F469398

General Info

Members Datasets Scaffolds Average Seq Length
614 263 1228 80

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_306953_c1|nmdc:mga08x19_306953_c1_599_877
Length 92
Sequence MSLHPHEQPPRXXXXSQFENFTASSLFCEKCKTATPVRERLLLVLPEKEIFDYLCTECGSSVGQREVTAGEKMVTEAMRPRQQVRIPLRSLR

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
189 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
190 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
191 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
192 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.96
Rhizosphere 89.74
Stem 0
Stem Tuber 0
Unclassified 37.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_306953_c1 3300050514 Bacteria 1103
2 SwRhRL2b_contig_487712 2162886007 Unclassified 1639
3 JGI25405J52794_10001154 3300003911 Bacteria 4258
4 JGI25405J52794_10114037 3300003911 Unclassified 607
5 Ga0065714_10261922 3300005288 Bacteria 755
6 Ga0065704_10115402 3300005289 Unclassified 1872
7 Ga0065704_10696436 3300005289 Bacteria 563
8 Ga0065712_10003065 3300005290 Bacteria 6204
9 Ga0065712_10010801 3300005290 Bacteria 4447
10 Ga0065712_10037007 3300005290 Bacteria 1158
11 Ga0065712_10081269 3300005290 Bacteria 3023
12 Ga0065712_10158908 3300005290 Bacteria 1316
13 Ga0065712_10270745 3300005290 Bacteria 916
14 Ga0065712_10540651 3300005290 Bacteria 624
15 Ga0065715_10016501 3300005293 Unclassified 3797
16 Ga0065715_10021146 3300005293 Bacteria 1980
17 Ga0065715_10052240 3300005293 Unclassified 1072
18 Ga0065715_10091525 3300005293 Bacteria 5726
19 Ga0065715_10324687 3300005293 Unclassified 995
20 Ga0065715_10372717 3300005293 Bacteria 919
21 Ga0065715_10577688 3300005293 Unclassified 722
22 Ga0065715_10836330 3300005293 Bacteria 597
23 Ga0065715_11041566 3300005293 Unclassified 526
24 Ga0065707_10067356 3300005295 Bacteria 558
25 Ga0065707_10075781 3300005295 Bacteria 509
26 Ga0065707_10215638 3300005295 Bacteria 1246
27 Ga0065707_10243477 3300005295 Bacteria 1138
28 Ga0065707_10259383 3300005295 Bacteria 1102
29 Ga0070676_10085172 3300005328 Bacteria 1925
30 Ga0070676_11051733 3300005328 Unclassified 613
31 Ga0070683_101486798 3300005329 Bacteria 651
32 Ga0070690_100646375 3300005330 Bacteria 807
33 Ga0070670_100339960 3300005331 Bacteria 1317
34 Ga0070670_101449333 3300005331 Bacteria 630
35 Ga0068869_100359995 3300005334 Unclassified 1188
36 Ga0068869_100383853 3300005334 Unclassified 1152
37 Ga0070680_100219233 3300005336 Unclassified 1606
38 Ga0070682_100300714 3300005337 Bacteria 1177
39 Ga0068868_100097921 3300005338 Bacteria 2371
40 Ga0068868_101307261 3300005338 Bacteria 674
41 Ga0070660_100057421 3300005339 Bacteria 3015
42 Ga0070660_100735156 3300005339 Bacteria 828
43 Ga0070660_101113105 3300005339 Unclassified 669
44 Ga0070689_100087900 3300005340 Bacteria 2446
45 Ga0070689_100327029 3300005340 Unclassified 1282
46 Ga0070689_101357518 3300005340 Unclassified 641
47 Ga0070687_100174912 3300005343 Bacteria 1281
48 Ga0070687_100595681 3300005343 Bacteria 759
49 Ga0070661_100152481 3300005344 Bacteria 1747
50 Ga0070668_100037400 3300005347 Bacteria 3706
51 Ga0070668_101842434 3300005347 Unclassified 557
52 Ga0070669_100009942 3300005353 Bacteria 6770
53 Ga0070675_100010797 3300005354 Bacteria 7142
54 Ga0070675_100026530 3300005354 Bacteria 4650
55 Ga0070675_100182827 3300005354 Bacteria 1813
56 Ga0070675_100514618 3300005354 Bacteria 1079
57 Ga0070675_101387309 3300005354 Unclassified 648
58 Ga0070671_100389905 3300005355 Unclassified 1191
59 Ga0070671_100442229 3300005355 Unclassified 1115
60 Ga0070671_100704107 3300005355 Bacteria 876
61 Ga0070671_100800582 3300005355 Bacteria 821
62 Ga0070671_101332223 3300005355 Bacteria 633
63 Ga0070674_102066612 3300005356 Unclassified 519
64 Ga0070673_100113473 3300005364 Bacteria 2250
65 Ga0070688_100002376 3300005365 Bacteria 9504
66 Ga0070688_100018766 3300005365 Bacteria 3999
67 Ga0070688_100211578 3300005365 Bacteria 1361
68 Ga0070688_100456199 3300005365 Unclassified 956
69 Ga0070659_100007384 3300005366 Bacteria 7984
70 Ga0070659_100061699 3300005366 Bacteria 2963
71 Ga0070659_100756088 3300005366 Unclassified 843
72 Ga0070659_102092515 3300005366 Unclassified 509
73 Ga0070667_100168843 3300005367 Bacteria 1930
74 Ga0070667_100822872 3300005367 Unclassified 863
75 Ga0070703_10033710 3300005406 Unclassified 1560
76 Ga0070703_10175429 3300005406 Unclassified 824
77 Ga0070709_10052815 3300005434 Bacteria 2556
78 Ga0070714_100095258 3300005435 Bacteria 2614
79 Ga0070713_100067358 3300005436 Bacteria 3014
80 Ga0070713_100320294 3300005436 Bacteria 1432
81 Ga0070713_101850290 3300005436 Unclassified 586
82 Ga0070710_10088599 3300005437 Bacteria 1821
83 Ga0070710_10160255 3300005437 Bacteria 1394
84 Ga0070710_10467498 3300005437 Bacteria 858
85 Ga0070710_11082467 3300005437 Bacteria 588
86 Ga0070701_10230075 3300005438 Unclassified 1110
87 Ga0070711_100719774 3300005439 Bacteria 841
88 Ga0070705_100014916 3300005440 Bacteria 4008
89 Ga0070705_100438717 3300005440 Bacteria 977
90 Ga0070700_100070627 3300005441 Unclassified 2227
91 Ga0070694_100106175 3300005444 Bacteria 1994
92 Ga0070694_101966160 3300005444 Unclassified 500
93 Ga0070708_100002881 3300005445 Bacteria 13354
94 Ga0070708_100006600 3300005445 Bacteria 9237
95 Ga0070708_100034509 3300005445 Bacteria 4402
96 Ga0070708_100102832 3300005445 Bacteria 2618
97 Ga0070708_100112692 3300005445 Bacteria 2502
98 Ga0070708_100224520 3300005445 Bacteria 1762
99 Ga0070708_100356893 3300005445 Bacteria 1378
100 Ga0070708_100405283 3300005445 Bacteria 1286
101 Ga0070708_101512084 3300005445 Bacteria 625
102 Ga0070708_101921046 3300005445 Unclassified 549
103 Ga0070662_100026771 3300005457 Bacteria 3996
104 Ga0070662_100076944 3300005457 Bacteria 2475
105 Ga0070662_100383282 3300005457 Bacteria 1157
106 Ga0070662_100936906 3300005457 Unclassified 740
107 Ga0070681_10338346 3300005458 Unclassified 1414
108 Ga0070706_100020713 3300005467 Bacteria 6058
109 Ga0070706_100101456 3300005467 Bacteria 2674
110 Ga0070706_100170449 3300005467 Bacteria 2032
111 Ga0070706_100336723 3300005467 Bacteria 1407
112 Ga0070706_100414643 3300005467 Bacteria 1254
113 Ga0070706_100921693 3300005467 Bacteria 807
114 Ga0070706_101060489 3300005467 Unclassified 746
115 Ga0070707_100000846 3300005468 Bacteria 30361
116 Ga0070707_100023714 3300005468 Bacteria 5803
117 Ga0070707_100026907 3300005468 Bacteria 5467
118 Ga0070707_100043665 3300005468 Bacteria 4289
119 Ga0070707_100108398 3300005468 Bacteria 2694
120 Ga0070707_100110748 3300005468 Bacteria 2663
121 Ga0070707_100185506 3300005468 Bacteria 2028
122 Ga0070707_100211197 3300005468 Bacteria 1892
123 Ga0070707_100219458 3300005468 Bacteria 1852
124 Ga0070707_100811188 3300005468 Unclassified 900
125 Ga0070707_100837756 3300005468 Unclassified 884
126 Ga0070707_101173691 3300005468 Unclassified 734
127 Ga0070707_101540407 3300005468 Bacteria 632
128 Ga0070698_100005905 3300005471 Bacteria 13355
129 Ga0070698_100007983 3300005471 Bacteria 11444
130 Ga0070698_100038467 3300005471 Bacteria 4929
131 Ga0070698_100060761 3300005471 Bacteria 3812
132 Ga0070698_100620749 3300005471 Unclassified 1022
133 Ga0070698_101980476 3300005471 Unclassified 536
134 Ga0070699_100178700 3300005518 Bacteria 1883
135 Ga0070699_100244776 3300005518 Bacteria 1601
136 Ga0070699_100335856 3300005518 Bacteria 1359
137 Ga0070699_100791394 3300005518 Bacteria 868
138 Ga0070699_101294833 3300005518 Unclassified 668
139 Ga0070699_102117501 3300005518 Unclassified 514
140 Ga0070679_100298551 3300005530 Unclassified 1561
141 Ga0070684_100001535 3300005535 Bacteria 16699
142 Ga0070684_100706982 3300005535 Bacteria 940
143 Ga0070697_100000863 3300005536 Bacteria 22791
144 Ga0070697_100003442 3300005536 Bacteria 12164
145 Ga0070697_100006005 3300005536 Bacteria 9392
146 Ga0070697_100078405 3300005536 Unclassified 2718
147 Ga0070697_100088819 3300005536 Bacteria 2553
148 Ga0070697_100129616 3300005536 Bacteria 2115
149 Ga0070697_100160611 3300005536 Bacteria 1898
150 Ga0070697_101240437 3300005536 Unclassified 665
151 Ga0068853_101004612 3300005539 Unclassified 803
152 Ga0070672_101199276 3300005543 Unclassified 676
153 Ga0070672_101246800 3300005543 Unclassified 663
154 Ga0070672_101364844 3300005543 Unclassified 633
155 Ga0070686_100614975 3300005544 Bacteria 858
156 Ga0070695_101833327 3300005545 Unclassified 509
157 Ga0070696_100898244 3300005546 Unclassified 735
158 Ga0070665_100010897 3300005548 Bacteria 9196
159 Ga0070665_100104721 3300005548 Unclassified 2831
160 Ga0070665_100995071 3300005548 Bacteria 851
161 Ga0070665_101187115 3300005548 Bacteria 774
162 Ga0070665_101201219 3300005548 Bacteria 769
163 Ga0070665_102271227 3300005548 Bacteria 546
164 Ga0070704_100029226 3300005549 Bacteria 3677
165 Ga0070704_100178755 3300005549 Bacteria 1695
166 Ga0070704_102271317 3300005549 Unclassified 505
167 Ga0070664_100184162 3300005564 Unclassified 1858
168 Ga0068856_100400304 3300005614 Bacteria 1393
169 Ga0068856_102076137 3300005614 Unclassified 578
170 Ga0070702_100205983 3300005615 Bacteria 1306
171 Ga0070702_100258861 3300005615 Bacteria 1184
172 Ga0070702_100748357 3300005615 Bacteria 750
173 Ga0070702_101692201 3300005615 Unclassified 526
174 Ga0068852_100305516 3300005616 Unclassified 1541
175 Ga0068866_10230084 3300005718 Bacteria 1124
176 Ga0068861_100376412 3300005719 Unclassified 1253
177 Ga0068860_100178221 3300005843 Bacteria 2054
178 Ga0068862_100723345 3300005844 Unclassified 966
179 Ga0081455_10001494 3300005937 Bacteria 28914
180 Ga0081455_10022426 3300005937 Bacteria 5901
181 Ga0081455_10053897 3300005937 Bacteria 3433
182 Ga0081455_10174088 3300005937 Bacteria 1636
183 Ga0081455_10334206 3300005937 Bacteria 1074
184 Ga0081540_1000380 3300005983 Bacteria 44546
185 Ga0081540_1064732 3300005983 Bacteria 1723
186 Ga0081539_10158384 3300005985 Bacteria 1082
187 Ga0081539_10423627 3300005985 Unclassified 552
188 Ga0070717_10155762 3300006028 Bacteria 1979
189 Ga0070717_10175171 3300006028 Bacteria 1867
190 Ga0070717_10186488 3300006028 Unclassified 1811
191 Ga0070717_10606153 3300006028 Bacteria 993
192 Ga0070717_11397563 3300006028 Unclassified 636
193 Ga0070716_100125331 3300006173 Bacteria 1615
194 Ga0070716_100619223 3300006173 Unclassified 817
195 Ga0070716_100965445 3300006173 Unclassified 672
196 Ga0070716_101808088 3300006173 Unclassified 506
197 Ga0070712_100032854 3300006175 Bacteria 3506
198 Ga0070712_100256451 3300006175 Unclassified 1400
199 Ga0070712_100738290 3300006175 Bacteria 842
200 Ga0070712_101340385 3300006175 Unclassified 624
201 Ga0070712_101580262 3300006175 Unclassified 574
202 Ga0070712_102036898 3300006175 Bacteria 503
203 Ga0070712_102060315 3300006175 Bacteria 500
204 Ga0097621_100115074 3300006237 Bacteria 2276
205 Ga0068871_100050156 3300006358 Unclassified 3376
206 Ga0068871_100479285 3300006358 Bacteria 1119
207 Ga0075428_100554172 3300006844 Unclassified 1229
208 Ga0075428_101772363 3300006844 Bacteria 643
209 Ga0075433_10528133 3300006852 Unclassified 1038
210 Ga0075434_100194802 3300006871 Bacteria 2046
211 Ga0075434_101019057 3300006871 Bacteria 842
212 Ga0068865_101597682 3300006881 Unclassified 586
213 Ga0099794_10196661 3300007265 Bacteria 1032
214 Ga0099794_10716498 3300007265 Bacteria 533
215 Ga0099795_10062080 3300007788 Bacteria 1389
216 Ga0099795_10083267 3300007788 Bacteria 1228
217 Ga0105240_10093626 3300009093 Bacteria 3667
218 Ga0111539_10172553 3300009094 Bacteria 2526
219 Ga0111539_12666383 3300009094 Unclassified 579
220 Ga0105245_10577690 3300009098 Bacteria 1148
221 Ga0114129_10010111 3300009147 Bacteria 13449
222 Ga0114129_10156788 3300009147 Bacteria 3112
223 Ga0114129_10246469 3300009147 Bacteria 2400
224 Ga0114129_10611255 3300009147 Bacteria 1411
225 Ga0114129_11821284 3300009147 Bacteria 740
226 Ga0105243_10237903 3300009148 Bacteria 1619
227 Ga0105241_12292380 3300009174 Unclassified 537
228 Ga0105242_11561918 3300009176 Bacteria 692
229 Ga0105248_10358801 3300009177 Bacteria 1641
230 Ga0105248_13175556 3300009177 Unclassified 523
231 Ga0105237_10081858 3300009545 Bacteria 3219
232 Ga0105237_11268000 3300009545 Unclassified 743
233 Ga0105249_10016016 3300009553 Bacteria 6645
234 Ga0105249_10029932 3300009553 Bacteria 4918
235 Ga0105249_12767848 3300009553 Unclassified 562
236 Ga0099796_10155600 3300010159 Bacteria 903
237 Ga0099796_10174592 3300010159 Bacteria 859
238 Ga0099796_10250069 3300010159 Bacteria 736
239 Ga0099796_10267643 3300010159 Unclassified 715
240 Ga0105239_10018427 3300010375 Bacteria 7712
241 Ga0105239_10043040 3300010375 Bacteria 4948
242 Ga0105239_10252267 3300010375 Bacteria 1982
243 Ga0105239_10544229 3300010375 Unclassified 1322
244 Ga0105239_11756252 3300010375 Bacteria 718
245 Ga0105239_11937639 3300010375 Bacteria 684
246 Ga0157373_10429337 3300013100 Bacteria 949
247 Ga0157371_10293055 3300013102 Bacteria 1177
248 Ga0157369_12106001 3300013105 Unclassified 572
249 Ga0157374_10023552 3300013296 Bacteria 5509
250 Ga0157374_10270384 3300013296 Bacteria 1676
251 Ga0157374_10352414 3300013296 Bacteria 1463
252 Ga0157374_10903727 3300013296 Bacteria 901
253 Ga0157374_11227863 3300013296 Unclassified 771
254 Ga0157374_11333724 3300013296 Bacteria 740
255 Ga0157378_10046740 3300013297 Bacteria 3847
256 Ga0157378_10145847 3300013297 Bacteria 2201
257 Ga0157378_10170697 3300013297 Unclassified 2040
258 Ga0157378_10529362 3300013297 Unclassified 1181
259 Ga0157378_10905908 3300013297 Bacteria 913
260 Ga0157378_11141190 3300013297 Bacteria 817
261 Ga0157378_12073430 3300013297 Unclassified 619
262 Ga0163162_10037100 3300013306 Bacteria 4861
263 Ga0163162_10357245 3300013306 Bacteria 1594
264 Ga0163162_10457022 3300013306 Unclassified 1409
265 Ga0163162_12274418 3300013306 Bacteria 623
266 Ga0163162_12318103 3300013306 Unclassified 617
267 Ga0163162_12376097 3300013306 Unclassified 609
268 Ga0157372_10035116 3300013307 Bacteria 5517
269 Ga0157372_10037590 3300013307 Bacteria 5342
270 Ga0157372_10047250 3300013307 Bacteria 4782
271 Ga0157372_10069362 3300013307 Unclassified 3965
272 Ga0157375_10012538 3300013308 Bacteria 7523
273 Ga0157375_10887077 3300013308 Bacteria 1036
274 Ga0157375_11406091 3300013308 Unclassified 822
275 Ga0163163_10020210 3300014325 Bacteria 6267
276 Ga0163163_10076329 3300014325 Bacteria 3345
277 Ga0163163_10475055 3300014325 Bacteria 1311
278 Ga0163163_10959083 3300014325 Unclassified 918
279 Ga0182008_10051368 3300014497 Bacteria 2045
280 Ga0157379_11184939 3300014968 Unclassified 734
281 Ga0157379_11547687 3300014968 Unclassified 646
282 Ga0157376_10068193 3300014969 Unclassified 3011
283 Ga0157376_10254816 3300014969 Bacteria 1641
284 Ga0157376_10354181 3300014969 Bacteria 1406
285 Ga0157376_10919156 3300014969 Unclassified 894
286 Ga0157376_11546037 3300014969 Unclassified 697
287 Ga0182005_1039644 3300015265 Bacteria 1281
288 Ga0182005_1242087 3300015265 Unclassified 555
289 Ga0213876_10034520 3300021384 Bacteria 2668
290 Ga0213875_10272061 3300021388 Bacteria 800
291 Ga0207666_1006881 3300025271 Unclassified 1484
292 Ga0207673_1015008 3300025290 Unclassified 1024
293 Ga0207673_1058380 3300025290 Unclassified 549
294 Ga0207697_10000352 3300025315 Bacteria 25702
295 Ga0207697_10000984 3300025315 Bacteria 15936
296 Ga0207697_10008894 3300025315 Bacteria 4366
297 Ga0207697_10043893 3300025315 Bacteria 1838
298 Ga0207653_10011216 3300025885 Bacteria 2797
299 Ga0207653_10301072 3300025885 Bacteria 621
300 Ga0207692_10381767 3300025898 Bacteria 875
301 Ga0207692_10734699 3300025898 Bacteria 642
302 Ga0207699_10326926 3300025906 Bacteria 1077
303 Ga0207645_10002352 3300025907 Bacteria 14913
304 Ga0207684_10091117 3300025910 Bacteria 2598
305 Ga0207684_10102665 3300025910 Bacteria 2445
306 Ga0207684_10124274 3300025910 Bacteria 2213
307 Ga0207684_10136460 3300025910 Bacteria 2107
308 Ga0207684_10141273 3300025910 Bacteria 2070
309 Ga0207684_10262327 3300025910 Bacteria 1491
310 Ga0207684_10265424 3300025910 Bacteria 1481
311 Ga0207707_11634818 3300025912 Unclassified 506
312 Ga0207693_10009706 3300025915 Bacteria 7835
313 Ga0207693_10099688 3300025915 Bacteria 2278
314 Ga0207693_10182158 3300025915 Bacteria 1653
315 Ga0207693_10215765 3300025915 Bacteria 1508
316 Ga0207693_10264377 3300025915 Unclassified 1349
317 Ga0207693_10466570 3300025915 Unclassified 986
318 Ga0207693_10771592 3300025915 Bacteria 742
319 Ga0207693_10881654 3300025915 Bacteria 687
320 Ga0207693_11128873 3300025915 Unclassified 594
321 Ga0207663_10075043 3300025916 Bacteria 2193
322 Ga0207663_11130730 3300025916 Unclassified 630
323 Ga0207660_10036583 3300025917 Unclassified 3413
324 Ga0207662_10000559 3300025918 Bacteria 16548
325 Ga0207662_10158114 3300025918 Bacteria 1446
326 Ga0207657_10054614 3300025919 Bacteria 3453
327 Ga0207657_10508929 3300025919 Bacteria 943
328 Ga0207649_10110147 3300025920 Bacteria 1838
329 Ga0207646_10000386 3300025922 Bacteria 59216
330 Ga0207646_10000411 3300025922 Bacteria 57429
331 Ga0207646_10025706 3300025922 Bacteria 5384
332 Ga0207646_10116310 3300025922 Bacteria 2402
333 Ga0207646_10131976 3300025922 Bacteria 2248
334 Ga0207646_10321363 3300025922 Bacteria 1398
335 Ga0207646_10721865 3300025922 Bacteria 890
336 Ga0207646_10722031 3300025922 Unclassified 890
337 Ga0207646_11916180 3300025922 Unclassified 505
338 Ga0207681_10008691 3300025923 Bacteria 6201
339 Ga0207650_10142698 3300025925 Bacteria 1884
340 Ga0207659_10024917 3300025926 Bacteria 4015
341 Ga0207659_10269917 3300025926 Unclassified 1387
342 Ga0207659_10673300 3300025926 Bacteria 885
343 Ga0207687_10354404 3300025927 Bacteria 1196
344 Ga0207700_10566486 3300025928 Bacteria 1009
345 Ga0207700_10723298 3300025928 Bacteria 889
346 Ga0207664_10332748 3300025929 Bacteria 1342
347 Ga0207664_10947590 3300025929 Bacteria 772
348 Ga0207644_10345690 3300025931 Unclassified 1207
349 Ga0207644_10444074 3300025931 Bacteria 1065
350 Ga0207706_10020606 3300025933 Bacteria 5925
351 Ga0207706_10181266 3300025933 Unclassified 1849
352 Ga0207706_10393162 3300025933 Unclassified 1202
353 Ga0207706_11458394 3300025933 Unclassified 560
354 Ga0207709_10394944 3300025935 Unclassified 1056
355 Ga0207670_10072101 3300025936 Bacteria 2390
356 Ga0207670_10383361 3300025936 Unclassified 1120
357 Ga0207670_11367454 3300025936 Unclassified 601
358 Ga0207669_10462446 3300025937 Unclassified 1008
359 Ga0207704_11034311 3300025938 Unclassified 696
360 Ga0207665_10043972 3300025939 Unclassified 2988
361 Ga0207665_10159437 3300025939 Bacteria 1622
362 Ga0207665_10243822 3300025939 Bacteria 1325
363 Ga0207665_10344080 3300025939 Bacteria 1124
364 Ga0207665_10349040 3300025939 Unclassified 1117
365 Ga0207665_11042338 3300025939 Bacteria 651
366 Ga0207691_10020547 3300025940 Bacteria 6244
367 Ga0207691_11317320 3300025940 Bacteria 596
368 Ga0207689_10027373 3300025942 Bacteria 4773
369 Ga0207689_11062998 3300025942 Unclassified 682
370 Ga0207661_10062817 3300025944 Bacteria 3006
371 Ga0207661_10870082 3300025944 Unclassified 830
372 Ga0207679_10089516 3300025945 Bacteria 2376
373 Ga0207679_10750489 3300025945 Unclassified 888
374 Ga0207651_12162204 3300025960 Unclassified 500
375 Ga0207712_10032945 3300025961 Bacteria 3500
376 Ga0207712_10519845 3300025961 Unclassified 1020
377 Ga0207668_10012259 3300025972 Bacteria 5241
378 Ga0207668_10187839 3300025972 Unclassified 1635
379 Ga0207658_10010561 3300025986 Bacteria 6273
380 Ga0207677_10135326 3300026023 Bacteria 1878
381 Ga0207677_10250140 3300026023 Unclassified 1439
382 Ga0207703_11706732 3300026035 Unclassified 606
383 Ga0207678_10131206 3300026067 Bacteria 2137
384 Ga0207708_10045187 3300026075 Bacteria 3357
385 Ga0207708_10489060 3300026075 Unclassified 1030
386 Ga0207702_10102127 3300026078 Bacteria 2533
387 Ga0207702_10713244 3300026078 Bacteria 989
388 Ga0207674_11579530 3300026116 Bacteria 625
389 Ga0207675_100431104 3300026118 Unclassified 1304
390 Ga0207675_101640686 3300026118 Unclassified 663
391 Ga0207683_10246174 3300026121 Bacteria 1631
392 Ga0209179_1134659 3300027512 Bacteria 552
393 Ga0209999_1082629 3300027543 Unclassified 620
394 Ga0209974_10040023 3300027876 Bacteria 1559
395 Ga0209974_10141539 3300027876 Unclassified 863
396 Ga0207428_11171727 3300027907 Bacteria 535
397 Ga0268266_10075111 3300028379 Bacteria 2935
398 Ga0268266_10225494 3300028379 Bacteria 1724
399 Ga0268266_11246919 3300028379 Unclassified 719
400 Ga0268264_10189533 3300028381 Bacteria 1874
401 Ga0268264_10240021 3300028381 Unclassified 1678
402 Ga0307513_10138609 3300031456 Bacteria 2363
403 Ga0373938_0191752 3300034957 Unclassified 563
404 Ga0373934_0156425 3300035086 Unclassified 935
405 Ga0373944_0357255 3300035089 Unclassified 557
406 Ga0373945_0490370 3300035116 Unclassified 547
407 Ga0373953_0150285 3300035117 Unclassified 998
408 Ga0373954_0216781 3300035118 Bacteria 941
409 Ga0373956_0356808 3300035119 Unclassified 697
410 Ga0373957_0418233 3300035120 Unclassified 578
411 Ga0373943_0022632 3300035170 Bacteria 2915
412 Ga0373943_0052633 3300035170 Bacteria 2008
413 Ga0373943_0105217 3300035170 Unclassified 1481
414 Ga0373943_0338681 3300035170 Unclassified 860
415 Ga0373946_0119110 3300035171 Bacteria 1203
416 Ga0373946_0627740 3300035171 Unclassified 559
417 Ga0373955_0017614 3300035172 Bacteria 3539
418 Ga0373955_0230532 3300035172 Bacteria 1108
419 Ga0373955_0592942 3300035172 Unclassified 678
420 Ga0373931_0696088 3300035691 Unclassified 671
421 Ga0373935_0023971 3300035692 Unclassified 3751
422 Ga0373935_0074414 3300035692 Bacteria 2196
423 Ga0373927_0118698 3300035695 Bacteria 1726
424 Ga0373927_0643137 3300035695 Unclassified 701
425 Ga0373933_0237275 3300035724 Bacteria 1172
426 Ga0373933_0455639 3300035724 Unclassified 837
427 Ga0373933_0989438 3300035724 Unclassified 554
428 Ga0373947_0062870 3300035725 Unclassified 2260
429 Ga0373947_0257228 3300035725 Bacteria 1156
430 Ga0373947_0264510 3300035725 Bacteria 1140
431 Ga0373947_0974747 3300035725 Unclassified 578
432 Ga0373937_0160500 3300036401 Bacteria 2107
433 Ga0373937_0478108 3300036401 Unclassified 1183
434 Ga0373937_0591132 3300036401 Bacteria 1054
435 Ga0373925_0169337 3300037068 Bacteria 1724
436 Ga0373925_0222616 3300037068 Bacteria 1507
437 Ga0373925_1090675 3300037068 Unclassified 657
438 Ga0373925_1393484 3300037068 Unclassified 574
439 Ga0395899_0022448 3300037312 Bacteria 4786
440 Ga0395899_0118347 3300037312 Bacteria 1900
441 Ga0395900_0003229 3300037418 Bacteria 17656
442 Ga0395900_0394144 3300037418 Bacteria 1350
443 Ga0395900_0454842 3300037418 Bacteria 1236
444 Ga0395900_1118074 3300037418 Unclassified 705
445 Ga0395898_0013011 3300037466 Bacteria 8577
446 Ga0395898_1972031 3300037466 Unclassified 503
447 Ga0395905_0196930 3300037471 Bacteria 1889
448 Ga0395905_0774538 3300037471 Unclassified 862
449 Ga0395905_1502340 3300037471 Unclassified 578
450 Ga0436364_0314395 3300037853 Bacteria 860
451 Ga0395901_0009691 3300038443 Bacteria 9769
452 Ga0395901_0169366 3300038443 Unclassified 2292
453 Ga0395901_0866844 3300038443 Bacteria 887
454 Ga0436365_1041806 3300039437 Bacteria 1787
455 Ga0436365_1553827 3300039437 Unclassified 2169
456 Ga0436365_1814206 3300039437 Bacteria 4500
457 Ga0436362_1088089 3300039453 Bacteria 569
458 Ga0451789_0118864 3300041443 Unclassified 703
459 Ga0451802_1858742 3300041460 Unclassified 585
460 Ga0451807_0485362 3300041486 Bacteria 709
461 Ga0451807_1347153 3300041486 Unclassified 1112
462 Ga0451853_3701655 3300041512 Bacteria 1221
463 Ga0439443_102195 3300042003 Unclassified 550
464 Ga0439450_092665 3300042008 Bacteria 760
465 Ga0439451_073908 3300042009 Bacteria 683
466 Ga0439454_005879 3300042011 Bacteria 1485
467 Ga0439456_141529 3300042013 Unclassified 558
468 Ga0439458_0194602 3300042157 Unclassified 553
469 Ga0439460_0021227 3300042461 Bacteria 1773
470 Ga0439460_0100411 3300042461 Bacteria 929
471 Ga0439460_0344709 3300042461 Bacteria 525
472 Ga0450893_0107990 3300042532 Bacteria 572
473 Ga0439440_0169405 3300042993 Unclassified 634
474 Ga0451576_0081187 3300045051 Bacteria 3372
475 Ga0451576_0689696 3300045051 Unclassified 1073
476 Ga0451576_0728725 3300045051 Unclassified 1042
477 Ga0466967_0173121 3300045976 Bacteria 2032
478 Ga0466967_0345721 3300045976 Bacteria 1439
479 Ga0495592_0068725 3300046454 Unclassified 2585
480 Ga0495592_0189178 3300046454 Unclassified 1396
481 Ga0495590_0413178 3300046457 Bacteria 519
482 Ga0495629_0196920 3300046459 Unclassified 1393
483 Ga0495641_0112655 3300046461 Unclassified 1214
484 Ga0495651_0117255 3300046462 Bacteria 1960
485 Ga0495651_0240421 3300046462 Bacteria 1242
486 Ga0495651_0844532 3300046462 Unclassified 563
487 Ga0495651_0950725 3300046462 Unclassified 523
488 Ga0495653_0271399 3300046463 Bacteria 1117
489 Ga0495653_0388788 3300046463 Bacteria 889
490 Ga0495653_0547918 3300046463 Unclassified 716
491 Ga0495653_0935263 3300046463 Unclassified 515
492 Ga0495582_0018551 3300046473 Bacteria 3804
493 Ga0495582_0386236 3300046473 Unclassified 807
494 Ga0495639_0014674 3300046475 Bacteria 3394
495 Ga0495662_0282764 3300046476 Unclassified 817
496 Ga0495664_0432792 3300046477 Unclassified 789
497 Ga0495594_0552134 3300046499 Unclassified 654
498 Ga0495608_0135829 3300046511 Bacteria 1572
499 Ga0495618_0071332 3300046514 Unclassified 2210
500 Ga0495618_0225455 3300046514 Unclassified 1181
501 Ga0495628_0017332 3300046516 Bacteria 5997
502 Ga0495628_0145408 3300046516 Unclassified 1807
503 Ga0495630_0194999 3300046517 Bacteria 1545
504 Ga0495652_0239233 3300046529 Unclassified 1352
505 Ga0495640_0807143 3300046533 Unclassified 559
506 Ga0495586_0172963 3300046535 Unclassified 1220
507 Ga0495586_0244981 3300046535 Unclassified 1022
508 Ga0495621_0113418 3300046539 Unclassified 1041
509 Ga0495597_0400960 3300046542 Bacteria 522
510 Ga0495645_0022313 3300046543 Bacteria 4578
511 Ga0495645_0905886 3300046543 Unclassified 523
512 Ga0495634_0115451 3300046642 Bacteria 1723
513 Ga0495634_0515476 3300046642 Unclassified 700
514 Ga0495635_0180884 3300046663 Bacteria 1433
515 Ga0495635_0210731 3300046663 Bacteria 1316
516 Ga0495635_0696898 3300046663 Unclassified 659
517 Ga0495657_0075637 3300046675 Bacteria 2189
518 Ga0495599_0026353 3300046678 Bacteria 3642
519 Ga0495599_0249872 3300046678 Unclassified 1080
520 Ga0495623_0061849 3300046679 Bacteria 2347
521 Ga0495646_0071363 3300046680 Unclassified 2043
522 Ga0495646_0386311 3300046680 Unclassified 729
523 Ga0495658_0749190 3300046683 Unclassified 626
524 Ga0495669_0097832 3300046684 Bacteria 1361
525 Ga0495669_0576928 3300046684 Unclassified 547
526 Ga0495613_0273258 3300046689 Unclassified 1175
527 Ga0495613_0541272 3300046689 Unclassified 780
528 Ga0495624_0501462 3300046690 Unclassified 726
529 Ga0495624_0835630 3300046690 Unclassified 544
530 Ga0495670_0202072 3300046691 Unclassified 1053
531 Ga0495600_0439450 3300046809 Unclassified 808
532 Ga0495581_0042823 3300047315 Bacteria 2620
533 Ga0495604_0080507 3300047317 Bacteria 2440
534 Ga0495604_0268522 3300047317 Unclassified 1157
535 Ga0495604_1048445 3300047317 Unclassified 502
536 Ga0495674_0072861 3300047319 Bacteria 2962
537 Ga0495674_0221910 3300047319 Bacteria 1562
538 Ga0495674_0940354 3300047319 Unclassified 665
539 Ga0495676_0274199 3300047321 Unclassified 1144
540 Ga0495680_0270032 3300047322 Bacteria 1201
541 Ga0495675_0079449 3300047444 Bacteria 2066
542 Ga0495684_0011055 3300047471 Bacteria 6978
543 Ga0495684_0055215 3300047471 Bacteria 3029
544 Ga0495602_0415370 3300048088 Unclassified 956
545 Ga0496100_0028555 3300048903 Bacteria 3442
546 Ga0496100_0613234 3300048903 Bacteria 846
547 Ga0496101_0613854 3300048904 Unclassified 860
548 Ga0496101_0902498 3300048904 Bacteria 696
549 Ga0496102_0153208 3300048905 Bacteria 2167
550 Ga0496102_0276961 3300048905 Bacteria 1581
551 Ga0496102_0967746 3300048905 Bacteria 772
552 Ga0496102_1280977 3300048905 Bacteria 652
553 Ga0496103_0297143 3300048906 Unclassified 1039
554 Ga0496103_0333693 3300048906 Bacteria 975
555 Ga0496103_0947864 3300048906 Unclassified 538
556 Ga0496104_0057889 3300048907 Bacteria 3668
557 Ga0496104_0076185 3300048907 Bacteria 3195
558 Ga0496104_0174226 3300048907 Unclassified 2062
559 Ga0496104_0384092 3300048907 Bacteria 1317
560 Ga0496105_0027127 3300048908 Bacteria 4676
561 Ga0496105_0105288 3300048908 Bacteria 2329
562 Ga0496105_0124602 3300048908 Bacteria 2124
563 Ga0496106_0385551 3300048909 Bacteria 1126
564 Ga0496106_0473465 3300048909 Unclassified 1006
565 Ga0496106_0668943 3300048909 Bacteria 829
566 Ga0496107_0155587 3300048910 Bacteria 1692
567 Ga0496107_0329014 3300048910 Unclassified 1137
568 Ga0496108_0007830 3300048911 Bacteria 8659
569 Ga0496108_0123064 3300048911 Bacteria 2226
570 Ga0496108_0165673 3300048911 Bacteria 1911
571 Ga0496108_0235097 3300048911 Bacteria 1594
572 Ga0496108_1706183 3300048911 Unclassified 518
573 Ga0496109_0020560 3300048912 Bacteria 5830
574 Ga0496109_0113981 3300048912 Bacteria 2515
575 Ga0496109_0631805 3300048912 Bacteria 1007
576 Ga0496109_0722817 3300048912 Bacteria 933
577 Ga0496110_0456272 3300048913 Bacteria 1165
578 Ga0496110_0992307 3300048913 Bacteria 747
579 Ga0496112_0075159 3300048915 Bacteria 3342
580 Ga0496112_0106218 3300048915 Unclassified 2777
581 Ga0496112_0351130 3300048915 Bacteria 1417
582 Ga0496112_0412501 3300048915 Unclassified 1290
583 Ga0496112_1345883 3300048915 Unclassified 629
584 Ga0496113_0046236 3300048916 Bacteria 3231
585 Ga0496113_0115512 3300048916 Bacteria 2094
586 Ga0496113_0166841 3300048916 Bacteria 1743
587 Ga0496114_0045338 3300048917 Bacteria 3652
588 Ga0496114_0123586 3300048917 Unclassified 2228
589 Ga0496114_0376695 3300048917 Bacteria 1256
590 Ga0496114_0895690 3300048917 Unclassified 768
591 Ga0496115_0004435 3300048918 Bacteria 10173
592 Ga0496115_0050669 3300048918 Bacteria 3327
593 Ga0496115_0095551 3300048918 Unclassified 2433
594 Ga0496115_0105226 3300048918 Bacteria 2316
595 Ga0496115_0598695 3300048918 Unclassified 877
596 nmdc:mga05p37_1396094_c1 3300050507 Bacteria 706
597 nmdc:mga05p37_156514_c1 3300050507 Bacteria 2784
598 nmdc:mga05p37_17694_c1 3300050507 Bacteria 8599
599 nmdc:mga05p37_686477_c1 3300050507 Bacteria 1140
600 nmdc:mga08y16_517878_c1 3300050511 Bacteria 1210
601 nmdc:mga08y16_782818_c1 3300050511 Unclassified 948
602 nmdc:mga0n895_371648_c1 3300050512 Bacteria 1447
603 nmdc:mga0n895_762462_c1 3300050512 Bacteria 960
604 nmdc:mga0n895_972391_c1 3300050512 Unclassified 831
605 nmdc:mga08x19_318528_c1 3300050514 Bacteria 1082
606 nmdc:mga0a205_201719_c1 3300050515 Bacteria 1879
607 nmdc:mga0a205_506861_c1 3300050515 Bacteria 1063
608 nmdc:mga0a205_929221_c1 3300050515 Unclassified 717
609 Ga0495601_0006303 3300053077 Bacteria 6929
610 Ga0495612_0106717 3300053078 Unclassified 1196
611 Ga0495655_0327381 3300053083 Unclassified 532
612 Ga0495595_0262332 3300053084 Unclassified 866
613 Ga0495619_0598595 3300053085 Unclassified 754
614 Ga0495619_1191881 3300053085 Unclassified 504
615 nmdc:mga08x19_306953_c1
616 SwRhRL2b_contig_487712
617 JGI25405J52794_10001154
618 JGI25405J52794_10114037
619 Ga0065714_10261922
620 Ga0065704_10115402
621 Ga0065704_10696436
622 Ga0065712_10003065
623 Ga0065712_10010801
624 Ga0065712_10037007
625 Ga0065712_10081269
626 Ga0065712_10158908
627 Ga0065712_10270745
628 Ga0065712_10540651
629 Ga0065715_10016501
630 Ga0065715_10021146
631 Ga0065715_10052240
632 Ga0065715_10091525
633 Ga0065715_10324687
634 Ga0065715_10372717
635 Ga0065715_10577688
636 Ga0065715_10836330
637 Ga0065715_11041566
638 Ga0065707_10067356
639 Ga0065707_10075781
640 Ga0065707_10215638
641 Ga0065707_10243477
642 Ga0065707_10259383
643 Ga0070676_10085172
644 Ga0070676_11051733
645 Ga0070683_101486798
646 Ga0070690_100646375
647 Ga0070670_100339960
648 Ga0070670_101449333
649 Ga0068869_100359995
650 Ga0068869_100383853
651 Ga0070680_100219233
652 Ga0070682_100300714
653 Ga0068868_100097921
654 Ga0068868_101307261
655 Ga0070660_100057421
656 Ga0070660_100735156
657 Ga0070660_101113105
658 Ga0070689_100087900
659 Ga0070689_100327029
660 Ga0070689_101357518
661 Ga0070687_100174912
662 Ga0070687_100595681
663 Ga0070661_100152481
664 Ga0070668_100037400
665 Ga0070668_101842434
666 Ga0070669_100009942
667 Ga0070675_100010797
668 Ga0070675_100026530
669 Ga0070675_100182827
670 Ga0070675_100514618
671 Ga0070675_101387309
672 Ga0070671_100389905
673 Ga0070671_100442229
674 Ga0070671_100704107
675 Ga0070671_100800582
676 Ga0070671_101332223
677 Ga0070674_102066612
678 Ga0070673_100113473
679 Ga0070688_100002376
680 Ga0070688_100018766
681 Ga0070688_100211578
682 Ga0070688_100456199
683 Ga0070659_100007384
684 Ga0070659_100061699
685 Ga0070659_100756088
686 Ga0070659_102092515
687 Ga0070667_100168843
688 Ga0070667_100822872
689 Ga0070703_10033710
690 Ga0070703_10175429
691 Ga0070709_10052815
692 Ga0070714_100095258
693 Ga0070713_100067358
694 Ga0070713_100320294
695 Ga0070713_101850290
696 Ga0070710_10088599
697 Ga0070710_10160255
698 Ga0070710_10467498
699 Ga0070710_11082467
700 Ga0070701_10230075
701 Ga0070711_100719774
702 Ga0070705_100014916
703 Ga0070705_100438717
704 Ga0070700_100070627
705 Ga0070694_100106175
706 Ga0070694_101966160
707 Ga0070708_100002881
708 Ga0070708_100006600
709 Ga0070708_100034509
710 Ga0070708_100102832
711 Ga0070708_100112692
712 Ga0070708_100224520
713 Ga0070708_100356893
714 Ga0070708_100405283
715 Ga0070708_101512084
716 Ga0070708_101921046
717 Ga0070662_100026771
718 Ga0070662_100076944
719 Ga0070662_100383282
720 Ga0070662_100936906
721 Ga0070681_10338346
722 Ga0070706_100020713
723 Ga0070706_100101456
724 Ga0070706_100170449
725 Ga0070706_100336723
726 Ga0070706_100414643
727 Ga0070706_100921693
728 Ga0070706_101060489
729 Ga0070707_100000846
730 Ga0070707_100023714
731 Ga0070707_100026907
732 Ga0070707_100043665
733 Ga0070707_100108398
734 Ga0070707_100110748
735 Ga0070707_100185506
736 Ga0070707_100211197
737 Ga0070707_100219458
738 Ga0070707_100811188
739 Ga0070707_100837756
740 Ga0070707_101173691
741 Ga0070707_101540407
742 Ga0070698_100005905
743 Ga0070698_100007983
744 Ga0070698_100038467
745 Ga0070698_100060761
746 Ga0070698_100620749
747 Ga0070698_101980476
748 Ga0070699_100178700
749 Ga0070699_100244776
750 Ga0070699_100335856
751 Ga0070699_100791394
752 Ga0070699_101294833
753 Ga0070699_102117501
754 Ga0070679_100298551
755 Ga0070684_100001535
756 Ga0070684_100706982
757 Ga0070697_100000863
758 Ga0070697_100003442
759 Ga0070697_100006005
760 Ga0070697_100078405
761 Ga0070697_100088819
762 Ga0070697_100129616
763 Ga0070697_100160611
764 Ga0070697_101240437
765 Ga0068853_101004612
766 Ga0070672_101199276
767 Ga0070672_101246800
768 Ga0070672_101364844
769 Ga0070686_100614975
770 Ga0070695_101833327
771 Ga0070696_100898244
772 Ga0070665_100010897
773 Ga0070665_100104721
774 Ga0070665_100995071
775 Ga0070665_101187115
776 Ga0070665_101201219
777 Ga0070665_102271227
778 Ga0070704_100029226
779 Ga0070704_100178755
780 Ga0070704_102271317
781 Ga0070664_100184162
782 Ga0068856_100400304
783 Ga0068856_102076137
784 Ga0070702_100205983
785 Ga0070702_100258861
786 Ga0070702_100748357
787 Ga0070702_101692201
788 Ga0068852_100305516
789 Ga0068866_10230084
790 Ga0068861_100376412
791 Ga0068860_100178221
792 Ga0068862_100723345
793 Ga0081455_10001494
794 Ga0081455_10022426
795 Ga0081455_10053897
796 Ga0081455_10174088
797 Ga0081455_10334206
798 Ga0081540_1000380
799 Ga0081540_1064732
800 Ga0081539_10158384
801 Ga0081539_10423627
802 Ga0070717_10155762
803 Ga0070717_10175171
804 Ga0070717_10186488
805 Ga0070717_10606153
806 Ga0070717_11397563
807 Ga0070716_100125331
808 Ga0070716_100619223
809 Ga0070716_100965445
810 Ga0070716_101808088
811 Ga0070712_100032854
812 Ga0070712_100256451
813 Ga0070712_100738290
814 Ga0070712_101340385
815 Ga0070712_101580262
816 Ga0070712_102036898
817 Ga0070712_102060315
818 Ga0097621_100115074
819 Ga0068871_100050156
820 Ga0068871_100479285
821 Ga0075428_100554172
822 Ga0075428_101772363
823 Ga0075433_10528133
824 Ga0075434_100194802
825 Ga0075434_101019057
826 Ga0068865_101597682
827 Ga0099794_10196661
828 Ga0099794_10716498
829 Ga0099795_10062080
830 Ga0099795_10083267
831 Ga0105240_10093626
832 Ga0111539_10172553
833 Ga0111539_12666383
834 Ga0105245_10577690
835 Ga0114129_10010111
836 Ga0114129_10156788
837 Ga0114129_10246469
838 Ga0114129_10611255
839 Ga0114129_11821284
840 Ga0105243_10237903
841 Ga0105241_12292380
842 Ga0105242_11561918
843 Ga0105248_10358801
844 Ga0105248_13175556
845 Ga0105237_10081858
846 Ga0105237_11268000
847 Ga0105249_10016016
848 Ga0105249_10029932
849 Ga0105249_12767848
850 Ga0099796_10155600
851 Ga0099796_10174592
852 Ga0099796_10250069
853 Ga0099796_10267643
854 Ga0105239_10018427
855 Ga0105239_10043040
856 Ga0105239_10252267
857 Ga0105239_10544229
858 Ga0105239_11756252
859 Ga0105239_11937639
860 Ga0157373_10429337
861 Ga0157371_10293055
862 Ga0157369_12106001
863 Ga0157374_10023552
864 Ga0157374_10270384
865 Ga0157374_10352414
866 Ga0157374_10903727
867 Ga0157374_11227863
868 Ga0157374_11333724
869 Ga0157378_10046740
870 Ga0157378_10145847
871 Ga0157378_10170697
872 Ga0157378_10529362
873 Ga0157378_10905908
874 Ga0157378_11141190
875 Ga0157378_12073430
876 Ga0163162_10037100
877 Ga0163162_10357245
878 Ga0163162_10457022
879 Ga0163162_12274418
880 Ga0163162_12318103
881 Ga0163162_12376097
882 Ga0157372_10035116
883 Ga0157372_10037590
884 Ga0157372_10047250
885 Ga0157372_10069362
886 Ga0157375_10012538
887 Ga0157375_10887077
888 Ga0157375_11406091
889 Ga0163163_10020210
890 Ga0163163_10076329
891 Ga0163163_10475055
892 Ga0163163_10959083
893 Ga0182008_10051368
894 Ga0157379_11184939
895 Ga0157379_11547687
896 Ga0157376_10068193
897 Ga0157376_10254816
898 Ga0157376_10354181
899 Ga0157376_10919156
900 Ga0157376_11546037
901 Ga0182005_1039644
902 Ga0182005_1242087
903 Ga0213876_10034520
904 Ga0213875_10272061
905 Ga0207666_1006881
906 Ga0207673_1015008
907 Ga0207673_1058380
908 Ga0207697_10000352
909 Ga0207697_10000984
910 Ga0207697_10008894
911 Ga0207697_10043893
912 Ga0207653_10011216
913 Ga0207653_10301072
914 Ga0207692_10381767
915 Ga0207692_10734699
916 Ga0207699_10326926
917 Ga0207645_10002352
918 Ga0207684_10091117
919 Ga0207684_10102665
920 Ga0207684_10124274
921 Ga0207684_10136460
922 Ga0207684_10141273
923 Ga0207684_10262327
924 Ga0207684_10265424
925 Ga0207707_11634818
926 Ga0207693_10009706
927 Ga0207693_10099688
928 Ga0207693_10182158
929 Ga0207693_10215765
930 Ga0207693_10264377
931 Ga0207693_10466570
932 Ga0207693_10771592
933 Ga0207693_10881654
934 Ga0207693_11128873
935 Ga0207663_10075043
936 Ga0207663_11130730
937 Ga0207660_10036583
938 Ga0207662_10000559
939 Ga0207662_10158114
940 Ga0207657_10054614
941 Ga0207657_10508929
942 Ga0207649_10110147
943 Ga0207646_10000386
944 Ga0207646_10000411
945 Ga0207646_10025706
946 Ga0207646_10116310
947 Ga0207646_10131976
948 Ga0207646_10321363
949 Ga0207646_10721865
950 Ga0207646_10722031
951 Ga0207646_11916180
952 Ga0207681_10008691
953 Ga0207650_10142698
954 Ga0207659_10024917
955 Ga0207659_10269917
956 Ga0207659_10673300
957 Ga0207687_10354404
958 Ga0207700_10566486
959 Ga0207700_10723298
960 Ga0207664_10332748
961 Ga0207664_10947590
962 Ga0207644_10345690
963 Ga0207644_10444074
964 Ga0207706_10020606
965 Ga0207706_10181266
966 Ga0207706_10393162
967 Ga0207706_11458394
968 Ga0207709_10394944
969 Ga0207670_10072101
970 Ga0207670_10383361
971 Ga0207670_11367454
972 Ga0207669_10462446
973 Ga0207704_11034311
974 Ga0207665_10043972
975 Ga0207665_10159437
976 Ga0207665_10243822
977 Ga0207665_10344080
978 Ga0207665_10349040
979 Ga0207665_11042338
980 Ga0207691_10020547
981 Ga0207691_11317320
982 Ga0207689_10027373
983 Ga0207689_11062998
984 Ga0207661_10062817
985 Ga0207661_10870082
986 Ga0207679_10089516
987 Ga0207679_10750489
988 Ga0207651_12162204
989 Ga0207712_10032945
990 Ga0207712_10519845
991 Ga0207668_10012259
992 Ga0207668_10187839
993 Ga0207658_10010561
994 Ga0207677_10135326
995 Ga0207677_10250140
996 Ga0207703_11706732
997 Ga0207678_10131206
998 Ga0207708_10045187
999 Ga0207708_10489060
1000 Ga0207702_10102127
1001 Ga0207702_10713244
1002 Ga0207674_11579530
1003 Ga0207675_100431104
1004 Ga0207675_101640686
1005 Ga0207683_10246174
1006 Ga0209179_1134659
1007 Ga0209999_1082629
1008 Ga0209974_10040023
1009 Ga0209974_10141539
1010 Ga0207428_11171727
1011 Ga0268266_10075111
1012 Ga0268266_10225494
1013 Ga0268266_11246919
1014 Ga0268264_10189533
1015 Ga0268264_10240021
1016 Ga0307513_10138609
1017 Ga0373938_0191752
1018 Ga0373934_0156425
1019 Ga0373944_0357255
1020 Ga0373945_0490370
1021 Ga0373953_0150285
1022 Ga0373954_0216781
1023 Ga0373956_0356808
1024 Ga0373957_0418233
1025 Ga0373943_0022632
1026 Ga0373943_0052633
1027 Ga0373943_0105217
1028 Ga0373943_0338681
1029 Ga0373946_0119110
1030 Ga0373946_0627740
1031 Ga0373955_0017614
1032 Ga0373955_0230532
1033 Ga0373955_0592942
1034 Ga0373931_0696088
1035 Ga0373935_0023971
1036 Ga0373935_0074414
1037 Ga0373927_0118698
1038 Ga0373927_0643137
1039 Ga0373933_0237275
1040 Ga0373933_0455639
1041 Ga0373933_0989438
1042 Ga0373947_0062870
1043 Ga0373947_0257228
1044 Ga0373947_0264510
1045 Ga0373947_0974747
1046 Ga0373937_0160500
1047 Ga0373937_0478108
1048 Ga0373937_0591132
1049 Ga0373925_0169337
1050 Ga0373925_0222616
1051 Ga0373925_1090675
1052 Ga0373925_1393484
1053 Ga0395899_0022448
1054 Ga0395899_0118347
1055 Ga0395900_0003229
1056 Ga0395900_0394144
1057 Ga0395900_0454842
1058 Ga0395900_1118074
1059 Ga0395898_0013011
1060 Ga0395898_1972031
1061 Ga0395905_0196930
1062 Ga0395905_0774538
1063 Ga0395905_1502340
1064 Ga0436364_0314395
1065 Ga0395901_0009691
1066 Ga0395901_0169366
1067 Ga0395901_0866844
1068 Ga0436365_1041806
1069 Ga0436365_1553827
1070 Ga0436365_1814206
1071 Ga0436362_1088089
1072 Ga0451789_0118864
1073 Ga0451802_1858742
1074 Ga0451807_0485362
1075 Ga0451807_1347153
1076 Ga0451853_3701655
1077 Ga0439443_102195
1078 Ga0439450_092665
1079 Ga0439451_073908
1080 Ga0439454_005879
1081 Ga0439456_141529
1082 Ga0439458_0194602
1083 Ga0439460_0021227
1084 Ga0439460_0100411
1085 Ga0439460_0344709
1086 Ga0450893_0107990
1087 Ga0439440_0169405
1088 Ga0451576_0081187
1089 Ga0451576_0689696
1090 Ga0451576_0728725
1091 Ga0466967_0173121
1092 Ga0466967_0345721
1093 Ga0495592_0068725
1094 Ga0495592_0189178
1095 Ga0495590_0413178
1096 Ga0495629_0196920
1097 Ga0495641_0112655
1098 Ga0495651_0117255
1099 Ga0495651_0240421
1100 Ga0495651_0844532
1101 Ga0495651_0950725
1102 Ga0495653_0271399
1103 Ga0495653_0388788
1104 Ga0495653_0547918
1105 Ga0495653_0935263
1106 Ga0495582_0018551
1107 Ga0495582_0386236
1108 Ga0495639_0014674
1109 Ga0495662_0282764
1110 Ga0495664_0432792
1111 Ga0495594_0552134
1112 Ga0495608_0135829
1113 Ga0495618_0071332
1114 Ga0495618_0225455
1115 Ga0495628_0017332
1116 Ga0495628_0145408
1117 Ga0495630_0194999
1118 Ga0495652_0239233
1119 Ga0495640_0807143
1120 Ga0495586_0172963
1121 Ga0495586_0244981
1122 Ga0495621_0113418
1123 Ga0495597_0400960
1124 Ga0495645_0022313
1125 Ga0495645_0905886
1126 Ga0495634_0115451
1127 Ga0495634_0515476
1128 Ga0495635_0180884
1129 Ga0495635_0210731
1130 Ga0495635_0696898
1131 Ga0495657_0075637
1132 Ga0495599_0026353
1133 Ga0495599_0249872
1134 Ga0495623_0061849
1135 Ga0495646_0071363
1136 Ga0495646_0386311
1137 Ga0495658_0749190
1138 Ga0495669_0097832
1139 Ga0495669_0576928
1140 Ga0495613_0273258
1141 Ga0495613_0541272
1142 Ga0495624_0501462
1143 Ga0495624_0835630
1144 Ga0495670_0202072
1145 Ga0495600_0439450
1146 Ga0495581_0042823
1147 Ga0495604_0080507
1148 Ga0495604_0268522
1149 Ga0495604_1048445
1150 Ga0495674_0072861
1151 Ga0495674_0221910
1152 Ga0495674_0940354
1153 Ga0495676_0274199
1154 Ga0495680_0270032
1155 Ga0495675_0079449
1156 Ga0495684_0011055
1157 Ga0495684_0055215
1158 Ga0495602_0415370
1159 Ga0496100_0028555
1160 Ga0496100_0613234
1161 Ga0496101_0613854
1162 Ga0496101_0902498
1163 Ga0496102_0153208
1164 Ga0496102_0276961
1165 Ga0496102_0967746
1166 Ga0496102_1280977
1167 Ga0496103_0297143
1168 Ga0496103_0333693
1169 Ga0496103_0947864
1170 Ga0496104_0057889
1171 Ga0496104_0076185
1172 Ga0496104_0174226
1173 Ga0496104_0384092
1174 Ga0496105_0027127
1175 Ga0496105_0105288
1176 Ga0496105_0124602
1177 Ga0496106_0385551
1178 Ga0496106_0473465
1179 Ga0496106_0668943
1180 Ga0496107_0155587
1181 Ga0496107_0329014
1182 Ga0496108_0007830
1183 Ga0496108_0123064
1184 Ga0496108_0165673
1185 Ga0496108_0235097
1186 Ga0496108_1706183
1187 Ga0496109_0020560
1188 Ga0496109_0113981
1189 Ga0496109_0631805
1190 Ga0496109_0722817
1191 Ga0496110_0456272
1192 Ga0496110_0992307
1193 Ga0496112_0075159
1194 Ga0496112_0106218
1195 Ga0496112_0351130
1196 Ga0496112_0412501
1197 Ga0496112_1345883
1198 Ga0496113_0046236
1199 Ga0496113_0115512
1200 Ga0496113_0166841
1201 Ga0496114_0045338
1202 Ga0496114_0123586
1203 Ga0496114_0376695
1204 Ga0496114_0895690
1205 Ga0496115_0004435
1206 Ga0496115_0050669
1207 Ga0496115_0095551
1208 Ga0496115_0105226
1209 Ga0496115_0598695
1210 nmdc:mga05p37_1396094_c1
1211 nmdc:mga05p37_156514_c1
1212 nmdc:mga05p37_17694_c1
1213 nmdc:mga05p37_686477_c1
1214 nmdc:mga08y16_517878_c1
1215 nmdc:mga08y16_782818_c1
1216 nmdc:mga0n895_371648_c1
1217 nmdc:mga0n895_762462_c1
1218 nmdc:mga0n895_972391_c1
1219 nmdc:mga08x19_318528_c1
1220 nmdc:mga0a205_201719_c1
1221 nmdc:mga0a205_506861_c1
1222 nmdc:mga0a205_929221_c1
1223 Ga0495601_0006303
1224 Ga0495612_0106717
1225 Ga0495655_0327381
1226 Ga0495595_0262332
1227 Ga0495619_0598595
1228 Ga0495619_1191881

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5svb-assembly1.cif.gz_F mechanism of atp-dependent acetone carboxylation, acetone carboxylase amp bound structure 0.7741 24 56
5m45-assembly2.cif.gz_L structure of acetone carboxylase purified from xanthobacter autotrophicus 0.7536 24 56
8ifj-assembly5.cif.gz_J crystal structure of pyrrolysyl-trna synthetase from methanogenic archaeon iso4-g1 0.7536 23 56
6y2r-assembly1.cif.gz_A escherichia coli r255a rnla endoribonuclease (single alanine mutant of rnla) 0.7406 25 58
4gak-assembly1.cif.gz_A-2 crystal structure of acyl-acp thioesterase from spirosoma linguale 0.7391 25 56
ID Description Score Start End Superfamily
af_I1JH63_227_471_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8395 25 56 2.130.10.10
af_A0A0R0IJU0_61_261_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8259 26 56 2.130.10.10
af_Q9LZY2_79_203_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.804 24 56 3.30.310.50
af_B4FKW7_103_359_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7872 21 56 2.130.10.10
af_A0A1D6FSG1_60_366_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7784 21 56 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2D6EQI5-F1-model_v4 Cytoplasmic protein 0.9309 10 56
AF-A0A1G1GJJ1-F1-model_v4 Cytoplasmic protein 0.924 9 56
AF-A0A534VUK5-F1-model_v4 Cytoplasmic protein 0.9213 10 56
AF-A0A7C3PA55-F1-model_v4 Cytoplasmic protein 0.92 9 56
AF-A0A330L4I8-F1-model_v4 Cytoplasmic protein 0.9009 2 56

Map