F469395

General Info

Members Datasets Scaffolds Average Seq Length
614 312 1228 202

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0442149|Ga0501038_0442149_38_772
Length 237
Sequence VRLRRALDRLLRRPTGARAGSGAGPGVEIDPAGEQVEEMTNEPTEVWLVVGLGNPGPSYAGHRHNVGHLVTAELAERMGSPFRAHKSGRADVVEGRLTPPGTPGPRVVLARTRTYMNESGGAVKQLATFYKVPPERIIAIHDELDIPFDTMRVKLGGGDNGHNGLRSLRGALGTGDFYRVRVGIGRPPGRQDPADYVLSDYTAAERKLLPLQVSTAADAVESLVTEGLERTQARFNS

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
73 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
134 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
135 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
157 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
162 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
163 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
164 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
165 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
166 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
172 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
277 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
282 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
283 2643221576 Nocardioides sp. Root614 Isolate Unclassified
284 2643221590 Nocardioides sp. Root682 Isolate Unclassified
285 2643221604 Nocardioides sp. Root190 Isolate Unclassified
286 2643221613 Oerskovia sp. Root22 Isolate Unclassified
287 2643221615 Nocardioides sp. Root224 Isolate Unclassified
288 2643221617 Nocardioides sp. Root79 Isolate Unclassified
289 2643221620 Nocardioides sp. Root240 Isolate Unclassified
290 2643221641 Nocardioides sp. Root122 Isolate Unclassified
291 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
292 2643221679 Angustibacter sp. Root456 Isolate Unclassified
293 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
294 2643221721 Oerskovia sp. Root918 Isolate Unclassified
295 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
296 2739367898 Nocardioides sp. CF479 Isolate Unclassified
297 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
298 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
299 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
300 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
301 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
302 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
303 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
304 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
305 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
306 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
307 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
308 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
309 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
310 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
311 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
312 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.35
Metatranscriptomes 2.61
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.84
Nodule 0.16
Rhizoplane 11.24
Rhizosphere 76.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0442149 3300049574 Bacteria 1001
2 JGI24740J21852_10012233 3300001979 Bacteria 3240
3 JGI24740J21852_10020624 3300001979 Bacteria 2296
4 JGI24739J22299_10011240 3300001989 Bacteria 3307
5 JGI24739J22299_10068564 3300001989 Bacteria 1107
6 Ga0055542_1002973 3300003762 Bacteria 4953
7 Ga0065714_10077927 3300005288 Bacteria 2630
8 Ga0070658_10006983 3300005327 Bacteria 9121
9 Ga0070658_10008777 3300005327 Bacteria 8121
10 Ga0070658_10547133 3300005327 Bacteria 1002
11 Ga0070658_10790891 3300005327 Bacteria 824
12 Ga0070683_100002341 3300005329 Bacteria 15036
13 Ga0070683_100004946 3300005329 Bacteria 11055
14 Ga0070683_100418749 3300005329 Bacteria 1278
15 Ga0070690_100494730 3300005330 Bacteria 914
16 Ga0070677_10085758 3300005333 Bacteria 1359
17 Ga0068869_100130787 3300005334 Bacteria 1929
18 Ga0070666_10438417 3300005335 Bacteria 942
19 Ga0070680_100316307 3300005336 Bacteria 1325
20 Ga0070682_100007778 3300005337 Bacteria 6038
21 Ga0070682_100064545 3300005337 Bacteria 2324
22 Ga0070682_100438123 3300005337 Bacteria 998
23 Ga0068868_100024906 3300005338 Bacteria 4544
24 Ga0070660_100014130 3300005339 Bacteria 5748
25 Ga0070660_100027486 3300005339 Bacteria 4246
26 Ga0070689_100585499 3300005340 Bacteria 965
27 Ga0070689_100720960 3300005340 Bacteria 872
28 Ga0070661_100574852 3300005344 Bacteria 909
29 Ga0070692_10006071 3300005345 Bacteria 5214
30 Ga0070692_10011855 3300005345 Bacteria 4017
31 Ga0070675_100385593 3300005354 Bacteria 1248
32 Ga0070674_100228494 3300005356 Bacteria 1451
33 Ga0070674_100714763 3300005356 Bacteria 858
34 Ga0070673_101163383 3300005364 Bacteria 722
35 Ga0070688_100051832 3300005365 Bacteria 2561
36 Ga0070659_100032897 3300005366 Bacteria 4026
37 Ga0070659_100115459 3300005366 Bacteria 2170
38 Ga0070667_100151670 3300005367 Bacteria 2036
39 Ga0070667_100205394 3300005367 Bacteria 1749
40 Ga0070667_100213555 3300005367 Bacteria 1715
41 Ga0070701_10008530 3300005438 Bacteria 4440
42 Ga0070708_100332686 3300005445 Bacteria 1431
43 Ga0070663_100116990 3300005455 Bacteria 2010
44 Ga0070663_100416215 3300005455 Bacteria 1102
45 Ga0070678_100116710 3300005456 Bacteria 2098
46 Ga0070678_100185415 3300005456 Bacteria 1707
47 Ga0070678_100236259 3300005456 Bacteria 1526
48 Ga0070678_101291257 3300005456 Bacteria 679
49 Ga0068867_100029377 3300005459 Bacteria 3960
50 Ga0070685_10417077 3300005466 Bacteria 933
51 Ga0070698_100021743 3300005471 Bacteria 6717
52 Ga0070679_100467320 3300005530 Bacteria 1206
53 Ga0070679_100741705 3300005530 Bacteria 925
54 Ga0070684_100004150 3300005535 Bacteria 10972
55 Ga0070684_100033128 3300005535 Bacteria 4409
56 Ga0068853_100046505 3300005539 Bacteria 3721
57 Ga0070672_100095602 3300005543 Bacteria 2403
58 Ga0070672_100297701 3300005543 Bacteria 1367
59 Ga0070686_100237991 3300005544 Bacteria 1324
60 Ga0070696_100018780 3300005546 Bacteria 4678
61 Ga0070665_100000606 3300005548 Bacteria 49390
62 Ga0070665_100058485 3300005548 Bacteria 3864
63 Ga0070665_100441504 3300005548 Bacteria 1311
64 Ga0070664_100088574 3300005564 Bacteria 2676
65 Ga0070664_100242271 3300005564 Bacteria 1619
66 Ga0068856_100509104 3300005614 Bacteria 1225
67 Ga0070702_100171986 3300005615 Bacteria 1410
68 Ga0070702_100458390 3300005615 Bacteria 926
69 Ga0068852_100005828 3300005616 Bacteria 8847
70 Ga0068852_100216446 3300005616 Bacteria 1820
71 Ga0068864_100020083 3300005618 Bacteria 5587
72 Ga0068864_100713867 3300005618 Bacteria 980
73 Ga0068866_10023332 3300005718 Bacteria 2877
74 Ga0068861_100048865 3300005719 Bacteria 3200
75 Ga0068851_10164311 3300005834 Bacteria 1221
76 Ga0068870_10017216 3300005840 Bacteria 3468
77 Ga0068870_10045277 3300005840 Bacteria 2303
78 Ga0068870_10260000 3300005840 Bacteria 1080
79 Ga0068858_100055974 3300005842 Bacteria 3646
80 Ga0068860_100120149 3300005843 Bacteria 2516
81 Ga0068862_100407013 3300005844 Bacteria 1274
82 Ga0081455_10058641 3300005937 Bacteria 3255
83 Ga0075365_10001661 3300006038 Bacteria 10271
84 Ga0075365_10001879 3300006038 Bacteria 9889
85 Ga0075365_10053958 3300006038 Bacteria 2664
86 Ga0075365_10352613 3300006038 Bacteria 1037
87 Ga0075365_10496544 3300006038 Bacteria 862
88 Ga0075365_10695173 3300006038 Bacteria 718
89 Ga0075368_10000755 3300006042 Bacteria 9915
90 Ga0075363_100006643 3300006048 Bacteria 5271
91 Ga0075364_10003491 3300006051 Bacteria 8949
92 Ga0075364_10034131 3300006051 Bacteria 3280
93 Ga0075364_10121381 3300006051 Bacteria 1749
94 Ga0075364_10228859 3300006051 Bacteria 1263
95 Ga0075364_10525638 3300006051 Bacteria 809
96 Ga0075367_10002239 3300006178 Bacteria 8741
97 Ga0097621_100365009 3300006237 Bacteria 1287
98 Ga0075370_10005014 3300006353 Bacteria 6515
99 Ga0075428_100961192 3300006844 Bacteria 905
100 Ga0075431_100718742 3300006847 Bacteria 976
101 Ga0075429_100074524 3300006880 Bacteria 2956
102 Ga0111539_10102121 3300009094 Bacteria 3366
103 Ga0111539_11149425 3300009094 Bacteria 902
104 Ga0105245_10001197 3300009098 Bacteria 23470
105 Ga0105245_10013078 3300009098 Bacteria 7230
106 Ga0105245_10112865 3300009098 Bacteria 2530
107 Ga0114129_10839778 3300009147 Bacteria 1169
108 Ga0105243_10005660 3300009148 Bacteria 9724
109 Ga0105243_10028270 3300009148 Bacteria 4303
110 Ga0105243_10072819 3300009148 Bacteria 2782
111 Ga0105243_10833767 3300009148 Bacteria 912
112 Ga0105242_10097067 3300009176 Bacteria 2491
113 Ga0105242_10107776 3300009176 Bacteria 2370
114 Ga0105242_11085005 3300009176 Bacteria 814
115 Ga0105248_10132406 3300009177 Bacteria 2813
116 Ga0105248_10142789 3300009177 Bacteria 2701
117 Ga0105238_10166563 3300009551 Bacteria 2179
118 Ga0105238_10169945 3300009551 Bacteria 2156
119 Ga0105238_10761935 3300009551 Bacteria 982
120 Ga0105249_10099583 3300009553 Bacteria 2732
121 Ga0105249_10549672 3300009553 Bacteria 1205
122 Ga0105239_10001341 3300010375 Bacteria 33185
123 Ga0105239_10125024 3300010375 Bacteria 2858
124 Ga0105239_10135735 3300010375 Bacteria 2739
125 Ga0105239_10377508 3300010375 Bacteria 1603
126 Ga0105246_10001074 3300011119 Bacteria 15790
127 Ga0105246_10247828 3300011119 Bacteria 1412
128 Ga0105246_10390475 3300011119 Bacteria 1153
129 Ga0157322_1003593 3300012490 Bacteria 959
130 Ga0157313_1016160 3300012503 Bacteria 710
131 Ga0157371_10338040 3300013102 Bacteria 1095
132 Ga0157370_11084420 3300013104 Bacteria 724
133 Ga0157378_10725738 3300013297 Bacteria 1015
134 Ga0163162_10355027 3300013306 Bacteria 1599
135 Ga0163162_11443268 3300013306 Bacteria 783
136 Ga0157372_10002413 3300013307 Bacteria 20232
137 Ga0157372_10303659 3300013307 Bacteria 1857
138 Ga0157372_10348283 3300013307 Bacteria 1726
139 Ga0157372_10587569 3300013307 Bacteria 1298
140 Ga0157372_10714650 3300013307 Bacteria 1166
141 Ga0157372_11625346 3300013307 Bacteria 744
142 Ga0157375_10054251 3300013308 Bacteria 3947
143 Ga0157375_10265303 3300013308 Bacteria 1879
144 Ga0157375_10533564 3300013308 Bacteria 1336
145 Ga0157375_10781492 3300013308 Bacteria 1104
146 Ga0163163_10226706 3300014325 Bacteria 1917
147 Ga0163163_10591933 3300014325 Bacteria 1172
148 Ga0163163_10619740 3300014325 Bacteria 1145
149 Ga0157380_10286609 3300014326 Bacteria 1510
150 Ga0157380_10592238 3300014326 Bacteria 1095
151 Ga0157380_10879707 3300014326 Bacteria 920
152 Ga0157377_10049561 3300014745 Bacteria 2361
153 Ga0157377_10087470 3300014745 Bacteria 1834
154 Ga0157377_10482308 3300014745 Bacteria 863
155 Ga0157379_10070517 3300014968 Bacteria 3126
156 Ga0157376_10179509 3300014969 Bacteria 1934
157 Ga0157376_10413331 3300014969 Bacteria 1307
158 Ga0157376_10503587 3300014969 Bacteria 1191
159 Ga0163161_10199130 3300017792 Bacteria 1543
160 Ga0163161_10300485 3300017792 Bacteria 1264
161 Ga0163161_10383642 3300017792 Bacteria 1124
162 Ga0206355_1638430 3300020076 Bacteria 1584
163 Ga0206354_11058171 3300020081 Bacteria 2227
164 Ga0206353_10717811 3300020082 Bacteria 1943
165 Ga0206353_11275066 3300020082 Bacteria 10737
166 Ga0206353_11908677 3300020082 Bacteria 2819
167 Ga0154015_1578179 3300020610 Bacteria 1441
168 Ga0209148_1002946 3300025254 Bacteria 5156
169 Ga0207656_10185256 3300025321 Bacteria 1001
170 Ga0207642_10019038 3300025899 Bacteria 2649
171 Ga0207688_10070644 3300025901 Bacteria 1980
172 Ga0207688_10096616 3300025901 Bacteria 1702
173 Ga0207688_10422310 3300025901 Bacteria 829
174 Ga0207680_10235411 3300025903 Bacteria 1260
175 Ga0207647_10007079 3300025904 Bacteria 8137
176 Ga0207647_10053784 3300025904 Bacteria 2480
177 Ga0207643_10019980 3300025908 Bacteria 3674
178 Ga0207643_10061233 3300025908 Bacteria 2149
179 Ga0207643_10193844 3300025908 Bacteria 1234
180 Ga0207705_10152584 3300025909 Bacteria 1731
181 Ga0207705_10567721 3300025909 Bacteria 882
182 Ga0207707_10616593 3300025912 Bacteria 917
183 Ga0207671_10723461 3300025914 Bacteria 791
184 Ga0207657_10070936 3300025919 Bacteria 2951
185 Ga0207652_10005990 3300025921 Bacteria 9836
186 Ga0207652_10285550 3300025921 Bacteria 1489
187 Ga0207652_10636286 3300025921 Bacteria 955
188 Ga0207652_10831599 3300025921 Bacteria 819
189 Ga0207687_10000975 3300025927 Bacteria 19466
190 Ga0207644_10367146 3300025931 Bacteria 1172
191 Ga0207644_10509067 3300025931 Bacteria 994
192 Ga0207690_10020386 3300025932 Bacteria 4097
193 Ga0207690_10147553 3300025932 Bacteria 1740
194 Ga0207686_10028564 3300025934 Bacteria 3280
195 Ga0207686_10237749 3300025934 Bacteria 1324
196 Ga0207686_10241394 3300025934 Bacteria 1315
197 Ga0207709_10019706 3300025935 Bacteria 3797
198 Ga0207709_10549833 3300025935 Bacteria 908
199 Ga0207704_10064582 3300025938 Bacteria 2287
200 Ga0207704_10157422 3300025938 Bacteria 1612
201 Ga0207691_10056406 3300025940 Bacteria 3578
202 Ga0207691_10184428 3300025940 Bacteria 1822
203 Ga0207711_10090767 3300025941 Bacteria 2686
204 Ga0207711_10531205 3300025941 Bacteria 1097
205 Ga0207689_10121423 3300025942 Bacteria 2149
206 Ga0207689_10233425 3300025942 Bacteria 1520
207 Ga0207661_10033929 3300025944 Bacteria 3964
208 Ga0207661_10161869 3300025944 Bacteria 1942
209 Ga0207661_10163546 3300025944 Bacteria 1932
210 Ga0207679_10039966 3300025945 Bacteria 3354
211 Ga0207679_10409392 3300025945 Bacteria 1194
212 Ga0207679_11033656 3300025945 Bacteria 753
213 Ga0207712_10238268 3300025961 Bacteria 1464
214 Ga0207668_10086534 3300025972 Bacteria 2290
215 Ga0207640_10101279 3300025981 Bacteria 2020
216 Ga0207658_10014306 3300025986 Bacteria 5434
217 Ga0207658_10359018 3300025986 Bacteria 1271
218 Ga0207658_10738088 3300025986 Bacteria 891
219 Ga0207677_10616986 3300026023 Bacteria 953
220 Ga0207703_10384978 3300026035 Bacteria 1298
221 Ga0207639_10148682 3300026041 Bacteria 1960
222 Ga0207639_10365257 3300026041 Bacteria 1293
223 Ga0207678_10058521 3300026067 Bacteria 3316
224 Ga0207678_10276631 3300026067 Bacteria 1440
225 Ga0207708_10120721 3300026075 Bacteria 2042
226 Ga0207708_10257278 3300026075 Bacteria 1408
227 Ga0207702_10068271 3300026078 Bacteria 3054
228 Ga0207702_10330043 3300026078 Bacteria 1455
229 Ga0207648_10019029 3300026089 Bacteria 6201
230 Ga0207676_10054202 3300026095 Bacteria 3142
231 Ga0207676_10222413 3300026095 Bacteria 1682
232 Ga0207674_10077304 3300026116 Bacteria 3334
233 Ga0207674_10348305 3300026116 Bacteria 1432
234 Ga0207675_100015567 3300026118 Bacteria 7094
235 Ga0207675_100323468 3300026118 Bacteria 1506
236 Ga0207675_100572595 3300026118 Bacteria 1130
237 Ga0207683_10227787 3300026121 Bacteria 1699
238 Ga0207683_10312795 3300026121 Bacteria 1438
239 Ga0207683_10882838 3300026121 Bacteria 830
240 Ga0207683_10984044 3300026121 Bacteria 783
241 Ga0207698_10121329 3300026142 Bacteria 2213
242 Ga0207698_10173296 3300026142 Bacteria 1902
243 Ga0207698_10855393 3300026142 Bacteria 915
244 Ga0209813_10014234 3300027866 Bacteria 2139
245 Ga0268266_10000339 3300028379 Bacteria 73355
246 Ga0268266_10049149 3300028379 Bacteria 3616
247 Ga0268266_10052078 3300028379 Bacteria 3515
248 Ga0268265_10149910 3300028380 Bacteria 1966
249 Ga0268264_10099057 3300028381 Bacteria 2529
250 Ga0314311_1115994 3300030733 Bacteria 1369
251 Ga0316179_1059643 3300030734 Bacteria 7862
252 Ga0316181_1004558 3300030744 Bacteria 1853
253 Ga0316181_1290401 3300030744 Bacteria 1405
254 Ga0307513_10053179 3300031456 Bacteria 4355
255 Ga0307513_10246378 3300031456 Bacteria 1587
256 Ga0307516_10229463 3300031730 Bacteria 1561
257 Ga0307405_10335075 3300031731 Bacteria 1161
258 Ga0307413_10746730 3300031824 Bacteria 817
259 Ga0307413_11188363 3300031824 Bacteria 663
260 Ga0307410_10022295 3300031852 Bacteria 3911
261 Ga0307410_10600775 3300031852 Bacteria 918
262 Ga0307406_10286693 3300031901 Bacteria 1259
263 Ga0307407_10002099 3300031903 Bacteria 7644
264 Ga0307407_10375845 3300031903 Bacteria 1013
265 Ga0307412_10530296 3300031911 Bacteria 985
266 Ga0307409_100007425 3300031995 Bacteria 6555
267 Ga0307409_100013359 3300031995 Bacteria 5281
268 Ga0307409_100320139 3300031995 Bacteria 1451
269 Ga0307416_100615821 3300032002 Bacteria 1167
270 Ga0307411_10911211 3300032005 Bacteria 782
271 Ga0307415_100273923 3300032126 Bacteria 1384
272 Ga0307415_100623952 3300032126 Bacteria 963
273 Ga0373941_0053866 3300035115 Bacteria 1288
274 Ga0316574_0171341 3300035398 Bacteria 1397
275 Ga0395899_0460525 3300037312 Bacteria 831
276 Ga0395900_0013014 3300037418 Bacteria 8502
277 Ga0395898_0004220 3300037466 Bacteria 15749
278 Ga0395898_0555001 3300037466 Bacteria 1091
279 Ga0395898_0617714 3300037466 Bacteria 1026
280 Ga0395905_0266939 3300037471 Bacteria 1597
281 Ga0436364_0601870 3300037853 Bacteria 1354
282 Ga0395901_0022327 3300038443 Bacteria 6485
283 Ga0395901_0092752 3300038443 Bacteria 3161
284 Ga0395901_0446094 3300038443 Bacteria 1324
285 Ga0395901_0446455 3300038443 Bacteria 1323
286 Ga0395901_0594356 3300038443 Bacteria 1116
287 Ga0439438_021489 3300041405 Bacteria 1799
288 Ga0439447_020175 3300041407 Bacteria 1771
289 Ga0439465_0095342 3300041413 Bacteria 1022
290 Ga0451791_0367629 3300041451 Bacteria 7532
291 Ga0451793_1760822 3300041452 Bacteria 12096
292 Ga0451797_0009474 3300041453 Bacteria 2404
293 Ga0451795_0984346 3300041456 Bacteria 1366
294 Ga0451798_0992359 3300041458 Bacteria 1569
295 Ga0451802_1992058 3300041460 Bacteria 2065
296 Ga0451833_0001040 3300041491 Bacteria 912
297 Ga0451837_0073120 3300041494 Bacteria 2136
298 Ga0451839_0931637 3300041496 Bacteria 3150
299 Ga0451851_1295780 3300041507 Bacteria 700
300 Ga0451843_0552627 3300041509 Bacteria 1706
301 Ga0451853_0068405 3300041512 Bacteria 1722
302 Ga0451853_1568239 3300041512 Bacteria 782
303 Ga0451853_3364545 3300041512 Bacteria 5549
304 Ga0439431_0001100 3300041997 Bacteria 5862
305 Ga0450907_012966 3300042146 Bacteria 1388
306 Ga0439434_0006964 3300042435 Bacteria 3303
307 Ga0466969_0147541 3300044656 Bacteria 1085
308 Ga0466972_0012738 3300044658 Bacteria 4223
309 Ga0466965_0009968 3300044683 Bacteria 4420
310 Ga0466965_0069760 3300044683 Bacteria 1766
311 Ga0466965_0077074 3300044683 Bacteria 1683
312 Ga0466966_0002232 3300044684 Bacteria 12596
313 Ga0466966_0176475 3300044684 Bacteria 1297
314 Ga0466966_0408593 3300044684 Bacteria 816
315 Ga0466961_0031192 3300044693 Bacteria 3426
316 Ga0466963_0091333 3300044694 Bacteria 2074
317 Ga0466963_0133261 3300044694 Bacteria 1718
318 Ga0466963_0160892 3300044694 Bacteria 1562
319 Ga0466963_0299280 3300044694 Bacteria 1131
320 Ga0466964_0049049 3300044706 Bacteria 1728
321 Ga0466971_0054838 3300044719 Bacteria 1796
322 Ga0466971_0091734 3300044719 Bacteria 1391
323 Ga0466971_0121766 3300044719 Bacteria 1208
324 Ga0466968_0043669 3300044735 Bacteria 1899
325 Ga0466968_0079664 3300044735 Bacteria 1437
326 Ga0466970_0004715 3300044765 Bacteria 6733
327 Ga0466970_0011782 3300044765 Bacteria 4459
328 Ga0466970_0197478 3300044765 Bacteria 1119
329 Ga0466970_0227946 3300044765 Bacteria 1041
330 Ga0466957_0086798 3300044842 Bacteria 1955
331 Ga0466960_0001672 3300044901 Bacteria 8125
332 Ga0466960_0043179 3300044901 Bacteria 2143
333 Ga0466960_0088596 3300044901 Bacteria 1573
334 Ga0466960_0186812 3300044901 Bacteria 1126
335 Ga0466960_0672939 3300044901 Bacteria 619
336 Ga0466959_0065369 3300045049 Bacteria 2639
337 Ga0466959_0231391 3300045049 Bacteria 1279
338 Ga0451576_0186163 3300045051 Bacteria 2168
339 Ga0466958_0030192 3300045836 Bacteria 3217
340 Ga0466958_0225392 3300045836 Bacteria 1196
341 Ga0466958_0500838 3300045836 Bacteria 788
342 Ga0466967_0004034 3300045976 Bacteria 9796
343 Ga0466967_0036244 3300045976 Bacteria 4208
344 Ga0466967_0041142 3300045976 Bacteria 3982
345 Ga0466967_0048066 3300045976 Bacteria 3724
346 Ga0466967_0064983 3300045976 Bacteria 3246
347 Ga0466967_0071103 3300045976 Bacteria 3114
348 Ga0466967_0192089 3300045976 Bacteria 1930
349 Ga0466967_0332473 3300045976 Bacteria 1467
350 Ga0466967_0532229 3300045976 Bacteria 1155
351 Ga0495627_009109 3300046453 Bacteria 3666
352 Ga0495627_064663 3300046453 Bacteria 1076
353 Ga0495603_0014559 3300046455 Bacteria 4758
354 Ga0495603_0015645 3300046455 Bacteria 4590
355 Ga0495603_0042236 3300046455 Bacteria 2726
356 Ga0495603_0090766 3300046455 Bacteria 1786
357 Ga0495629_0028468 3300046459 Bacteria 3967
358 Ga0495629_0439612 3300046459 Bacteria 884
359 Ga0495605_0230240 3300046474 Bacteria 798
360 Ga0495585_0016493 3300046492 Bacteria 4280
361 Ga0495594_0046976 3300046499 Bacteria 2371
362 Ga0495644_0374680 3300046523 Bacteria 562
363 Ga0495622_0177535 3300046557 Bacteria 956
364 Ga0495622_0335732 3300046557 Bacteria 655
365 Ga0495668_0397028 3300046616 Bacteria 758
366 Ga0495625_0236807 3300046660 Bacteria 1190
367 Ga0495659_0153137 3300046664 Bacteria 927
368 Ga0495657_0275003 3300046675 Bacteria 1009
369 Ga0495658_0105125 3300046683 Bacteria 1691
370 Ga0495613_0002046 3300046689 Bacteria 15333
371 Ga0495600_0053470 3300046809 Bacteria 2638
372 Ga0495581_0138514 3300047315 Bacteria 1419
373 Ga0495676_0003194 3300047321 Bacteria 14809
374 Ga0495685_011792 3300047447 Bacteria 2955
375 Ga0495593_0033151 3300047673 Bacteria 2814
376 Ga0495614_0009974 3300048089 Bacteria 4192
377 Ga0496100_0497226 3300048903 Bacteria 939
378 Ga0496101_0002279 3300048904 Bacteria 11715
379 Ga0496101_0037283 3300048904 Bacteria 3448
380 Ga0496101_0362809 3300048904 Bacteria 1139
381 Ga0496101_0853700 3300048904 Bacteria 717
382 Ga0496102_0004783 3300048905 Bacteria 11457
383 Ga0496102_0008685 3300048905 Bacteria 8721
384 Ga0496102_0147222 3300048905 Bacteria 2211
385 Ga0496102_0290238 3300048905 Bacteria 1542
386 Ga0496103_0091386 3300048906 Bacteria 1921
387 Ga0496103_0290125 3300048906 Bacteria 1052
388 Ga0496104_0003236 3300048907 Bacteria 14024
389 Ga0496104_0659864 3300048907 Bacteria 955
390 Ga0496104_0820387 3300048907 Bacteria 836
391 Ga0496105_0002891 3300048908 Bacteria 12594
392 Ga0496105_0075963 3300048908 Bacteria 2774
393 Ga0496105_0101748 3300048908 Bacteria 2373
394 Ga0496105_0180866 3300048908 Bacteria 1727
395 Ga0496106_0003302 3300048909 Bacteria 12032
396 Ga0496106_0023140 3300048909 Bacteria 4615
397 Ga0496106_0055184 3300048909 Bacteria 3002
398 Ga0496106_0119469 3300048909 Bacteria 2059
399 Ga0496106_0825247 3300048909 Bacteria 735
400 Ga0496106_0830818 3300048909 Bacteria 732
401 Ga0496107_0010526 3300048910 Bacteria 6427
402 Ga0496107_0081450 3300048910 Bacteria 2361
403 Ga0496107_0251492 3300048910 Bacteria 1315
404 Ga0496107_0563268 3300048910 Bacteria 843
405 Ga0496108_0004950 3300048911 Bacteria 10766
406 Ga0496108_0078393 3300048911 Bacteria 2796
407 Ga0496108_0101068 3300048911 Bacteria 2460
408 Ga0496108_0143223 3300048911 Bacteria 2060
409 Ga0496108_0167239 3300048911 Bacteria 1902
410 Ga0496108_0237598 3300048911 Bacteria 1585
411 Ga0496108_0305575 3300048911 Bacteria 1386
412 Ga0496108_0455757 3300048911 Bacteria 1117
413 Ga0496108_0593533 3300048911 Bacteria 965
414 Ga0496108_0870201 3300048911 Bacteria 775
415 Ga0496109_0035217 3300048912 Bacteria 4514
416 Ga0496109_0072140 3300048912 Bacteria 3171
417 Ga0496109_0095488 3300048912 Bacteria 2753
418 Ga0496109_0207828 3300048912 Bacteria 1841
419 Ga0496109_0436409 3300048912 Bacteria 1237
420 Ga0496109_0695997 3300048912 Bacteria 954
421 Ga0496110_0004658 3300048913 Bacteria 10665
422 Ga0496110_0015561 3300048913 Bacteria 6335
423 Ga0496110_0040125 3300048913 Bacteria 4080
424 Ga0496110_0198172 3300048913 Bacteria 1824
425 Ga0496111_0000445 3300048914 Bacteria 21022
426 Ga0496111_0052115 3300048914 Bacteria 2954
427 Ga0496111_0099747 3300048914 Bacteria 2133
428 Ga0496111_0472035 3300048914 Bacteria 925
429 Ga0496113_0023963 3300048916 Bacteria 4333
430 Ga0496114_0012364 3300048917 Bacteria 6830
431 Ga0496114_0038487 3300048917 Bacteria 3957
432 Ga0496114_0087471 3300048917 Bacteria 2642
433 Ga0496114_0115706 3300048917 Bacteria 2301
434 Ga0496114_0178109 3300048917 Bacteria 1856
435 Ga0496114_0324125 3300048917 Bacteria 1361
436 Ga0496114_0329043 3300048917 Bacteria 1351
437 Ga0496114_0736731 3300048917 Bacteria 862
438 Ga0496115_0004962 3300048918 Bacteria 9666
439 Ga0496115_0155631 3300048918 Bacteria 1888
440 Ga0496118_0033332 3300048921 Bacteria 4228
441 Ga0496126_0036899 3300048929 Bacteria 4566
442 Ga0501306_026927 3300049127 Bacteria 835
443 Ga0501309_007958 3300049129 Bacteria 1324
444 Ga0501305_033203 3300049161 Bacteria 813
445 Ga0501305_040962 3300049161 Bacteria 753
446 Ga0501307_032963 3300049162 Bacteria 726
447 Ga0501311_005359 3300049527 Bacteria 1404
448 Ga0501312_023664 3300049528 Bacteria 926
449 Ga0501317_009894 3300049533 Bacteria 1129
450 Ga0501318_006519 3300049534 Bacteria 1194
451 Ga0501321_001372 3300049537 Bacteria 1918
452 Ga0501031_0016784 3300049568 Bacteria 4756
453 Ga0501031_0181159 3300049568 Bacteria 1376
454 Ga0501031_0295945 3300049568 Bacteria 1049
455 Ga0501031_0325219 3300049568 Bacteria 996
456 Ga0501031_0352050 3300049568 Bacteria 953
457 Ga0501032_0000979 3300049569 Bacteria 23099
458 Ga0501032_0008023 3300049569 Bacteria 7696
459 Ga0501032_0224573 3300049569 Bacteria 1222
460 Ga0501034_0103923 3300049571 Bacteria 2834
461 Ga0501034_0155678 3300049571 Bacteria 2259
462 Ga0501034_0269759 3300049571 Bacteria 1643
463 Ga0501034_0523235 3300049571 Bacteria 1098
464 Ga0501036_0037705 3300049572 Bacteria 4089
465 Ga0501036_0117853 3300049572 Bacteria 2243
466 Ga0501036_0142234 3300049572 Bacteria 2024
467 Ga0501036_0603074 3300049572 Bacteria 911
468 Ga0501037_0004167 3300049573 Bacteria 10484
469 Ga0501037_0154466 3300049573 Bacteria 1639
470 Ga0501037_0175091 3300049573 Bacteria 1524
471 Ga0501038_0001575 3300049574 Bacteria 21127
472 Ga0501038_0005029 3300049574 Bacteria 12281
473 Ga0501038_0190064 3300049574 Bacteria 1653
474 Ga0501038_0419576 3300049574 Bacteria 1033
475 Ga0501039_0006688 3300049575 Bacteria 8766
476 Ga0501039_0188907 3300049575 Bacteria 1620
477 Ga0501039_0200319 3300049575 Bacteria 1570
478 Ga0501039_0229699 3300049575 Bacteria 1459
479 Ga0501039_0238528 3300049575 Bacteria 1430
480 Ga0501041_0202109 3300049577 Bacteria 1246
481 Ga0501042_0144878 3300049578 Bacteria 1713
482 Ga0501042_0220601 3300049578 Bacteria 1368
483 Ga0501042_0547110 3300049578 Bacteria 841
484 Ga0501043_0004270 3300049579 Bacteria 11637
485 Ga0501043_0016979 3300049579 Bacteria 5706
486 Ga0501043_0056592 3300049579 Bacteria 3080
487 Ga0501043_0530054 3300049579 Bacteria 877
488 Ga0501046_0000862 3300049580 Bacteria 29490
489 Ga0501046_0002697 3300049580 Bacteria 16521
490 Ga0501046_0346820 3300049580 Bacteria 1078
491 Ga0501047_0152323 3300049581 Bacteria 2187
492 Ga0501047_0240702 3300049581 Bacteria 1660
493 Ga0501047_0297051 3300049581 Bacteria 1458
494 Ga0501048_0019702 3300049582 Bacteria 4947
495 Ga0501048_0664852 3300049582 Bacteria 748
496 Ga0501067_0002023 3300049583 Bacteria 11183
497 Ga0501067_0002257 3300049583 Bacteria 10632
498 Ga0501067_0028818 3300049583 Bacteria 3078
499 Ga0501067_0083337 3300049583 Bacteria 1774
500 Ga0501067_0344514 3300049583 Bacteria 830
501 Ga0501067_0535172 3300049583 Bacteria 656
502 Ga0501068_0012839 3300049584 Bacteria 4757
503 Ga0501068_0063830 3300049584 Bacteria 2240
504 Ga0501069_0065288 3300049585 Bacteria 2035
505 Ga0501069_0086622 3300049585 Bacteria 1768
506 Ga0501069_0182805 3300049585 Bacteria 1212
507 Ga0501070_0001826 3300049586 Bacteria 18754
508 Ga0501070_0024172 3300049586 Bacteria 5095
509 Ga0501070_0084914 3300049586 Bacteria 2621
510 Ga0501070_0373119 3300049586 Bacteria 1156
511 Ga0501070_0713818 3300049586 Bacteria 792
512 Ga0501071_0003531 3300049587 Bacteria 9783
513 Ga0501071_0083759 3300049587 Bacteria 2336
514 Ga0501071_0227395 3300049587 Bacteria 1405
515 Ga0501071_0236721 3300049587 Bacteria 1376
516 Ga0501071_0517937 3300049587 Bacteria 915
517 Ga0501072_0029418 3300049588 Bacteria 4291
518 Ga0501073_0003986 3300049589 Bacteria 11083
519 Ga0501073_0038917 3300049589 Bacteria 3371
520 Ga0501073_0049858 3300049589 Bacteria 2935
521 Ga0501073_0067981 3300049589 Bacteria 2484
522 Ga0501074_0001928 3300049590 Bacteria 14262
523 Ga0501074_0044342 3300049590 Bacteria 3219
524 Ga0501074_0073731 3300049590 Bacteria 2452
525 Ga0501074_0119705 3300049590 Bacteria 1883
526 Ga0501074_0130817 3300049590 Bacteria 1795
527 Ga0501074_0170149 3300049590 Bacteria 1555
528 Ga0501074_0343529 3300049590 Bacteria 1059
529 Ga0501076_0359166 3300049592 Bacteria 1197
530 Ga0501079_0062469 3300049741 Bacteria 2873
531 Ga0501079_0402803 3300049741 Bacteria 1073
532 Ga0501080_0010959 3300049742 Bacteria 8297
533 Ga0501080_0035647 3300049742 Bacteria 4643
534 Ga0501080_0545885 3300049742 Bacteria 1033
535 Ga0501081_0748229 3300049743 Bacteria 734
536 Ga0501083_0010562 3300049744 Bacteria 6499
537 Ga0501083_0027023 3300049744 Bacteria 3963
538 Ga0501035_0007240 3300049822 Bacteria 10383
539 Ga0501035_0649016 3300049822 Bacteria 856
540 Ga0501044_0005928 3300049823 Bacteria 13541
541 Ga0501044_0097790 3300049823 Bacteria 2956
542 Ga0501044_0110543 3300049823 Bacteria 2757
543 Ga0501044_0552390 3300049823 Bacteria 1048
544 Ga0501045_0214681 3300049824 Bacteria 1433
545 Ga0501045_0379866 3300049824 Bacteria 1052
546 Ga0501045_0436998 3300049824 Bacteria 973
547 Ga0501045_0446288 3300049824 Bacteria 962
548 nmdc:mga03683_12816_c1 3300050489 Bacteria 3070
549 nmdc:mga03n38_16246_c1 3300050490 Bacteria 2893
550 nmdc:mga03n38_5415_c1 3300050490 Bacteria 4345
551 nmdc:mga03n38_5988_c1 3300050490 Bacteria 4191
552 nmdc:mga00v17_142950_c1 3300050491 Bacteria 1535
553 nmdc:mga00v17_77720_c1 3300050491 Bacteria 2067
554 nmdc:mga00v17_96432_c1 3300050491 Bacteria 1863
555 nmdc:mga0yw44_11665_c1 3300050492 Bacteria 4549
556 nmdc:mga0yw44_204625_c1 3300050492 Bacteria 1304
557 nmdc:mga0yw44_210284_c1 3300050492 Bacteria 1287
558 nmdc:mga0yw44_261272_c1 3300050492 Bacteria 1154
559 nmdc:mga0yw44_283166_c1 3300050492 Bacteria 1108
560 nmdc:mga0yw44_353024_c1 3300050492 Bacteria 990
561 nmdc:mga0yw44_39544_c1 3300050492 Bacteria 2798
562 nmdc:mga0yw44_48178_c1 3300050492 Bacteria 2569
563 nmdc:mga06z11_211351_c1 3300050494 Bacteria 1131
564 nmdc:mga06z11_391716_c1 3300050494 Bacteria 835
565 nmdc:mga04h51_10266_c1 3300050495 Bacteria 2568
566 nmdc:mga07m45_17352_c1 3300050496 Bacteria 3865
567 nmdc:mga07m45_2442_c1 3300050496 Bacteria 8724
568 nmdc:mga09592_21517_c1 3300050508 Bacteria 5314
569 nmdc:mga06r32_19000_c1 3300050510 Bacteria 6301
570 Ga0495619_0385026 3300053085 Bacteria 969
571 Ga0495619_0457292 3300053085 Bacteria 880
572 Ga0500644_0000093 3300053088 Bacteria 55990
573 Ga0500556_0000476 3300053104 Bacteria 27975
574 Ga0500593_000182 3300053117 Bacteria 25634
575 Ga0500573_0036006 3300053140 Bacteria 2857
576 Ga0501084_0016035 3300054114 Bacteria 6218
577 Ga0501084_0254818 3300054114 Bacteria 1481
578 Ga0501084_0906769 3300054114 Bacteria 741
579 Ga0501082_0006770 3300060353 Bacteria 9903
580 Ga0501082_0060054 3300060353 Bacteria 3275
581 Ga0501082_0141222 3300060353 Bacteria 2090
582 Ga0466962_0085151 3300061719 Bacteria 1513
583 Ga0530510_0409683 3300061734 Bacteria 1023
584 2585300159 2582581312 Bacteria 7308206
585 2643890282 2643221576 Bacteria 5214352
586 2643959338 2643221590 Bacteria 5214697
587 2644033210 2643221604 Bacteria 5014917
588 2644080680 2643221613 Bacteria 4622396
589 2644091214 2643221615 Bacteria 5487866
590 2644098273 2643221617 Bacteria 5139111
591 2644119000 2643221620 Bacteria 5134593
592 2644228798 2643221641 Bacteria 4490190
593 2644321017 2643221657 Bacteria 5490246
594 2644446837 2643221679 Bacteria 3839507
595 2644505002 2643221690 Bacteria 4654705
596 2644664003 2643221721 Bacteria 4486924
597 2729907162 2728369276 Bacteria 5610032
598 2740166241 2739367898 Bacteria 4367674
599 2760625428 2758568621 Bacteria 5967089
600 2774396519 2773857762 Bacteria 5971770
601 2809198185 2808606439 Bacteria 5952208
602 2812353143 2811994878 Bacteria 5992952
603 2857483304 2857481737 Bacteria 4761446
604 2887447105 2887443736 Bacteria 4426037
605 2891969229 2891968417 Bacteria 5821697
606 2919052867 2919051321 Bacteria 4210889
607 2932433727 2932431166 Bacteria 4215299
608 2935893153 2935890801 Bacteria 4593001
609 2946063525 2946059875 Bacteria 4386623
610 8004022816 8004021418 Bacteria 4313954
611 8004028859 8004025490 Bacteria 4327753
612 8033685415 8033684223 Bacteria 6906479
613 8054610087 8054609563 Bacteria 5170090
614 8056581219 8056579771 Bacteria 5840325
615 Ga0501038_0442149
616 JGI24740J21852_10012233
617 JGI24740J21852_10020624
618 JGI24739J22299_10011240
619 JGI24739J22299_10068564
620 Ga0055542_1002973
621 Ga0065714_10077927
622 Ga0070658_10006983
623 Ga0070658_10008777
624 Ga0070658_10547133
625 Ga0070658_10790891
626 Ga0070683_100002341
627 Ga0070683_100004946
628 Ga0070683_100418749
629 Ga0070690_100494730
630 Ga0070677_10085758
631 Ga0068869_100130787
632 Ga0070666_10438417
633 Ga0070680_100316307
634 Ga0070682_100007778
635 Ga0070682_100064545
636 Ga0070682_100438123
637 Ga0068868_100024906
638 Ga0070660_100014130
639 Ga0070660_100027486
640 Ga0070689_100585499
641 Ga0070689_100720960
642 Ga0070661_100574852
643 Ga0070692_10006071
644 Ga0070692_10011855
645 Ga0070675_100385593
646 Ga0070674_100228494
647 Ga0070674_100714763
648 Ga0070673_101163383
649 Ga0070688_100051832
650 Ga0070659_100032897
651 Ga0070659_100115459
652 Ga0070667_100151670
653 Ga0070667_100205394
654 Ga0070667_100213555
655 Ga0070701_10008530
656 Ga0070708_100332686
657 Ga0070663_100116990
658 Ga0070663_100416215
659 Ga0070678_100116710
660 Ga0070678_100185415
661 Ga0070678_100236259
662 Ga0070678_101291257
663 Ga0068867_100029377
664 Ga0070685_10417077
665 Ga0070698_100021743
666 Ga0070679_100467320
667 Ga0070679_100741705
668 Ga0070684_100004150
669 Ga0070684_100033128
670 Ga0068853_100046505
671 Ga0070672_100095602
672 Ga0070672_100297701
673 Ga0070686_100237991
674 Ga0070696_100018780
675 Ga0070665_100000606
676 Ga0070665_100058485
677 Ga0070665_100441504
678 Ga0070664_100088574
679 Ga0070664_100242271
680 Ga0068856_100509104
681 Ga0070702_100171986
682 Ga0070702_100458390
683 Ga0068852_100005828
684 Ga0068852_100216446
685 Ga0068864_100020083
686 Ga0068864_100713867
687 Ga0068866_10023332
688 Ga0068861_100048865
689 Ga0068851_10164311
690 Ga0068870_10017216
691 Ga0068870_10045277
692 Ga0068870_10260000
693 Ga0068858_100055974
694 Ga0068860_100120149
695 Ga0068862_100407013
696 Ga0081455_10058641
697 Ga0075365_10001661
698 Ga0075365_10001879
699 Ga0075365_10053958
700 Ga0075365_10352613
701 Ga0075365_10496544
702 Ga0075365_10695173
703 Ga0075368_10000755
704 Ga0075363_100006643
705 Ga0075364_10003491
706 Ga0075364_10034131
707 Ga0075364_10121381
708 Ga0075364_10228859
709 Ga0075364_10525638
710 Ga0075367_10002239
711 Ga0097621_100365009
712 Ga0075370_10005014
713 Ga0075428_100961192
714 Ga0075431_100718742
715 Ga0075429_100074524
716 Ga0111539_10102121
717 Ga0111539_11149425
718 Ga0105245_10001197
719 Ga0105245_10013078
720 Ga0105245_10112865
721 Ga0114129_10839778
722 Ga0105243_10005660
723 Ga0105243_10028270
724 Ga0105243_10072819
725 Ga0105243_10833767
726 Ga0105242_10097067
727 Ga0105242_10107776
728 Ga0105242_11085005
729 Ga0105248_10132406
730 Ga0105248_10142789
731 Ga0105238_10166563
732 Ga0105238_10169945
733 Ga0105238_10761935
734 Ga0105249_10099583
735 Ga0105249_10549672
736 Ga0105239_10001341
737 Ga0105239_10125024
738 Ga0105239_10135735
739 Ga0105239_10377508
740 Ga0105246_10001074
741 Ga0105246_10247828
742 Ga0105246_10390475
743 Ga0157322_1003593
744 Ga0157313_1016160
745 Ga0157371_10338040
746 Ga0157370_11084420
747 Ga0157378_10725738
748 Ga0163162_10355027
749 Ga0163162_11443268
750 Ga0157372_10002413
751 Ga0157372_10303659
752 Ga0157372_10348283
753 Ga0157372_10587569
754 Ga0157372_10714650
755 Ga0157372_11625346
756 Ga0157375_10054251
757 Ga0157375_10265303
758 Ga0157375_10533564
759 Ga0157375_10781492
760 Ga0163163_10226706
761 Ga0163163_10591933
762 Ga0163163_10619740
763 Ga0157380_10286609
764 Ga0157380_10592238
765 Ga0157380_10879707
766 Ga0157377_10049561
767 Ga0157377_10087470
768 Ga0157377_10482308
769 Ga0157379_10070517
770 Ga0157376_10179509
771 Ga0157376_10413331
772 Ga0157376_10503587
773 Ga0163161_10199130
774 Ga0163161_10300485
775 Ga0163161_10383642
776 Ga0206355_1638430
777 Ga0206354_11058171
778 Ga0206353_10717811
779 Ga0206353_11275066
780 Ga0206353_11908677
781 Ga0154015_1578179
782 Ga0209148_1002946
783 Ga0207656_10185256
784 Ga0207642_10019038
785 Ga0207688_10070644
786 Ga0207688_10096616
787 Ga0207688_10422310
788 Ga0207680_10235411
789 Ga0207647_10007079
790 Ga0207647_10053784
791 Ga0207643_10019980
792 Ga0207643_10061233
793 Ga0207643_10193844
794 Ga0207705_10152584
795 Ga0207705_10567721
796 Ga0207707_10616593
797 Ga0207671_10723461
798 Ga0207657_10070936
799 Ga0207652_10005990
800 Ga0207652_10285550
801 Ga0207652_10636286
802 Ga0207652_10831599
803 Ga0207687_10000975
804 Ga0207644_10367146
805 Ga0207644_10509067
806 Ga0207690_10020386
807 Ga0207690_10147553
808 Ga0207686_10028564
809 Ga0207686_10237749
810 Ga0207686_10241394
811 Ga0207709_10019706
812 Ga0207709_10549833
813 Ga0207704_10064582
814 Ga0207704_10157422
815 Ga0207691_10056406
816 Ga0207691_10184428
817 Ga0207711_10090767
818 Ga0207711_10531205
819 Ga0207689_10121423
820 Ga0207689_10233425
821 Ga0207661_10033929
822 Ga0207661_10161869
823 Ga0207661_10163546
824 Ga0207679_10039966
825 Ga0207679_10409392
826 Ga0207679_11033656
827 Ga0207712_10238268
828 Ga0207668_10086534
829 Ga0207640_10101279
830 Ga0207658_10014306
831 Ga0207658_10359018
832 Ga0207658_10738088
833 Ga0207677_10616986
834 Ga0207703_10384978
835 Ga0207639_10148682
836 Ga0207639_10365257
837 Ga0207678_10058521
838 Ga0207678_10276631
839 Ga0207708_10120721
840 Ga0207708_10257278
841 Ga0207702_10068271
842 Ga0207702_10330043
843 Ga0207648_10019029
844 Ga0207676_10054202
845 Ga0207676_10222413
846 Ga0207674_10077304
847 Ga0207674_10348305
848 Ga0207675_100015567
849 Ga0207675_100323468
850 Ga0207675_100572595
851 Ga0207683_10227787
852 Ga0207683_10312795
853 Ga0207683_10882838
854 Ga0207683_10984044
855 Ga0207698_10121329
856 Ga0207698_10173296
857 Ga0207698_10855393
858 Ga0209813_10014234
859 Ga0268266_10000339
860 Ga0268266_10049149
861 Ga0268266_10052078
862 Ga0268265_10149910
863 Ga0268264_10099057
864 Ga0314311_1115994
865 Ga0316179_1059643
866 Ga0316181_1004558
867 Ga0316181_1290401
868 Ga0307513_10053179
869 Ga0307513_10246378
870 Ga0307516_10229463
871 Ga0307405_10335075
872 Ga0307413_10746730
873 Ga0307413_11188363
874 Ga0307410_10022295
875 Ga0307410_10600775
876 Ga0307406_10286693
877 Ga0307407_10002099
878 Ga0307407_10375845
879 Ga0307412_10530296
880 Ga0307409_100007425
881 Ga0307409_100013359
882 Ga0307409_100320139
883 Ga0307416_100615821
884 Ga0307411_10911211
885 Ga0307415_100273923
886 Ga0307415_100623952
887 Ga0373941_0053866
888 Ga0316574_0171341
889 Ga0395899_0460525
890 Ga0395900_0013014
891 Ga0395898_0004220
892 Ga0395898_0555001
893 Ga0395898_0617714
894 Ga0395905_0266939
895 Ga0436364_0601870
896 Ga0395901_0022327
897 Ga0395901_0092752
898 Ga0395901_0446094
899 Ga0395901_0446455
900 Ga0395901_0594356
901 Ga0439438_021489
902 Ga0439447_020175
903 Ga0439465_0095342
904 Ga0451791_0367629
905 Ga0451793_1760822
906 Ga0451797_0009474
907 Ga0451795_0984346
908 Ga0451798_0992359
909 Ga0451802_1992058
910 Ga0451833_0001040
911 Ga0451837_0073120
912 Ga0451839_0931637
913 Ga0451851_1295780
914 Ga0451843_0552627
915 Ga0451853_0068405
916 Ga0451853_1568239
917 Ga0451853_3364545
918 Ga0439431_0001100
919 Ga0450907_012966
920 Ga0439434_0006964
921 Ga0466969_0147541
922 Ga0466972_0012738
923 Ga0466965_0009968
924 Ga0466965_0069760
925 Ga0466965_0077074
926 Ga0466966_0002232
927 Ga0466966_0176475
928 Ga0466966_0408593
929 Ga0466961_0031192
930 Ga0466963_0091333
931 Ga0466963_0133261
932 Ga0466963_0160892
933 Ga0466963_0299280
934 Ga0466964_0049049
935 Ga0466971_0054838
936 Ga0466971_0091734
937 Ga0466971_0121766
938 Ga0466968_0043669
939 Ga0466968_0079664
940 Ga0466970_0004715
941 Ga0466970_0011782
942 Ga0466970_0197478
943 Ga0466970_0227946
944 Ga0466957_0086798
945 Ga0466960_0001672
946 Ga0466960_0043179
947 Ga0466960_0088596
948 Ga0466960_0186812
949 Ga0466960_0672939
950 Ga0466959_0065369
951 Ga0466959_0231391
952 Ga0451576_0186163
953 Ga0466958_0030192
954 Ga0466958_0225392
955 Ga0466958_0500838
956 Ga0466967_0004034
957 Ga0466967_0036244
958 Ga0466967_0041142
959 Ga0466967_0048066
960 Ga0466967_0064983
961 Ga0466967_0071103
962 Ga0466967_0192089
963 Ga0466967_0332473
964 Ga0466967_0532229
965 Ga0495627_009109
966 Ga0495627_064663
967 Ga0495603_0014559
968 Ga0495603_0015645
969 Ga0495603_0042236
970 Ga0495603_0090766
971 Ga0495629_0028468
972 Ga0495629_0439612
973 Ga0495605_0230240
974 Ga0495585_0016493
975 Ga0495594_0046976
976 Ga0495644_0374680
977 Ga0495622_0177535
978 Ga0495622_0335732
979 Ga0495668_0397028
980 Ga0495625_0236807
981 Ga0495659_0153137
982 Ga0495657_0275003
983 Ga0495658_0105125
984 Ga0495613_0002046
985 Ga0495600_0053470
986 Ga0495581_0138514
987 Ga0495676_0003194
988 Ga0495685_011792
989 Ga0495593_0033151
990 Ga0495614_0009974
991 Ga0496100_0497226
992 Ga0496101_0002279
993 Ga0496101_0037283
994 Ga0496101_0362809
995 Ga0496101_0853700
996 Ga0496102_0004783
997 Ga0496102_0008685
998 Ga0496102_0147222
999 Ga0496102_0290238
1000 Ga0496103_0091386
1001 Ga0496103_0290125
1002 Ga0496104_0003236
1003 Ga0496104_0659864
1004 Ga0496104_0820387
1005 Ga0496105_0002891
1006 Ga0496105_0075963
1007 Ga0496105_0101748
1008 Ga0496105_0180866
1009 Ga0496106_0003302
1010 Ga0496106_0023140
1011 Ga0496106_0055184
1012 Ga0496106_0119469
1013 Ga0496106_0825247
1014 Ga0496106_0830818
1015 Ga0496107_0010526
1016 Ga0496107_0081450
1017 Ga0496107_0251492
1018 Ga0496107_0563268
1019 Ga0496108_0004950
1020 Ga0496108_0078393
1021 Ga0496108_0101068
1022 Ga0496108_0143223
1023 Ga0496108_0167239
1024 Ga0496108_0237598
1025 Ga0496108_0305575
1026 Ga0496108_0455757
1027 Ga0496108_0593533
1028 Ga0496108_0870201
1029 Ga0496109_0035217
1030 Ga0496109_0072140
1031 Ga0496109_0095488
1032 Ga0496109_0207828
1033 Ga0496109_0436409
1034 Ga0496109_0695997
1035 Ga0496110_0004658
1036 Ga0496110_0015561
1037 Ga0496110_0040125
1038 Ga0496110_0198172
1039 Ga0496111_0000445
1040 Ga0496111_0052115
1041 Ga0496111_0099747
1042 Ga0496111_0472035
1043 Ga0496113_0023963
1044 Ga0496114_0012364
1045 Ga0496114_0038487
1046 Ga0496114_0087471
1047 Ga0496114_0115706
1048 Ga0496114_0178109
1049 Ga0496114_0324125
1050 Ga0496114_0329043
1051 Ga0496114_0736731
1052 Ga0496115_0004962
1053 Ga0496115_0155631
1054 Ga0496118_0033332
1055 Ga0496126_0036899
1056 Ga0501306_026927
1057 Ga0501309_007958
1058 Ga0501305_033203
1059 Ga0501305_040962
1060 Ga0501307_032963
1061 Ga0501311_005359
1062 Ga0501312_023664
1063 Ga0501317_009894
1064 Ga0501318_006519
1065 Ga0501321_001372
1066 Ga0501031_0016784
1067 Ga0501031_0181159
1068 Ga0501031_0295945
1069 Ga0501031_0325219
1070 Ga0501031_0352050
1071 Ga0501032_0000979
1072 Ga0501032_0008023
1073 Ga0501032_0224573
1074 Ga0501034_0103923
1075 Ga0501034_0155678
1076 Ga0501034_0269759
1077 Ga0501034_0523235
1078 Ga0501036_0037705
1079 Ga0501036_0117853
1080 Ga0501036_0142234
1081 Ga0501036_0603074
1082 Ga0501037_0004167
1083 Ga0501037_0154466
1084 Ga0501037_0175091
1085 Ga0501038_0001575
1086 Ga0501038_0005029
1087 Ga0501038_0190064
1088 Ga0501038_0419576
1089 Ga0501039_0006688
1090 Ga0501039_0188907
1091 Ga0501039_0200319
1092 Ga0501039_0229699
1093 Ga0501039_0238528
1094 Ga0501041_0202109
1095 Ga0501042_0144878
1096 Ga0501042_0220601
1097 Ga0501042_0547110
1098 Ga0501043_0004270
1099 Ga0501043_0016979
1100 Ga0501043_0056592
1101 Ga0501043_0530054
1102 Ga0501046_0000862
1103 Ga0501046_0002697
1104 Ga0501046_0346820
1105 Ga0501047_0152323
1106 Ga0501047_0240702
1107 Ga0501047_0297051
1108 Ga0501048_0019702
1109 Ga0501048_0664852
1110 Ga0501067_0002023
1111 Ga0501067_0002257
1112 Ga0501067_0028818
1113 Ga0501067_0083337
1114 Ga0501067_0344514
1115 Ga0501067_0535172
1116 Ga0501068_0012839
1117 Ga0501068_0063830
1118 Ga0501069_0065288
1119 Ga0501069_0086622
1120 Ga0501069_0182805
1121 Ga0501070_0001826
1122 Ga0501070_0024172
1123 Ga0501070_0084914
1124 Ga0501070_0373119
1125 Ga0501070_0713818
1126 Ga0501071_0003531
1127 Ga0501071_0083759
1128 Ga0501071_0227395
1129 Ga0501071_0236721
1130 Ga0501071_0517937
1131 Ga0501072_0029418
1132 Ga0501073_0003986
1133 Ga0501073_0038917
1134 Ga0501073_0049858
1135 Ga0501073_0067981
1136 Ga0501074_0001928
1137 Ga0501074_0044342
1138 Ga0501074_0073731
1139 Ga0501074_0119705
1140 Ga0501074_0130817
1141 Ga0501074_0170149
1142 Ga0501074_0343529
1143 Ga0501076_0359166
1144 Ga0501079_0062469
1145 Ga0501079_0402803
1146 Ga0501080_0010959
1147 Ga0501080_0035647
1148 Ga0501080_0545885
1149 Ga0501081_0748229
1150 Ga0501083_0010562
1151 Ga0501083_0027023
1152 Ga0501035_0007240
1153 Ga0501035_0649016
1154 Ga0501044_0005928
1155 Ga0501044_0097790
1156 Ga0501044_0110543
1157 Ga0501044_0552390
1158 Ga0501045_0214681
1159 Ga0501045_0379866
1160 Ga0501045_0436998
1161 Ga0501045_0446288
1162 nmdc:mga03683_12816_c1
1163 nmdc:mga03n38_16246_c1
1164 nmdc:mga03n38_5415_c1
1165 nmdc:mga03n38_5988_c1
1166 nmdc:mga00v17_142950_c1
1167 nmdc:mga00v17_77720_c1
1168 nmdc:mga00v17_96432_c1
1169 nmdc:mga0yw44_11665_c1
1170 nmdc:mga0yw44_204625_c1
1171 nmdc:mga0yw44_210284_c1
1172 nmdc:mga0yw44_261272_c1
1173 nmdc:mga0yw44_283166_c1
1174 nmdc:mga0yw44_353024_c1
1175 nmdc:mga0yw44_39544_c1
1176 nmdc:mga0yw44_48178_c1
1177 nmdc:mga06z11_211351_c1
1178 nmdc:mga06z11_391716_c1
1179 nmdc:mga04h51_10266_c1
1180 nmdc:mga07m45_17352_c1
1181 nmdc:mga07m45_2442_c1
1182 nmdc:mga09592_21517_c1
1183 nmdc:mga06r32_19000_c1
1184 Ga0495619_0385026
1185 Ga0495619_0457292
1186 Ga0500644_0000093
1187 Ga0500556_0000476
1188 Ga0500593_000182
1189 Ga0500573_0036006
1190 Ga0501084_0016035
1191 Ga0501084_0254818
1192 Ga0501084_0906769
1193 Ga0501082_0006770
1194 Ga0501082_0060054
1195 Ga0501082_0141222
1196 Ga0466962_0085151
1197 Ga0530510_0409683
1198 2585300159
1199 2643890282
1200 2643959338
1201 2644033210
1202 2644080680
1203 2644091214
1204 2644098273
1205 2644119000
1206 2644228798
1207 2644321017
1208 2644446837
1209 2644505002
1210 2644664003
1211 2729907162
1212 2740166241
1213 2760625428
1214 2774396519
1215 2809198185
1216 2812353143
1217 2857483304
1218 2887447105
1219 2891969229
1220 2919052867
1221 2932433727
1222 2935893153
1223 2946063525
1224 8004022816
1225 8004028859
1226 8033685415
1227 8054610087
1228 8056581219

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

48

236

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9838 4 190
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9822 4 177
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9743 4 190
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9635 4 190
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9592 4 190
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9532 64 190 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9416 5 190 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9324 6 190 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9283 3 189 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9244 1 189 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A2M9BG41-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9915 2 190 GO:0004045
GO:0005737
GO:0006412
AF-A0A7T5WPR7-F1-model_v4 deleted 0.9906 7 189
AF-A0A4R2DKB0-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9905 1 188 GO:0004045
GO:0005737
GO:0006412
AF-D6Y8B0-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9893 5 189 GO:0004045
GO:0005737
GO:0006412
AF-A0A354XPW4-F1-model_v4 deleted 0.9891 5 190

Map