | 4948 |
| 242 | Ga0105239_10252267 | 3300010375 | Bacteria | 1982 |
| 243 | Ga0105239_10544229 | 3300010375 | Unclassified | 1322 |
| 244 | Ga0105239_11756252 | 3300010375 | Bacteria | 718 |
| 245 | Ga0105239_11937639 | 3300010375 | Bacteria | 684 |
| 246 | Ga0157373_10429337 | 3300013100 | Bacteria | 949 |
| 247 | Ga0157371_10293055 | 3300013102 | Bacteria | 1177 |
| 248 | Ga0157369_12106001 | 3300013105 | Unclassified | 572 |
| 249 | Ga0157374_10023552 | 3300013296 | Bacteria | 5509 |
| 250 | Ga0157374_10270384 | 3300013296 | Bacteria | 1676 |
| 251 | Ga0157374_10352414 | 3300013296 | Bacteria | 1463 |
| 252 | Ga0157374_10903727 | 3300013296 | Bacteria | 901 |
| 253 | Ga0157374_11227863 | 3300013296 | Unclassified | 771 |
| 254 | Ga0157374_11333724 | 3300013296 | Bacteria | 740 |
| 255 | Ga0157378_10046740 | 3300013297 | Bacteria | 3847 |
| 256 | Ga0157378_10145847 | 3300013297 | Bacteria | 2201 |
| 257 | Ga0157378_10170697 | 3300013297 | Unclassified | 2040 |
| 258 | Ga0157378_10529362 | 3300013297 | Unclassified | 1181 |
| 259 | Ga0157378_10905908 | 3300013297 | Bacteria | 913 |
| 260 | Ga0157378_11141190 | 3300013297 | Bacteria | 817 |
| 261 | Ga0157378_12073430 | 3300013297 | Unclassified | 619 |
| 262 | Ga0163162_10037100 | 3300013306 | Bacteria | 4861 |
| 263 | Ga0163162_10357245 | 3300013306 | Bacteria | 1594 |
| 264 | Ga0163162_10457022 | 3300013306 | Unclassified | 1409 |
| 265 | Ga0163162_12274418 | 3300013306 | Bacteria | 623 |
| 266 | Ga0163162_12318103 | 3300013306 | Unclassified | 617 |
| 267 | Ga0163162_12376097 | 3300013306 | Unclassified | 609 |
| 268 | Ga0157372_10035116 | 3300013307 | Bacteria | 5517 |
| 269 | Ga0157372_10037590 | 3300013307 | Bacteria | 5342 |
| 270 | Ga0157372_10047250 | 3300013307 | Bacteria | 4782 |
| 271 | Ga0157372_10069362 | 3300013307 | Unclassified | 3965 |
| 272 | Ga0157375_10012538 | 3300013308 | Bacteria | 7523 |
| 273 | Ga0157375_10887077 | 3300013308 | Bacteria | 1036 |
| 274 | Ga0157375_11406091 | 3300013308 | Unclassified | 822 |
| 275 | Ga0163163_10020210 | 3300014325 | Bacteria | 6267 |
| 276 | Ga0163163_10076329 | 3300014325 | Bacteria | 3345 |
| 277 | Ga0163163_10475055 | 3300014325 | Bacteria | 1311 |
| 278 | Ga0163163_10959083 | 3300014325 | Unclassified | 918 |
| 279 | Ga0182008_10051368 | 3300014497 | Bacteria | 2045 |
| 280 | Ga0157379_11184939 | 3300014968 | Unclassified | 734 |
| 281 | Ga0157379_11547687 | 3300014968 | Unclassified | 646 |
| 282 | Ga0157376_10068193 | 3300014969 | Unclassified | 3011 |
| 283 | Ga0157376_10254816 | 3300014969 | Bacteria | 1641 |
| 284 | Ga0157376_10354181 | 3300014969 | Bacteria | 1406 |
| 285 | Ga0157376_10919156 | 3300014969 | Unclassified | 894 |
| 286 | Ga0157376_11546037 | 3300014969 | Unclassified | 697 |
| 287 | Ga0182005_1039644 | 3300015265 | Bacteria | 1281 |
| 288 | Ga0182005_1242087 | 3300015265 | Unclassified | 555 |
| 289 | Ga0213876_10034520 | 3300021384 | Bacteria | 2668 |
| 290 | Ga0213875_10272061 | 3300021388 | Bacteria | 800 |
| 291 | Ga0207666_1006881 | 3300025271 | Unclassified | 1484 |
| 292 | Ga0207673_1015008 | 3300025290 | Unclassified | 1024 |
| 293 | Ga0207673_1058380 | 3300025290 | Unclassified | 549 |
| 294 | Ga0207697_10000352 | 3300025315 | Bacteria | 25702 |
| 295 | Ga0207697_10000984 | 3300025315 | Bacteria | 15936 |
| 296 | Ga0207697_10008894 | 3300025315 | Bacteria | 4366 |
| 297 | Ga0207697_10043893 | 3300025315 | Bacteria | 1838 |
| 298 | Ga0207653_10011216 | 3300025885 | Bacteria | 2797 |
| 299 | Ga0207653_10301072 | 3300025885 | Bacteria | 621 |
| 300 | Ga0207692_10381767 | 3300025898 | Bacteria | 875 |
| 301 | Ga0207692_10734699 | 3300025898 | Bacteria | 642 |
| 302 | Ga0207699_10326926 | 3300025906 | Bacteria | 1077 |
| 303 | Ga0207645_10002352 | 3300025907 | Bacteria | 14913 |
| 304 | Ga0207684_10091117 | 3300025910 | Bacteria | 2598 |
| 305 | Ga0207684_10102665 | 3300025910 | Bacteria | 2445 |
| 306 | Ga0207684_10124274 | 3300025910 | Bacteria | 2213 |
| 307 | Ga0207684_10136460 | 3300025910 | Bacteria | 2107 |
| 308 | Ga0207684_10141273 | 3300025910 | Bacteria | 2070 |
| 309 | Ga0207684_10262327 | 3300025910 | Bacteria | 1491 |
| 310 | Ga0207684_10265424 | 3300025910 | Bacteria | 1481 |
| 311 | Ga0207707_11634818 | 3300025912 | Unclassified | 506 |
| 312 | Ga0207693_10009706 | 3300025915 | Bacteria | 7835 |
| 313 | Ga0207693_10099688 | 3300025915 | Bacteria | 2278 |
| 314 | Ga0207693_10182158 | 3300025915 | Bacteria | 1653 |
| 315 | Ga0207693_10215765 | 3300025915 | Bacteria | 1508 |
| 316 | Ga0207693_10264377 | 3300025915 | Unclassified | 1349 |
| 317 | Ga0207693_10466570 | 3300025915 | Unclassified | 986 |
| 318 | Ga0207693_10771592 | 3300025915 | Bacteria | 742 |
| 319 | Ga0207693_10881654 | 3300025915 | Bacteria | 687 |
| 320 | Ga0207693_11128873 | 3300025915 | Unclassified | 594 |
| 321 | Ga0207663_10075043 | 3300025916 | Bacteria | 2193 |
| 322 | Ga0207663_11130730 | 3300025916 | Unclassified | 630 |
| 323 | Ga0207660_10036583 | 3300025917 | Unclassified | 3413 |
| 324 | Ga0207662_10000559 | 3300025918 | Bacteria | 16548 |
| 325 | Ga0207662_10158114 | 3300025918 | Bacteria | 1446 |
| 326 | Ga0207657_10054614 | 3300025919 | Bacteria | 3453 |
| 327 | Ga0207657_10508929 | 3300025919 | Bacteria | 943 |
| 328 | Ga0207649_10110147 | 3300025920 | Bacteria | 1838 |
| 329 | Ga0207646_10000386 | 3300025922 | Bacteria | 59216 |
| 330 | Ga0207646_10000411 | 3300025922 | Bacteria | 57429 |
| 331 | Ga0207646_10025706 | 3300025922 | Bacteria | 5384 |
| 332 | Ga0207646_10116310 | 3300025922 | Bacteria | 2402 |
| 333 | Ga0207646_10131976 | 3300025922 | Bacteria | 2248 |
| 334 | Ga0207646_10321363 | 3300025922 | Bacteria | 1398 |
| 335 | Ga0207646_10721865 | 3300025922 | Bacteria | 890 |
| 336 | Ga0207646_10722031 | 3300025922 | Unclassified | 890 |
| 337 | Ga0207646_11916180 | 3300025922 | Unclassified | 505 |
| 338 | Ga0207681_10008691 | 3300025923 | Bacteria | 6201 |
| 339 | Ga0207650_10142698 | 3300025925 | Bacteria | 1884 |
| 340 | Ga0207659_10024917 | 3300025926 | Bacteria | 4015 |
| 341 | Ga0207659_10269917 | 3300025926 | Unclassified | 1387 |
| 342 | Ga0207659_10673300 | 3300025926 | Bacteria | 885 |
| 343 | Ga0207687_10354404 | 3300025927 | Bacteria | 1196 |
| 344 | Ga0207700_10566486 | 3300025928 | Bacteria | 1009 |
| 345 | Ga0207700_10723298 | 3300025928 | Bacteria | 889 |
| 346 | Ga0207664_10332748 | 3300025929 | Bacteria | 1342 |
| 347 | Ga0207664_10947590 | 3300025929 | Bacteria | 772 |
| 348 | Ga0207644_10345690 | 3300025931 | Unclassified | 1207 |
| 349 | Ga0207644_10444074 | 3300025931 | Bacteria | 1065 |
| 350 | Ga0207706_10020606 | 3300025933 | Bacteria | 5925 |
| 351 | Ga0207706_10181266 | 3300025933 | Unclassified | 1849 |
| 352 | Ga0207706_10393162 | 3300025933 | Unclassified | 1202 |
| 353 | Ga0207706_11458394 | 3300025933 | Unclassified | 560 |
| 354 | Ga0207709_10394944 | 3300025935 | Unclassified | 1056 |
| 355 | Ga0207670_10072101 | 3300025936 | Bacteria | 2390 |
| 356 | Ga0207670_10383361 | 3300025936 | Unclassified | 1120 |
| 357 | Ga0207670_11367454 | 3300025936 | Unclassified | 601 |
| 358 | Ga0207669_10462446 | 3300025937 | Unclassified | 1008 |
| 359 | Ga0207704_11034311 | 3300025938 | Unclassified | 696 |
| 360 | Ga0207665_10043972 | 3300025939 | Unclassified | 2988 |
| 361 | Ga0207665_10159437 | 3300025939 | Bacteria | 1622 |
| 362 | Ga0207665_10243822 | 3300025939 | Bacteria | 1325 |
| 363 | Ga0207665_10344080 | 3300025939 | Bacteria | 1124 |
| 364 | Ga0207665_10349040 | 3300025939 | Unclassified | 1117 |
| 365 | Ga0207665_11042338 | 3300025939 | Bacteria | 651 |
| 366 | Ga0207691_10020547 | 3300025940 | Bacteria | 6244 |
| 367 | Ga0207691_11317320 | 3300025940 | Bacteria | 596 |
| 368 | Ga0207689_10027373 | 3300025942 | Bacteria | 4773 |
| 369 | Ga0207689_11062998 | 3300025942 | Unclassified | 682 |
| 370 | Ga0207661_10062817 | 3300025944 | Bacteria | 3006 |
| 371 | Ga0207661_10870082 | 3300025944 | Unclassified | 830 |
| 372 | Ga0207679_10089516 | 3300025945 | Bacteria | 2376 |
| 373 | Ga0207679_10750489 | 3300025945 | Unclassified | 888 |
| 374 | Ga0207651_12162204 | 3300025960 | Unclassified | 500 |
| 375 | Ga0207712_10032945 | 3300025961 | Bacteria | 3500 |
| 376 | Ga0207712_10519845 | 3300025961 | Unclassified | 1020 |
| 377 | Ga0207668_10012259 | 3300025972 | Bacteria | 5241 |
| 378 | Ga0207668_10187839 | 3300025972 | Unclassified | 1635 |
| 379 | Ga0207658_10010561 | 3300025986 | Bacteria | 6273 |
| 380 | Ga0207677_10135326 | 3300026023 | Bacteria | 1878 |
| 381 | Ga0207677_10250140 | 3300026023 | Unclassified | 1439 |
| 382 | Ga0207703_11706732 | 3300026035 | Unclassified | 606 |
| 383 | Ga0207678_10131206 | 3300026067 | Bacteria | 2137 |
| 384 | Ga0207708_10045187 | 3300026075 | Bacteria | 3357 |
| 385 | Ga0207708_10489060 | 3300026075 | Unclassified | 1030 |
| 386 | Ga0207702_10102127 | 3300026078 | Bacteria | 2533 |
| 387 | Ga0207702_10713244 | 3300026078 | Bacteria | 989 |
| 388 | Ga0207674_11579530 | 3300026116 | Bacteria | 625 |
| 389 | Ga0207675_100431104 | 3300026118 | Unclassified | 1304 |
| 390 | Ga0207675_101640686 | 3300026118 | Unclassified | 663 |
| 391 | Ga0207683_10246174 | 3300026121 | Bacteria | 1631 |
| 392 | Ga0209179_1134659 | 3300027512 | Bacteria | 552 |
| 393 | Ga0209999_1082629 | 3300027543 | Unclassified | 620 |
| 394 | Ga0209974_10040023 | 3300027876 | Bacteria | 1559 |
| 395 | Ga0209974_10141539 | 3300027876 | Unclassified | 863 |
| 396 | Ga0207428_11171727 | 3300027907 | Bacteria | 535 |
| 397 | Ga0268266_10075111 | 3300028379 | Bacteria | 2935 |
| 398 | Ga0268266_10225494 | 3300028379 | Bacteria | 1724 |
| 399 | Ga0268266_11246919 | 3300028379 | Unclassified | 719 |
| 400 | Ga0268264_10189533 | 3300028381 | Bacteria | 1874 |
| 401 | Ga0268264_10240021 | 3300028381 | Unclassified | 1678 |
| 402 | Ga0307513_10138609 | 3300031456 | Bacteria | 2363 |
| 403 | Ga0373938_0191752 | 3300034957 | Unclassified | 563 |
| 404 | Ga0373934_0156425 | 3300035086 | Unclassified | 935 |
| 405 | Ga0373944_0357255 | 3300035089 | Unclassified | 557 |
| 406 | Ga0373945_0490370 | 3300035116 | Unclassified | 547 |
| 407 | Ga0373953_0150285 | 3300035117 | Unclassified | 998 |
| 408 | Ga0373954_0216781 | 3300035118 | Bacteria | 941 |
| 409 | Ga0373956_0356808 | 3300035119 | Unclassified | 697 |
| 410 | Ga0373957_0418233 | 3300035120 | Unclassified | 578 |
| 411 | Ga0373943_0022632 | 3300035170 | Bacteria | 2915 |
| 412 | Ga0373943_0052633 | 3300035170 | Bacteria | 2008 |
| 413 | Ga0373943_0105217 | 3300035170 | Unclassified | 1481 |
| 414 | Ga0373943_0338681 | 3300035170 | Unclassified | 860 |
| 415 | Ga0373946_0119110 | 3300035171 | Bacteria | 1203 |
| 416 | Ga0373946_0627740 | 3300035171 | Unclassified | 559 |
| 417 | Ga0373955_0017614 | 3300035172 | Bacteria | 3539 |
| 418 | Ga0373955_0230532 | 3300035172 | Bacteria | 1108 |
| 419 | Ga0373955_0592942 | 3300035172 | Unclassified | 678 |
| 420 | Ga0373931_0696088 | 3300035691 | Unclassified | 671 |
| 421 | Ga0373935_0023971 | 3300035692 | Unclassified | 3751 |
| 422 | Ga0373935_0074414 | 3300035692 | Bacteria | 2196 |
| 423 | Ga0373927_0118698 | 3300035695 | Bacteria | 1726 |
| 424 | Ga0373927_0643137 | 3300035695 | Unclassified | 701 |
| 425 | Ga0373933_0237275 | 3300035724 | Bacteria | 1172 |
| 426 | Ga0373933_0455639 | 3300035724 | Unclassified | 837 |
| 427 | Ga0373933_0989438 | 3300035724 | Unclassified | 554 |
| 428 | Ga0373947_0062870 | 3300035725 | Unclassified | 2260 |
| 429 | Ga0373947_0257228 | 3300035725 | Bacteria | 1156 |
| 430 | Ga0373947_0264510 | 3300035725 | Bacteria | 1140 |
| 431 | Ga0373947_0974747 | 3300035725 | Unclassified | 578 |
| 432 | Ga0373937_0160500 | 3300036401 | Bacteria | 2107 |
| 433 | Ga0373937_0478108 | 3300036401 | Unclassified | 1183 |
| 434 | Ga0373937_0591132 | 3300036401 | Bacteria | 1054 |
| 435 | Ga0373925_0169337 | 3300037068 | Bacteria | 1724 |
| 436 | Ga0373925_0222616 | 3300037068 | Bacteria | 1507 |
| 437 | Ga0373925_1090675 | 3300037068 | Unclassified | 657 |
| 438 | Ga0373925_1393484 | 3300037068 | Unclassified | 574 |
| 439 | Ga0395899_0022448 | 3300037312 | Bacteria | 4786 |
| 440 | Ga0395899_0118347 | 3300037312 | Bacteria | 1900 |
| 441 | Ga0395900_0003229 | 3300037418 | Bacteria | 17656 |
| 442 | Ga0395900_0394144 | 3300037418 | Bacteria | 1350 |
| 443 | Ga0395900_0454842 | 3300037418 | Bacteria | 1236 |
| 444 | Ga0395900_1118074 | 3300037418 | Unclassified | 705 |
| 445 | Ga0395898_0013011 | 3300037466 | Bacteria | 8577 |
| 446 | Ga0395898_1972031 | 3300037466 | Unclassified | 503 |
| 447 | Ga0395905_0196930 | 3300037471 | Bacteria | 1889 |
| 448 | Ga0395905_0774538 | 3300037471 | Unclassified | 862 |
| 449 | Ga0395905_1502340 | 3300037471 | Unclassified | 578 |
| 450 | Ga0436364_0314395 | 3300037853 | Bacteria | 860 |
| 451 | Ga0395901_0009691 | 3300038443 | Bacteria | 9769 |
| 452 | Ga0395901_0169366 | 3300038443 | Unclassified | 2292 |
| 453 | Ga0395901_0866844 | 3300038443 | Bacteria | 887 |
| 454 | Ga0436365_1041806 | 3300039437 | Bacteria | 1787 |
| 455 | Ga0436365_1553827 | 3300039437 | Unclassified | 2169 |
| 456 | Ga0436365_1814206 | 3300039437 | Bacteria | 4500 |
| 457 | Ga0436362_1088089 | 3300039453 | Bacteria | 569 |
| 458 | Ga0451789_0118864 | 3300041443 | Unclassified | 703 |
| 459 | Ga0451802_1858742 | 3300041460 | Unclassified | 585 |
| 460 | Ga0451807_0485362 | 3300041486 | Bacteria | 709 |
| 461 | Ga0451807_1347153 | 3300041486 | Unclassified | 1112 |
| 462 | Ga0451853_3701655 | 3300041512 | Bacteria | 1221 |
| 463 | Ga0439443_102195 | 3300042003 | Unclassified | 550 |
| 464 | Ga0439450_092665 | 3300042008 | Bacteria | 760 |
| 465 | Ga0439451_073908 | 3300042009 | Bacteria | 683 |
| 466 | Ga0439454_005879 | 3300042011 | Bacteria | 1485 |
| 467 | Ga0439456_141529 | 3300042013 | Unclassified | 558 |
| 468 | Ga0439458_0194602 | 3300042157 | Unclassified | 553 |
| 469 | Ga0439460_0021227 | 3300042461 | Bacteria | 1773 |
| 470 | Ga0439460_0100411 | 3300042461 | Bacteria | 929 |
| 471 | Ga0439460_0344709 | 3300042461 | Bacteria | 525 |
| 472 | Ga0450893_0107990 | 3300042532 | Bacteria | 572 |
| 473 | Ga0439440_0169405 | 3300042993 | Unclassified | 634 |
| 474 | Ga0451576_0081187 | 3300045051 | Bacteria | 3372 |
| 475 | Ga0451576_0689696 | 3300045051 | Unclassified | 1073 |
| 476 | Ga0451576_0728725 | 3300045051 | Unclassified | 1042 |
| 477 | Ga0466967_0173121 | 3300045976 | Bacteria | 2032 |
| 478 | Ga0466967_0345721 | 3300045976 | Bacteria | 1439 |
| 479 | Ga0495592_0068725 | 3300046454 | Unclassified | 2585 |
| 480 | Ga0495592_0189178 | 3300046454 | Unclassified | 1396 |
| 481 | Ga0495590_0413178 | 3300046457 | Bacteria | 519 |
| 482 | Ga0495629_0196920 | 3300046459 | Unclassified | 1393 |
| 483 | Ga0495641_0112655 | 3300046461 | Unclassified | 1214 |
| 484 | Ga0495651_0117255 | 3300046462 | Bacteria | 1960 |
| 485 | Ga0495651_0240421 | 3300046462 | Bacteria | 1242 |
| 486 | Ga0495651_0844532 | 3300046462 | Unclassified | 563 |
| 487 | Ga0495651_0950725 | 3300046462 | Unclassified | 523 |
| 488 | Ga0495653_0271399 | 3300046463 | Bacteria | 1117 |
| 489 | Ga0495653_0388788 | 3300046463 | Bacteria | 889 |
| 490 | Ga0495653_0547918 | 3300046463 | Unclassified | 716 |
| 491 | Ga0495653_0935263 | 3300046463 | Unclassified | 515 |
| 492 | Ga0495582_0018551 | 3300046473 | Bacteria | 3804 |
| 493 | Ga0495582_0386236 | 3300046473 | Unclassified | 807 |
| 494 | Ga0495639_0014674 | 3300046475 | Bacteria | 3394 |
| 495 | Ga0495662_0282764 | 3300046476 | Unclassified | 817 |
| 496 | Ga0495664_0432792 | 3300046477 | Unclassified | 789 |
| 497 | Ga0495594_0552134 | 3300046499 | Unclassified | 654 |
| 498 | Ga0495608_0135829 | 3300046511 | Bacteria | 1572 |
| 499 | Ga0495618_0071332 | 3300046514 | Unclassified | 2210 |
| 500 | Ga0495618_0225455 | 3300046514 | Unclassified | 1181 |
| 501 | Ga0495628_0017332 | 3300046516 | Bacteria | 5997 |
| 502 | Ga0495628_0145408 | 3300046516 | Unclassified | 1807 |
| 503 | Ga0495630_0194999 | 3300046517 | Bacteria | 1545 |
| 504 | Ga0495652_0239233 | 3300046529 | Unclassified | 1352 |
| 505 | Ga0495640_0807143 | 3300046533 | Unclassified | 559 |
| 506 | Ga0495586_0172963 | 3300046535 | Unclassified | 1220 |
| 507 | Ga0495586_0244981 | 3300046535 | Unclassified | 1022 |
| 508 | Ga0495621_0113418 | 3300046539 | Unclassified | 1041 |
| 509 | Ga0495597_0400960 | 3300046542 | Bacteria | 522 |
| 510 | Ga0495645_0022313 | 3300046543 | Bacteria | 4578 |
| 511 | Ga0495645_0905886 | 3300046543 | Unclassified | 523 |
| 512 | Ga0495634_0115451 | 3300046642 | Bacteria | 1723 |
| 513 | Ga0495634_0515476 | 3300046642 | Unclassified | 700 |
| 514 | Ga0495635_0180884 | 3300046663 | Bacteria | 1433 |
| 515 | Ga0495635_0210731 | 3300046663 | Bacteria | 1316 |
| 516 | Ga0495635_0696898 | 3300046663 | Unclassified | 659 |
| 517 | Ga0495657_0075637 | 3300046675 | Bacteria | 2189 |
| 518 | Ga0495599_0026353 | 3300046678 | Bacteria | 3642 |
| 519 | Ga0495599_0249872 | 3300046678 | Unclassified | 1080 |
| 520 | Ga0495623_0061849 | 3300046679 | Bacteria | 2347 |
| 521 | Ga0495646_0071363 | 3300046680 | Unclassified | 2043 |
| 522 | Ga0495646_0386311 | 3300046680 | Unclassified | 729 |
| 523 | Ga0495658_0749190 | 3300046683 | Unclassified | 626 |
| 524 | Ga0495669_0097832 | 3300046684 | Bacteria | 1361 |
| 525 | Ga0495669_0576928 | 3300046684 | Unclassified | 547 |
| 526 | Ga0495613_0273258 | 3300046689 | Unclassified | 1175 |
| 527 | Ga0495613_0541272 | 3300046689 | Unclassified | 780 |
| 528 | Ga0495624_0501462 | 3300046690 | Unclassified | 726 |
| 529 | Ga0495624_0835630 | 3300046690 | Unclassified | 544 |
| 530 | Ga0495670_0202072 | 3300046691 | Unclassified | 1053 |
| 531 | Ga0495600_0439450 | 3300046809 | Unclassified | 808 |
| 532 | Ga0495581_0042823 | 3300047315 | Bacteria | 2620 |
| 533 | Ga0495604_0080507 | 3300047317 | Bacteria | 2440 |
| 534 | Ga0495604_0268522 | 3300047317 | Unclassified | 1157 |
| 535 | Ga0495604_1048445 | 3300047317 | Unclassified | 502 |
| 536 | Ga0495674_0072861 | 3300047319 | Bacteria | 2962 |
| 537 | Ga0495674_0221910 | 3300047319 | Bacteria | 1562 |
| 538 | Ga0495674_0940354 | 3300047319 | Unclassified | 665 |
| 539 | Ga0495676_0274199 | 3300047321 | Unclassified | 1144 |
| 540 | Ga0495680_0270032 | 3300047322 | Bacteria | 1201 |
| 541 | Ga0495675_0079449 | 3300047444 | Bacteria | 2066 |
| 542 | Ga0495684_0011055 | 3300047471 | Bacteria | 6978 |
| 543 | Ga0495684_0055215 | 3300047471 | Bacteria | 3029 |
| 544 | Ga0495602_0415370 | 3300048088 | Unclassified | 956 |
| 545 | Ga0496100_0028555 | 3300048903 | Bacteria | 3442 |
| 546 | Ga0496100_0613234 | 3300048903 | Bacteria | 846 |
| 547 | Ga0496101_0613854 | 3300048904 | Unclassified | 860 |
| 548 | Ga0496101_0902498 | 3300048904 | Bacteria | 696 |
| 549 | Ga0496102_0153208 | 3300048905 | Bacteria | 2167 |
| 550 | Ga0496102_0276961 | 3300048905 | Bacteria | 1581 |
| 551 | Ga0496102_0967746 | 3300048905 | Bacteria | 772 |
| 552 | Ga0496102_1280977 | 3300048905 | Bacteria | 652 |
| 553 | Ga0496103_0297143 | 3300048906 | Unclassified | 1039 |
| 554 | Ga0496103_0333693 | 3300048906 | Bacteria | 975 |
| 555 | Ga0496103_0947864 | 3300048906 | Unclassified | 538 |
| 556 | Ga0496104_0057889 | 3300048907 | Bacteria | 3668 |
| 557 | Ga0496104_0076185 | 3300048907 | Bacteria | 3195 |
| 558 | Ga0496104_0174226 | 3300048907 | Unclassified | 2062 |
| 559 | Ga0496104_0384092 | 3300048907 | Bacteria | 1317 |
| 560 | Ga0496105_0027127 | 3300048908 | Bacteria | 4676 |
| 561 | Ga0496105_0105288 | 3300048908 | Bacteria | 2329 |
| 562 | Ga0496105_0124602 | 3300048908 | Bacteria | 2124 |
| 563 | Ga0496106_0385551 | 3300048909 | Bacteria | 1126 |
| 564 | Ga0496106_0473465 | 3300048909 | Unclassified | 1006 |
| 565 | Ga0496106_0668943 | 3300048909 | Bacteria | 829 |
| 566 | Ga0496107_0155587 | 3300048910 | Bacteria | 1692 |
| 567 | Ga0496107_0329014 | 3300048910 | Unclassified | 1137 |
| 568 | Ga0496108_0007830 | 3300048911 | Bacteria | 8659 |
| 569 | Ga0496108_0123064 | 3300048911 | Bacteria | 2226 |
| 570 | Ga0496108_0165673 | 3300048911 | Bacteria | 1911 |
| 571 | Ga0496108_0235097 | 3300048911 | Bacteria | 1594 |
| 572 | Ga0496108_1706183 | 3300048911 | Unclassified | 518 |
| 573 | Ga0496109_0020560 | 3300048912 | Bacteria | 5830 |
| 574 | Ga0496109_0113981 | 3300048912 | Bacteria | 2515 |
| 575 | Ga0496109_0631805 | 3300048912 | Bacteria | 1007 |
| 576 | Ga0496109_0722817 | 3300048912 | Bacteria | 933 |
| 577 | Ga0496110_0456272 | 3300048913 | Bacteria | 1165 |
| 578 | Ga0496110_0992307 | 3300048913 | Bacteria | 747 |
| 579 | Ga0496112_0075159 | 3300048915 | Bacteria | 3342 |
| 580 | Ga0496112_0106218 | 3300048915 | Unclassified | 2777 |
| 581 | Ga0496112_0351130 | 3300048915 | Bacteria | 1417 |
| 582 | Ga0496112_0412501 | 3300048915 | Unclassified | 1290 |
| 583 | Ga0496112_1345883 | 3300048915 | Unclassified | 629 |
| 584 | Ga0496113_0046236 | 3300048916 | Bacteria | 3231 |
| 585 | Ga0496113_0115512 | 3300048916 | Bacteria | 2094 |
| 586 | Ga0496113_0166841 | 3300048916 | Bacteria | 1743 |
| 587 | Ga0496114_0045338 | 3300048917 | Bacteria | 3652 |
| 588 | Ga0496114_0123586 | 3300048917 | Unclassified | 2228 |
| 589 | Ga0496114_0376695 | 3300048917 | Bacteria | 1256 |
| 590 | Ga0496114_0895690 | 3300048917 | Unclassified | 768 |
| 591 | Ga0496115_0004435 | 3300048918 | Bacteria | 10173 |
| 592 | Ga0496115_0050669 | 3300048918 | Bacteria | 3327 |
| 593 | Ga0496115_0095551 | 3300048918 | Unclassified | 2433 |
| 594 | Ga0496115_0105226 | 3300048918 | Bacteria | 2316 |
| 595 | Ga0496115_0598695 | 3300048918 | Unclassified | 877 |
| 596 | nmdc:mga05p37_1396094_c1 | 3300050507 | Bacteria | 706 |
| 597 | nmdc:mga05p37_156514_c1 | 3300050507 | Bacteria | 2784 |
| 598 | nmdc:mga05p37_17694_c1 | 3300050507 | Bacteria | 8599 |
| 599 | nmdc:mga05p37_686477_c1 | 3300050507 | Bacteria | 1140 |
| 600 | nmdc:mga08y16_517878_c1 | 3300050511 | Bacteria | 1210 |
| 601 | nmdc:mga08y16_782818_c1 | 3300050511 | Unclassified | 948 |
| 602 | nmdc:mga0n895_371648_c1 | 3300050512 | Bacteria | 1447 |
| 603 | nmdc:mga0n895_762462_c1 | 3300050512 | Bacteria | 960 |
| 604 | nmdc:mga0n895_972391_c1 | 3300050512 | Unclassified | 831 |
| 605 | nmdc:mga08x19_318528_c1 | 3300050514 | Bacteria | 1082 |
| 606 | nmdc:mga0a205_201719_c1 | 3300050515 | Bacteria | 1879 |
| 607 | nmdc:mga0a205_506861_c1 | 3300050515 | Bacteria | 1063 |
| 608 | nmdc:mga0a205_929221_c1 | 3300050515 | Unclassified | 717 |
| 609 | Ga0495601_0006303 | 3300053077 | Bacteria | 6929 |
| 610 | Ga0495612_0106717 | 3300053078 | Unclassified | 1196 |
| 611 | Ga0495655_0327381 | 3300053083 | Unclassified | 532 |
| 612 | Ga0495595_0262332 | 3300053084 | Unclassified | 866 |
| 613 | Ga0495619_0598595 | 3300053085 | Unclassified | 754 |
| 614 | Ga0495619_1191881 | 3300053085 | Unclassified | 504 |
| 615 | nmdc:mga08x19_306953_c1 | |||
| 616 | SwRhRL2b_contig_487712 | |||
| 617 | JGI25405J52794_10001154 | |||
| 618 | JGI25405J52794_10114037 | |||
| 619 | Ga0065714_10261922 | |||
| 620 | Ga0065704_10115402 | |||
| 621 | Ga0065704_10696436 | |||
| 622 | Ga0065712_10003065 | |||
| 623 | Ga0065712_10010801 | |||
| 624 | Ga0065712_10037007 | |||
| 625 | Ga0065712_10081269 | |||
| 626 | Ga0065712_10158908 | |||
| 627 | Ga0065712_10270745 | |||
| 628 | Ga0065712_10540651 | |||
| 629 | Ga0065715_10016501 | |||
| 630 | Ga0065715_10021146 | |||
| 631 | Ga0065715_10052240 | |||
| 632 | Ga0065715_10091525 | |||
| 633 | Ga0065715_10324687 | |||
| 634 | Ga0065715_10372717 | |||
| 635 | Ga0065715_10577688 | |||
| 636 | Ga0065715_10836330 | |||
| 637 | Ga0065715_11041566 | |||
| 638 | Ga0065707_10067356 | |||
| 639 | Ga0065707_10075781 | |||
| 640 | Ga0065707_10215638 | |||
| 641 | Ga0065707_10243477 | |||
| 642 | Ga0065707_10259383 | |||
| 643 | Ga0070676_10085172 | |||
| 644 | Ga0070676_11051733 | |||
| 645 | Ga0070683_101486798 | |||
| 646 | Ga0070690_100646375 | |||
| 647 | Ga0070670_100339960 | |||
| 648 | Ga0070670_101449333 | |||
| 649 | Ga0068869_100359995 | |||
| 650 | Ga0068869_100383853 | |||
| 651 | Ga0070680_100219233 | |||
| 652 | Ga0070682_100300714 | |||
| 653 | Ga0068868_100097921 | |||
| 654 | Ga0068868_101307261 | |||
| 655 | Ga0070660_100057421 | |||
| 656 | Ga0070660_100735156 | |||
| 657 | Ga0070660_101113105 | |||
| 658 | Ga0070689_100087900 | |||
| 659 | Ga0070689_100327029 | |||
| 660 | Ga0070689_101357518 | |||
| 661 | Ga0070687_100174912 | |||
| 662 | Ga0070687_100595681 | |||
| 663 | Ga0070661_100152481 | |||
| 664 | Ga0070668_100037400 | |||
| 665 | Ga0070668_101842434 | |||
| 666 | Ga0070669_100009942 | |||
| 667 | Ga0070675_100010797 | |||
| 668 | Ga0070675_100026530 | |||
| 669 | Ga0070675_100182827 | |||
| 670 | Ga0070675_100514618 | |||
| 671 | Ga0070675_101387309 | |||
| 672 | Ga0070671_100389905 | |||
| 673 | Ga0070671_100442229 | |||
| 674 | Ga0070671_100704107 | |||
| 675 | Ga0070671_100800582 | |||
| 676 | Ga0070671_101332223 | |||
| 677 | Ga0070674_102066612 | |||
| 678 | Ga0070673_100113473 | |||
| 679 | Ga0070688_100002376 | |||
| 680 | Ga0070688_100018766 | |||
| 681 | Ga0070688_100211578 | |||
| 682 | Ga0070688_100456199 | |||
| 683 | Ga0070659_100007384 | |||
| 684 | Ga0070659_100061699 | |||
| 685 | Ga0070659_100756088 | |||
| 686 | Ga0070659_102092515 | |||
| 687 | Ga0070667_100168843 | |||
| 688 | Ga0070667_100822872 | |||
| 689 | Ga0070703_10033710 | |||
| 690 | Ga0070703_10175429 | |||
| 691 | Ga0070709_10052815 | |||
| 692 | Ga0070714_100095258 | |||
| 693 | Ga0070713_100067358 | |||
| 694 | Ga0070713_100320294 | |||
| 695 | Ga0070713_101850290 | |||
| 696 | Ga0070710_10088599 | |||
| 697 | Ga0070710_10160255 | |||
| 698 | Ga0070710_10467498 | |||
| 699 | Ga0070710_11082467 | |||
| 700 | Ga0070701_10230075 | |||
| 701 | Ga0070711_100719774 | |||
| 702 | Ga0070705_100014916 | |||
| 703 | Ga0070705_100438717 | |||
| 704 | Ga0070700_100070627 | |||
| 705 | Ga0070694_100106175 | |||
| 706 | Ga0070694_101966160 | |||
| 707 | Ga0070708_100002881 | |||
| 708 | Ga0070708_100006600 | |||
| 709 | Ga0070708_100034509 | |||
| 710 | Ga0070708_100102832 | |||
| 711 | Ga0070708_100112692 | |||
| 712 | Ga0070708_100224520 | |||
| 713 | Ga0070708_100356893 | |||
| 714 | Ga0070708_100405283 | |||
| 715 | Ga0070708_101512084 | |||
| 716 | Ga0070708_101921046 | |||
| 717 | Ga0070662_100026771 | |||
| 718 | Ga0070662_100076944 | |||
| 719 | Ga0070662_100383282 | |||
| 720 | Ga0070662_100936906 | |||
| 721 | Ga0070681_10338346 | |||
| 722 | Ga0070706_100020713 | |||
| 723 | Ga0070706_100101456 | |||
| 724 | Ga0070706_100170449 | |||
| 725 | Ga0070706_100336723 | |||
| 726 | Ga0070706_100414643 | |||
| 727 | Ga0070706_100921693 | |||
| 728 | Ga0070706_101060489 | |||
| 729 | Ga0070707_100000846 | |||
| 730 | Ga0070707_100023714 | |||
| 731 | Ga0070707_100026907 | |||
| 732 | Ga0070707_100043665 | |||
| 733 | Ga0070707_100108398 | |||
| 734 | Ga0070707_100110748 | |||
| 735 | Ga0070707_100185506 | |||
| 736 | Ga0070707_100211197 | |||
| 737 | Ga0070707_100219458 | |||
| 738 | Ga0070707_100811188 | |||
| 739 | Ga0070707_100837756 | |||
| 740 | Ga0070707_101173691 | |||
| 741 | Ga0070707_101540407 | |||
| 742 | Ga0070698_100005905 | |||
| 743 | Ga0070698_100007983 | |||
| 744 | Ga0070698_100038467 | |||
| 745 | Ga0070698_100060761 | |||
| 746 | Ga0070698_100620749 | |||
| 747 | Ga0070698_101980476 | |||
| 748 | Ga0070699_100178700 | |||
| 749 | Ga0070699_100244776 | |||
| 750 | Ga0070699_100335856 | |||
| 751 | Ga0070699_100791394 | |||
| 752 | Ga0070699_101294833 | |||
| 753 | Ga0070699_102117501 | |||
| 754 | Ga0070679_100298551 | |||
| 755 | Ga0070684_100001535 | |||
| 756 | Ga0070684_100706982 | |||
| 757 | Ga0070697_100000863 | |||
| 758 | Ga0070697_100003442 | |||
| 759 | Ga0070697_100006005 | |||
| 760 | Ga0070697_100078405 | |||
| 761 | Ga0070697_100088819 | |||
| 762 | Ga0070697_100129616 | |||
| 763 | Ga0070697_100160611 | |||
| 764 | Ga0070697_101240437 | |||
| 765 | Ga0068853_101004612 | |||
| 766 | Ga0070672_101199276 | |||
| 767 | Ga0070672_101246800 | |||
| 768 | Ga0070672_101364844 | |||
| 769 | Ga0070686_100614975 | |||
| 770 | Ga0070695_101833327 | |||
| 771 | Ga0070696_100898244 | |||
| 772 | Ga0070665_100010897 | |||
| 773 | Ga0070665_100104721 | |||
| 774 | Ga0070665_100995071 | |||
| 775 | Ga0070665_101187115 | |||
| 776 | Ga0070665_101201219 | |||
| 777 | Ga0070665_102271227 | |||
| 778 | Ga0070704_100029226 | |||
| 779 | Ga0070704_100178755 | |||
| 780 | Ga0070704_102271317 | |||
| 781 | Ga0070664_100184162 | |||
| 782 | Ga0068856_100400304 | |||
| 783 | Ga0068856_102076137 | |||
| 784 | Ga0070702_100205983 | |||
| 785 | Ga0070702_100258861 | |||
| 786 | Ga0070702_100748357 | |||
| 787 | Ga0070702_101692201 | |||
| 788 | Ga0068852_100305516 | |||
| 789 | Ga0068866_10230084 | |||
| 790 | Ga0068861_100376412 | |||
| 791 | Ga0068860_100178221 | |||
| 792 | Ga0068862_100723345 | |||
| 793 | Ga0081455_10001494 | |||
| 794 | Ga0081455_10022426 | |||
| 795 | Ga0081455_10053897 | |||
| 796 | Ga0081455_10174088 | |||
| 797 | Ga0081455_10334206 | |||
| 798 | Ga0081540_1000380 | |||
| 799 | Ga0081540_1064732 | |||
| 800 | Ga0081539_10158384 | |||
| 801 | Ga0081539_10423627 | |||
| 802 | Ga0070717_10155762 | |||
| 803 | Ga0070717_10175171 | |||
| 804 | Ga0070717_10186488 | |||
| 805 | Ga0070717_10606153 | |||
| 806 | Ga0070717_11397563 | |||
| 807 | Ga0070716_100125331 | |||
| 808 | Ga0070716_100619223 | |||
| 809 | Ga0070716_100965445 | |||
| 810 | Ga0070716_101808088 | |||
| 811 | Ga0070712_100032854 | |||
| 812 | Ga0070712_100256451 | |||
| 813 | Ga0070712_100738290 | |||
| 814 | Ga0070712_101340385 | |||
| 815 | Ga0070712_101580262 | |||
| 816 | Ga0070712_102036898 | |||
| 817 | Ga0070712_102060315 | |||
| 818 | Ga0097621_100115074 | |||
| 819 | Ga0068871_100050156 | |||
| 820 | Ga0068871_100479285 | |||
| 821 | Ga0075428_100554172 | |||
| 822 | Ga0075428_101772363 | |||
| 823 | Ga0075433_10528133 | |||
| 824 | Ga0075434_100194802 | |||
| 825 | Ga0075434_101019057 | |||
| 826 | Ga0068865_101597682 | |||
| 827 | Ga0099794_10196661 | |||
| 828 | Ga0099794_10716498 | |||
| 829 | Ga0099795_10062080 | |||
| 830 | Ga0099795_10083267 | |||
| 831 | Ga0105240_10093626 | |||
| 832 | Ga0111539_10172553 | |||
| 833 | Ga0111539_12666383 | |||
| 834 | Ga0105245_10577690 | |||
| 835 | Ga0114129_10010111 | |||
| 836 | Ga0114129_10156788 | |||
| 837 | Ga0114129_10246469 | |||
| 838 | Ga0114129_10611255 | |||
| 839 | Ga0114129_11821284 | |||
| 840 | Ga0105243_10237903 | |||
| 841 | Ga0105241_12292380 | |||
| 842 | Ga0105242_11561918 | |||
| 843 | Ga0105248_10358801 | |||
| 844 | Ga0105248_13175556 | |||
| 845 | Ga0105237_10081858 | |||
| 846 | Ga0105237_11268000 | |||
| 847 | Ga0105249_10016016 | |||
| 848 | Ga0105249_10029932 | |||
| 849 | Ga0105249_12767848 | |||
| 850 | Ga0099796_10155600 | |||
| 851 | Ga0099796_10174592 | |||
| 852 | Ga0099796_10250069 | |||
| 853 | Ga0099796_10267643 | |||
| 854 | Ga0105239_10018427 | |||
| 855 | Ga0105239_10043040 | |||
| 856 | Ga0105239_10252267 | |||
| 857 | Ga0105239_10544229 | |||
| 858 | Ga0105239_11756252 | |||
| 859 | Ga0105239_11937639 | |||
| 860 | Ga0157373_10429337 | |||
| 861 | Ga0157371_10293055 | |||
| 862 | Ga0157369_12106001 | |||
| 863 | Ga0157374_10023552 | |||
| 864 | Ga0157374_10270384 | |||
| 865 | Ga0157374_10352414 | |||
| 866 | Ga0157374_10903727 | |||
| 867 | Ga0157374_11227863 | |||
| 868 | Ga0157374_11333724 | |||
| 869 | Ga0157378_10046740 | |||
| 870 | Ga0157378_10145847 | |||
| 871 | Ga0157378_10170697 | |||
| 872 | Ga0157378_10529362 | |||
| 873 | Ga0157378_10905908 | |||
| 874 | Ga0157378_11141190 | |||
| 875 | Ga0157378_12073430 | |||
| 876 | Ga0163162_10037100 | |||
| 877 | Ga0163162_10357245 | |||
| 878 | Ga0163162_10457022 | |||
| 879 | Ga0163162_12274418 | |||
| 880 | Ga0163162_12318103 | |||
| 881 | Ga0163162_12376097 | |||
| 882 | Ga0157372_10035116 | |||
| 883 | Ga0157372_10037590 | |||
| 884 | Ga0157372_10047250 | |||
| 885 | Ga0157372_10069362 | |||
| 886 | Ga0157375_10012538 | |||
| 887 | Ga0157375_10887077 | |||
| 888 | Ga0157375_11406091 | |||
| 889 | Ga0163163_10020210 | |||
| 890 | Ga0163163_10076329 | |||
| 891 | Ga0163163_10475055 | |||
| 892 | Ga0163163_10959083 | |||
| 893 | Ga0182008_10051368 | |||
| 894 | Ga0157379_11184939 | |||
| 895 | Ga0157379_11547687 | |||
| 896 | Ga0157376_10068193 | |||
| 897 | Ga0157376_10254816 | |||
| 898 | Ga0157376_10354181 | |||
| 899 | Ga0157376_10919156 | |||
| 900 | Ga0157376_11546037 | |||
| 901 | Ga0182005_1039644 | |||
| 902 | Ga0182005_1242087 | |||
| 903 | Ga0213876_10034520 | |||
| 904 | Ga0213875_10272061 | |||
| 905 | Ga0207666_1006881 | |||
| 906 | Ga0207673_1015008 | |||
| 907 | Ga0207673_1058380 | |||
| 908 | Ga0207697_10000352 | |||
| 909 | Ga0207697_10000984 | |||
| 910 | Ga0207697_10008894 | |||
| 911 | Ga0207697_10043893 | |||
| 912 | Ga0207653_10011216 | |||
| 913 | Ga0207653_10301072 | |||
| 914 | Ga0207692_10381767 | |||
| 915 | Ga0207692_10734699 | |||
| 916 | Ga0207699_10326926 | |||
| 917 | Ga0207645_10002352 | |||
| 918 | Ga0207684_10091117 | |||
| 919 | Ga0207684_10102665 | |||
| 920 | Ga0207684_10124274 | |||
| 921 | Ga0207684_10136460 | |||
| 922 | Ga0207684_10141273 | |||
| 923 | Ga0207684_10262327 | |||
| 924 | Ga0207684_10265424 | |||
| 925 | Ga0207707_11634818 | |||
| 926 | Ga0207693_10009706 | |||
| 927 | Ga0207693_10099688 | |||
| 928 | Ga0207693_10182158 | |||
| 929 | Ga0207693_10215765 | |||
| 930 | Ga0207693_10264377 | |||
| 931 | Ga0207693_10466570 | |||
| 932 | Ga0207693_10771592 | |||
| 933 | Ga0207693_10881654 | |||
| 934 | Ga0207693_11128873 | |||
| 935 | Ga0207663_10075043 | |||
| 936 | Ga0207663_11130730 | |||
| 937 | Ga0207660_10036583 | |||
| 938 | Ga0207662_10000559 | |||
| 939 | Ga0207662_10158114 | |||
| 940 | Ga0207657_10054614 | |||
| 941 | Ga0207657_10508929 | |||
| 942 | Ga0207649_10110147 | |||
| 943 | Ga0207646_10000386 | |||
| 944 | Ga0207646_10000411 | |||
| 945 | Ga0207646_10025706 | |||
| 946 | Ga0207646_10116310 | |||
| 947 | Ga0207646_10131976 | |||
| 948 | Ga0207646_10321363 | |||
| 949 | Ga0207646_10721865 | |||
| 950 | Ga0207646_10722031 | |||
| 951 | Ga0207646_11916180 | |||
| 952 | Ga0207681_10008691 | |||
| 953 | Ga0207650_10142698 | |||
| 954 | Ga0207659_10024917 | |||
| 955 | Ga0207659_10269917 | |||
| 956 | Ga0207659_10673300 | |||
| 957 | Ga0207687_10354404 | |||
| 958 | Ga0207700_10566486 | |||
| 959 | Ga0207700_10723298 | |||
| 960 | Ga0207664_10332748 | |||
| 961 | Ga0207664_10947590 | |||
| 962 | Ga0207644_10345690 | |||
| 963 | Ga0207644_10444074 | |||
| 964 | Ga0207706_10020606 | |||
| 965 | Ga0207706_10181266 | |||
| 966 | Ga0207706_10393162 | |||
| 967 | Ga0207706_11458394 | |||
| 968 | Ga0207709_10394944 | |||
| 969 | Ga0207670_10072101 | |||
| 970 | Ga0207670_10383361 | |||
| 971 | Ga0207670_11367454 | |||
| 972 | Ga0207669_10462446 | |||
| 973 | Ga0207704_11034311 | |||
| 974 | Ga0207665_10043972 | |||
| 975 | Ga0207665_10159437 | |||
| 976 | Ga0207665_10243822 | |||
| 977 | Ga0207665_10344080 | |||
| 978 | Ga0207665_10349040 | |||
| 979 | Ga0207665_11042338 | |||
| 980 | Ga0207691_10020547 | |||
| 981 | Ga0207691_11317320 | |||
| 982 | Ga0207689_10027373 | |||
| 983 | Ga0207689_11062998 | |||
| 984 | Ga0207661_10062817 | |||
| 985 | Ga0207661_10870082 | |||
| 986 | Ga0207679_10089516 | |||
| 987 | Ga0207679_10750489 | |||
| 988 | Ga0207651_12162204 | |||
| 989 | Ga0207712_10032945 | |||
| 990 | Ga0207712_10519845 | |||
| 991 | Ga0207668_10012259 | |||
| 992 | Ga0207668_10187839 | |||
| 993 | Ga0207658_10010561 | |||
| 994 | Ga0207677_10135326 | |||
| 995 | Ga0207677_10250140 | |||
| 996 | Ga0207703_11706732 | |||
| 997 | Ga0207678_10131206 | |||
| 998 | Ga0207708_10045187 | |||
| 999 | Ga0207708_10489060 | |||
| 1000 | Ga0207702_10102127 | |||
| 1001 | Ga0207702_10713244 | |||
| 1002 | Ga0207674_11579530 | |||
| 1003 | Ga0207675_100431104 | |||
| 1004 | Ga0207675_101640686 | |||
| 1005 | Ga0207683_10246174 | |||
| 1006 | Ga0209179_1134659 | |||
| 1007 | Ga0209999_1082629 | |||
| 1008 | Ga0209974_10040023 | |||
| 1009 | Ga0209974_10141539 | |||
| 1010 | Ga0207428_11171727 | |||
| 1011 | Ga0268266_10075111 | |||
| 1012 | Ga0268266_10225494 | |||
| 1013 | Ga0268266_11246919 | |||
| 1014 | Ga0268264_10189533 | |||
| 1015 | Ga0268264_10240021 | |||
| 1016 | Ga0307513_10138609 | |||
| 1017 | Ga0373938_0191752 | |||
| 1018 | Ga0373934_0156425 | |||
| 1019 | Ga0373944_0357255 | |||
| 1020 | Ga0373945_0490370 | |||
| 1021 | Ga0373953_0150285 | |||
| 1022 | Ga0373954_0216781 | |||
| 1023 | Ga0373956_0356808 | |||
| 1024 | Ga0373957_0418233 | |||
| 1025 | Ga0373943_0022632 | |||
| 1026 | Ga0373943_0052633 | |||
| 1027 | Ga0373943_0105217 | |||
| 1028 | Ga0373943_0338681 | |||
| 1029 | Ga0373946_0119110 | |||
| 1030 | Ga0373946_0627740 | |||
| 1031 | Ga0373955_0017614 | |||
| 1032 | Ga0373955_0230532 | |||
| 1033 | Ga0373955_0592942 | |||
| 1034 | Ga0373931_0696088 | |||
| 1035 | Ga0373935_0023971 | |||
| 1036 | Ga0373935_0074414 | |||
| 1037 | Ga0373927_0118698 | |||
| 1038 | Ga0373927_0643137 | |||
| 1039 | Ga0373933_0237275 | |||
| 1040 | Ga0373933_0455639 | |||
| 1041 | Ga0373933_0989438 | |||
| 1042 | Ga0373947_0062870 | |||
| 1043 | Ga0373947_0257228 | |||
| 1044 | Ga0373947_0264510 | |||
| 1045 | Ga0373947_0974747 | |||
| 1046 | Ga0373937_0160500 | |||
| 1047 | Ga0373937_0478108 | |||
| 1048 | Ga0373937_0591132 | |||
| 1049 | Ga0373925_0169337 | |||
| 1050 | Ga0373925_0222616 | |||
| 1051 | Ga0373925_1090675 | |||
| 1052 | Ga0373925_1393484 | |||
| 1053 | Ga0395899_0022448 | |||
| 1054 | Ga0395899_0118347 | |||
| 1055 | Ga0395900_0003229 | |||
| 1056 | Ga0395900_0394144 | |||
| 1057 | Ga0395900_0454842 | |||
| 1058 | Ga0395900_1118074 | |||
| 1059 | Ga0395898_0013011 | |||
| 1060 | Ga0395898_1972031 | |||
| 1061 | Ga0395905_0196930 | |||
| 1062 | Ga0395905_0774538 | |||
| 1063 | Ga0395905_1502340 | |||
| 1064 | Ga0436364_0314395 | |||
| 1065 | Ga0395901_0009691 | |||
| 1066 | Ga0395901_0169366 | |||
| 1067 | Ga0395901_0866844 | |||
| 1068 | Ga0436365_1041806 | |||
| 1069 | Ga0436365_1553827 | |||
| 1070 | Ga0436365_1814206 | |||
| 1071 | Ga0436362_1088089 | |||
| 1072 | Ga0451789_0118864 | |||
| 1073 | Ga0451802_1858742 | |||
| 1074 | Ga0451807_0485362 | |||
| 1075 | Ga0451807_1347153 | |||
| 1076 | Ga0451853_3701655 | |||
| 1077 | Ga0439443_102195 | |||
| 1078 | Ga0439450_092665 | |||
| 1079 | Ga0439451_073908 | |||
| 1080 | Ga0439454_005879 | |||
| 1081 | Ga0439456_141529 | |||
| 1082 | Ga0439458_0194602 | |||
| 1083 | Ga0439460_0021227 | |||
| 1084 | Ga0439460_0100411 | |||
| 1085 | Ga0439460_0344709 | |||
| 1086 | Ga0450893_0107990 | |||
| 1087 | Ga0439440_0169405 | |||
| 1088 | Ga0451576_0081187 | |||
| 1089 | Ga0451576_0689696 | |||
| 1090 | Ga0451576_0728725 | |||
| 1091 | Ga0466967_0173121 | |||
| 1092 | Ga0466967_0345721 | |||
| 1093 | Ga0495592_0068725 | |||
| 1094 | Ga0495592_0189178 | |||
| 1095 | Ga0495590_0413178 | |||
| 1096 | Ga0495629_0196920 | |||
| 1097 | Ga0495641_0112655 | |||
| 1098 | Ga0495651_0117255 | |||
| 1099 | Ga0495651_0240421 | |||
| 1100 | Ga0495651_0844532 | |||
| 1101 | Ga0495651_0950725 | |||
| 1102 | Ga0495653_0271399 | |||
| 1103 | Ga0495653_0388788 | |||
| 1104 | Ga0495653_0547918 | |||
| 1105 | Ga0495653_0935263 | |||
| 1106 | Ga0495582_0018551 | |||
| 1107 | Ga0495582_0386236 | |||
| 1108 | Ga0495639_0014674 | |||
| 1109 | Ga0495662_0282764 | |||
| 1110 | Ga0495664_0432792 | |||
| 1111 | Ga0495594_0552134 | |||
| 1112 | Ga0495608_0135829 | |||
| 1113 | Ga0495618_0071332 | |||
| 1114 | Ga0495618_0225455 | |||
| 1115 | Ga0495628_0017332 | |||
| 1116 | Ga0495628_0145408 | |||
| 1117 | Ga0495630_0194999 | |||
| 1118 | Ga0495652_0239233 | |||
| 1119 | Ga0495640_0807143 | |||
| 1120 | Ga0495586_0172963 | |||
| 1121 | Ga0495586_0244981 | |||
| 1122 | Ga0495621_0113418 | |||
| 1123 | Ga0495597_0400960 | |||
| 1124 | Ga0495645_0022313 | |||
| 1125 | Ga0495645_0905886 | |||
| 1126 | Ga0495634_0115451 | |||
| 1127 | Ga0495634_0515476 | |||
| 1128 | Ga0495635_0180884 | |||
| 1129 | Ga0495635_0210731 | |||
| 1130 | Ga0495635_0696898 | |||
| 1131 | Ga0495657_0075637 | |||
| 1132 | Ga0495599_0026353 | |||
| 1133 | Ga0495599_0249872 | |||
| 1134 | Ga0495623_0061849 | |||
| 1135 | Ga0495646_0071363 | |||
| 1136 | Ga0495646_0386311 | |||
| 1137 | Ga0495658_0749190 | |||
| 1138 | Ga0495669_0097832 | |||
| 1139 | Ga0495669_0576928 | |||
| 1140 | Ga0495613_0273258 | |||
| 1141 | Ga0495613_0541272 | |||
| 1142 | Ga0495624_0501462 | |||
| 1143 | Ga0495624_0835630 | |||
| 1144 | Ga0495670_0202072 | |||
| 1145 | Ga0495600_0439450 | |||
| 1146 | Ga0495581_0042823 | |||
| 1147 | Ga0495604_0080507 | |||
| 1148 | Ga0495604_0268522 | |||
| 1149 | Ga0495604_1048445 | |||
| 1150 | Ga0495674_0072861 | |||
| 1151 | Ga0495674_0221910 | |||
| 1152 | Ga0495674_0940354 | |||
| 1153 | Ga0495676_0274199 | |||
| 1154 | Ga0495680_0270032 | |||
| 1155 | Ga0495675_0079449 | |||
| 1156 | Ga0495684_0011055 | |||
| 1157 | Ga0495684_0055215 | |||
| 1158 | Ga0495602_0415370 | |||
| 1159 | Ga0496100_0028555 | |||
| 1160 | Ga0496100_0613234 | |||
| 1161 | Ga0496101_0613854 | |||
| 1162 | Ga0496101_0902498 | |||
| 1163 | Ga0496102_0153208 | |||
| 1164 | Ga0496102_0276961 | |||
| 1165 | Ga0496102_0967746 | |||
| 1166 | Ga0496102_1280977 | |||
| 1167 | Ga0496103_0297143 | |||
| 1168 | Ga0496103_0333693 | |||
| 1169 | Ga0496103_0947864 | |||
| 1170 | Ga0496104_0057889 | |||
| 1171 | Ga0496104_0076185 | |||
| 1172 | Ga0496104_0174226 | |||
| 1173 | Ga0496104_0384092 | |||
| 1174 | Ga0496105_0027127 | |||
| 1175 | Ga0496105_0105288 | |||
| 1176 | Ga0496105_0124602 | |||
| 1177 | Ga0496106_0385551 | |||
| 1178 | Ga0496106_0473465 | |||
| 1179 | Ga0496106_0668943 | |||
| 1180 | Ga0496107_0155587 | |||
| 1181 | Ga0496107_0329014 | |||
| 1182 | Ga0496108_0007830 | |||
| 1183 | Ga0496108_0123064 | |||
| 1184 | Ga0496108_0165673 | |||
| 1185 | Ga0496108_0235097 | |||
| 1186 | Ga0496108_1706183 | |||
| 1187 | Ga0496109_0020560 | |||
| 1188 | Ga0496109_0113981 | |||
| 1189 | Ga0496109_0631805 | |||
| 1190 | Ga0496109_0722817 | |||
| 1191 | Ga0496110_0456272 | |||
| 1192 | Ga0496110_0992307 | |||
| 1193 | Ga0496112_0075159 | |||
| 1194 | Ga0496112_0106218 | |||
| 1195 | Ga0496112_0351130 | |||
| 1196 | Ga0496112_0412501 | |||
| 1197 | Ga0496112_1345883 | |||
| 1198 | Ga0496113_0046236 | |||
| 1199 | Ga0496113_0115512 | |||
| 1200 | Ga0496113_0166841 | |||
| 1201 | Ga0496114_0045338 | |||
| 1202 | Ga0496114_0123586 | |||
| 1203 | Ga0496114_0376695 | |||
| 1204 | Ga0496114_0895690 | |||
| 1205 | Ga0496115_0004435 | |||
| 1206 | Ga0496115_0050669 | |||
| 1207 | Ga0496115_0095551 | |||
| 1208 | Ga0496115_0105226 | |||
| 1209 | Ga0496115_0598695 | |||
| 1210 | nmdc:mga05p37_1396094_c1 | |||
| 1211 | nmdc:mga05p37_156514_c1 | |||
| 1212 | nmdc:mga05p37_17694_c1 | |||
| 1213 | nmdc:mga05p37_686477_c1 | |||
| 1214 | nmdc:mga08y16_517878_c1 | |||
| 1215 | nmdc:mga08y16_782818_c1 | |||
| 1216 | nmdc:mga0n895_371648_c1 | |||
| 1217 | nmdc:mga0n895_762462_c1 | |||
| 1218 | nmdc:mga0n895_972391_c1 | |||
| 1219 | nmdc:mga08x19_318528_c1 | |||
| 1220 | nmdc:mga0a205_201719_c1 | |||
| 1221 | nmdc:mga0a205_506861_c1 | |||
| 1222 | nmdc:mga0a205_929221_c1 | |||
| 1223 | Ga0495601_0006303 | |||
| 1224 | Ga0495612_0106717 | |||
| 1225 | Ga0495655_0327381 | |||
| 1226 | Ga0495595_0262332 | |||
| 1227 | Ga0495619_0598595 | |||
| 1228 | Ga0495619_1191881 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5svb-assembly1.cif.gz_F | mechanism of atp-dependent acetone carboxylation, acetone carboxylase amp bound structure | 0.7741 | 24 | 56 |
| 5m45-assembly2.cif.gz_L | structure of acetone carboxylase purified from xanthobacter autotrophicus | 0.7536 | 24 | 56 |
| 8ifj-assembly5.cif.gz_J | crystal structure of pyrrolysyl-trna synthetase from methanogenic archaeon iso4-g1 | 0.7536 | 23 | 56 |
| 6y2r-assembly1.cif.gz_A | escherichia coli r255a rnla endoribonuclease (single alanine mutant of rnla) | 0.7406 | 25 | 58 |
| 4gak-assembly1.cif.gz_A-2 | crystal structure of acyl-acp thioesterase from spirosoma linguale | 0.7391 | 25 | 56 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JH63_227_471_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8395 | 25 | 56 | 2.130.10.10 |
| af_A0A0R0IJU0_61_261_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8259 | 26 | 56 | 2.130.10.10 |
| af_Q9LZY2_79_203_3.30.310.50 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain | 0.804 | 24 | 56 | 3.30.310.50 |
| af_B4FKW7_103_359_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7872 | 21 | 56 | 2.130.10.10 |
| af_A0A1D6FSG1_60_366_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7784 | 21 | 56 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6EQI5-F1-model_v4 | Cytoplasmic protein | 0.9309 | 10 | 56 |
|
| AF-A0A1G1GJJ1-F1-model_v4 | Cytoplasmic protein | 0.924 | 9 | 56 |
|
| AF-A0A534VUK5-F1-model_v4 | Cytoplasmic protein | 0.9213 | 10 | 56 |
|
| AF-A0A7C3PA55-F1-model_v4 | Cytoplasmic protein | 0.92 | 9 | 56 |
|
| AF-A0A330L4I8-F1-model_v4 | Cytoplasmic protein | 0.9009 | 2 | 56 |
|