F469395
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 614 | 312 | 1228 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300049574|Ga0501038_0442149|Ga0501038_0442149_38_772 |
| Length | 237 |
| Sequence | VRLRRALDRLLRRPTGARAGSGAGPGVEIDPAGEQVEEMTNEPTEVWLVVGLGNPGPSYAGHRHNVGHLVTAELAERMGSPFRAHKSGRADVVEGRLTPPGTPGPRVVLARTRTYMNESGGAVKQLATFYKVPPERIIAIHDELDIPFDTMRVKLGGGDNGHNGLRSLRGALGTGDFYRVRVGIGRPPGRQDPADYVLSDYTAAERKLLPLQVSTAADAVESLVTEGLERTQARFNS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 73 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 87 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 134 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 135 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 136 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 137 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 147 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 148 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 150 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 157 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 158 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 159 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 163 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 166 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 167 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 168 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 169 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 170 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 171 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 172 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 173 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 174 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 175 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 176 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 177 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 178 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 181 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 182 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 183 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 226 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 227 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 269 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 270 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 276 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 277 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 278 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 282 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 283 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 284 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 285 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 286 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 287 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 288 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 289 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 290 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 291 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 292 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 293 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 294 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 295 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 296 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 297 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 298 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 299 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 300 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 301 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 302 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 303 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 304 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 305 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 306 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 307 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 308 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 309 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 310 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 311 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 312 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.35 |
| Metatranscriptomes | 2.61 |
| Isolates | 5.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.84 |
| Nodule | 0.16 |
| Rhizoplane | 11.24 |
| Rhizosphere | 76.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501038_0442149 | 3300049574 | Bacteria | 1001 |
| 2 | JGI24740J21852_10012233 | 3300001979 | Bacteria | 3240 |
| 3 | JGI24740J21852_10020624 | 3300001979 | Bacteria | 2296 |
| 4 | JGI24739J22299_10011240 | 3300001989 | Bacteria | 3307 |
| 5 | JGI24739J22299_10068564 | 3300001989 | Bacteria | 1107 |
| 6 | Ga0055542_1002973 | 3300003762 | Bacteria | 4953 |
| 7 | Ga0065714_10077927 | 3300005288 | Bacteria | 2630 |
| 8 | Ga0070658_10006983 | 3300005327 | Bacteria | 9121 |
| 9 | Ga0070658_10008777 | 3300005327 | Bacteria | 8121 |
| 10 | Ga0070658_10547133 | 3300005327 | Bacteria | 1002 |
| 11 | Ga0070658_10790891 | 3300005327 | Bacteria | 824 |
| 12 | Ga0070683_100002341 | 3300005329 | Bacteria | 15036 |
| 13 | Ga0070683_100004946 | 3300005329 | Bacteria | 11055 |
| 14 | Ga0070683_100418749 | 3300005329 | Bacteria | 1278 |
| 15 | Ga0070690_100494730 | 3300005330 | Bacteria | 914 |
| 16 | Ga0070677_10085758 | 3300005333 | Bacteria | 1359 |
| 17 | Ga0068869_100130787 | 3300005334 | Bacteria | 1929 |
| 18 | Ga0070666_10438417 | 3300005335 | Bacteria | 942 |
| 19 | Ga0070680_100316307 | 3300005336 | Bacteria | 1325 |
| 20 | Ga0070682_100007778 | 3300005337 | Bacteria | 6038 |
| 21 | Ga0070682_100064545 | 3300005337 | Bacteria | 2324 |
| 22 | Ga0070682_100438123 | 3300005337 | Bacteria | 998 |
| 23 | Ga0068868_100024906 | 3300005338 | Bacteria | 4544 |
| 24 | Ga0070660_100014130 | 3300005339 | Bacteria | 5748 |
| 25 | Ga0070660_100027486 | 3300005339 | Bacteria | 4246 |
| 26 | Ga0070689_100585499 | 3300005340 | Bacteria | 965 |
| 27 | Ga0070689_100720960 | 3300005340 | Bacteria | 872 |
| 28 | Ga0070661_100574852 | 3300005344 | Bacteria | 909 |
| 29 | Ga0070692_10006071 | 3300005345 | Bacteria | 5214 |
| 30 | Ga0070692_10011855 | 3300005345 | Bacteria | 4017 |
| 31 | Ga0070675_100385593 | 3300005354 | Bacteria | 1248 |
| 32 | Ga0070674_100228494 | 3300005356 | Bacteria | 1451 |
| 33 | Ga0070674_100714763 | 3300005356 | Bacteria | 858 |
| 34 | Ga0070673_101163383 | 3300005364 | Bacteria | 722 |
| 35 | Ga0070688_100051832 | 3300005365 | Bacteria | 2561 |
| 36 | Ga0070659_100032897 | 3300005366 | Bacteria | 4026 |
| 37 | Ga0070659_100115459 | 3300005366 | Bacteria | 2170 |
| 38 | Ga0070667_100151670 | 3300005367 | Bacteria | 2036 |
| 39 | Ga0070667_100205394 | 3300005367 | Bacteria | 1749 |
| 40 | Ga0070667_100213555 | 3300005367 | Bacteria | 1715 |
| 41 | Ga0070701_10008530 | 3300005438 | Bacteria | 4440 |
| 42 | Ga0070708_100332686 | 3300005445 | Bacteria | 1431 |
| 43 | Ga0070663_100116990 | 3300005455 | Bacteria | 2010 |
| 44 | Ga0070663_100416215 | 3300005455 | Bacteria | 1102 |
| 45 | Ga0070678_100116710 | 3300005456 | Bacteria | 2098 |
| 46 | Ga0070678_100185415 | 3300005456 | Bacteria | 1707 |
| 47 | Ga0070678_100236259 | 3300005456 | Bacteria | 1526 |
| 48 | Ga0070678_101291257 | 3300005456 | Bacteria | 679 |
| 49 | Ga0068867_100029377 | 3300005459 | Bacteria | 3960 |
| 50 | Ga0070685_10417077 | 3300005466 | Bacteria | 933 |
| 51 | Ga0070698_100021743 | 3300005471 | Bacteria | 6717 |
| 52 | Ga0070679_100467320 | 3300005530 | Bacteria | 1206 |
| 53 | Ga0070679_100741705 | 3300005530 | Bacteria | 925 |
| 54 | Ga0070684_100004150 | 3300005535 | Bacteria | 10972 |
| 55 | Ga0070684_100033128 | 3300005535 | Bacteria | 4409 |
| 56 | Ga0068853_100046505 | 3300005539 | Bacteria | 3721 |
| 57 | Ga0070672_100095602 | 3300005543 | Bacteria | 2403 |
| 58 | Ga0070672_100297701 | 3300005543 | Bacteria | 1367 |
| 59 | Ga0070686_100237991 | 3300005544 | Bacteria | 1324 |
| 60 | Ga0070696_100018780 | 3300005546 | Bacteria | 4678 |
| 61 | Ga0070665_100000606 | 3300005548 | Bacteria | 49390 |
| 62 | Ga0070665_100058485 | 3300005548 | Bacteria | 3864 |
| 63 | Ga0070665_100441504 | 3300005548 | Bacteria | 1311 |
| 64 | Ga0070664_100088574 | 3300005564 | Bacteria | 2676 |
| 65 | Ga0070664_100242271 | 3300005564 | Bacteria | 1619 |
| 66 | Ga0068856_100509104 | 3300005614 | Bacteria | 1225 |
| 67 | Ga0070702_100171986 | 3300005615 | Bacteria | 1410 |
| 68 | Ga0070702_100458390 | 3300005615 | Bacteria | 926 |
| 69 | Ga0068852_100005828 | 3300005616 | Bacteria | 8847 |
| 70 | Ga0068852_100216446 | 3300005616 | Bacteria | 1820 |
| 71 | Ga0068864_100020083 | 3300005618 | Bacteria | 5587 |
| 72 | Ga0068864_100713867 | 3300005618 | Bacteria | 980 |
| 73 | Ga0068866_10023332 | 3300005718 | Bacteria | 2877 |
| 74 | Ga0068861_100048865 | 3300005719 | Bacteria | 3200 |
| 75 | Ga0068851_10164311 | 3300005834 | Bacteria | 1221 |
| 76 | Ga0068870_10017216 | 3300005840 | Bacteria | 3468 |
| 77 | Ga0068870_10045277 | 3300005840 | Bacteria | 2303 |
| 78 | Ga0068870_10260000 | 3300005840 | Bacteria | 1080 |
| 79 | Ga0068858_100055974 | 3300005842 | Bacteria | 3646 |
| 80 | Ga0068860_100120149 | 3300005843 | Bacteria | 2516 |
| 81 | Ga0068862_100407013 | 3300005844 | Bacteria | 1274 |
| 82 | Ga0081455_10058641 | 3300005937 | Bacteria | 3255 |
| 83 | Ga0075365_10001661 | 3300006038 | Bacteria | 10271 |
| 84 | Ga0075365_10001879 | 3300006038 | Bacteria | 9889 |
| 85 | Ga0075365_10053958 | 3300006038 | Bacteria | 2664 |
| 86 | Ga0075365_10352613 | 3300006038 | Bacteria | 1037 |
| 87 | Ga0075365_10496544 | 3300006038 | Bacteria | 862 |
| 88 | Ga0075365_10695173 | 3300006038 | Bacteria | 718 |
| 89 | Ga0075368_10000755 | 3300006042 | Bacteria | 9915 |
| 90 | Ga0075363_100006643 | 3300006048 | Bacteria | 5271 |
| 91 | Ga0075364_10003491 | 3300006051 | Bacteria | 8949 |
| 92 | Ga0075364_10034131 | 3300006051 | Bacteria | 3280 |
| 93 | Ga0075364_10121381 | 3300006051 | Bacteria | 1749 |
| 94 | Ga0075364_10228859 | 3300006051 | Bacteria | 1263 |
| 95 | Ga0075364_10525638 | 3300006051 | Bacteria | 809 |
| 96 | Ga0075367_10002239 | 3300006178 | Bacteria | 8741 |
| 97 | Ga0097621_100365009 | 3300006237 | Bacteria | 1287 |
| 98 | Ga0075370_10005014 | 3300006353 | Bacteria | 6515 |
| 99 | Ga0075428_100961192 | 3300006844 | Bacteria | 905 |
| 100 | Ga0075431_100718742 | 3300006847 | Bacteria | 976 |
| 101 | Ga0075429_100074524 | 3300006880 | Bacteria | 2956 |
| 102 | Ga0111539_10102121 | 3300009094 | Bacteria | 3366 |
| 103 | Ga0111539_11149425 | 3300009094 | Bacteria | 902 |
| 104 | Ga0105245_10001197 | 3300009098 | Bacteria | 23470 |
| 105 | Ga0105245_10013078 | 3300009098 | Bacteria | 7230 |
| 106 | Ga0105245_10112865 | 3300009098 | Bacteria | 2530 |
| 107 | Ga0114129_10839778 | 3300009147 | Bacteria | 1169 |
| 108 | Ga0105243_10005660 | 3300009148 | Bacteria | 9724 |
| 109 | Ga0105243_10028270 | 3300009148 | Bacteria | 4303 |
| 110 | Ga0105243_10072819 | 3300009148 | Bacteria | 2782 |
| 111 | Ga0105243_10833767 | 3300009148 | Bacteria | 912 |
| 112 | Ga0105242_10097067 | 3300009176 | Bacteria | 2491 |
| 113 | Ga0105242_10107776 | 3300009176 | Bacteria | 2370 |
| 114 | Ga0105242_11085005 | 3300009176 | Bacteria | 814 |
| 115 | Ga0105248_10132406 | 3300009177 | Bacteria | 2813 |
| 116 | Ga0105248_10142789 | 3300009177 | Bacteria | 2701 |
| 117 | Ga0105238_10166563 | 3300009551 | Bacteria | 2179 |
| 118 | Ga0105238_10169945 | 3300009551 | Bacteria | 2156 |
| 119 | Ga0105238_10761935 | 3300009551 | Bacteria | 982 |
| 120 | Ga0105249_10099583 | 3300009553 | Bacteria | 2732 |
| 121 | Ga0105249_10549672 | 3300009553 | Bacteria | 1205 |
| 122 | Ga0105239_10001341 | 3300010375 | Bacteria | 33185 |
| 123 | Ga0105239_10125024 | 3300010375 | Bacteria | 2858 |
| 124 | Ga0105239_10135735 | 3300010375 | Bacteria | 2739 |
| 125 | Ga0105239_10377508 | 3300010375 | Bacteria | 1603 |
| 126 | Ga0105246_10001074 | 3300011119 | Bacteria | 15790 |
| 127 | Ga0105246_10247828 | 3300011119 | Bacteria | 1412 |
| 128 | Ga0105246_10390475 | 3300011119 | Bacteria | 1153 |
| 129 | Ga0157322_1003593 | 3300012490 | Bacteria | 959 |
| 130 | Ga0157313_1016160 | 3300012503 | Bacteria | 710 |
| 131 | Ga0157371_10338040 | 3300013102 | Bacteria | 1095 |
| 132 | Ga0157370_11084420 | 3300013104 | Bacteria | 724 |
| 133 | Ga0157378_10725738 | 3300013297 | Bacteria | 1015 |
| 134 | Ga0163162_10355027 | 3300013306 | Bacteria | 1599 |
| 135 | Ga0163162_11443268 | 3300013306 | Bacteria | 783 |
| 136 | Ga0157372_10002413 | 3300013307 | Bacteria | 20232 |
| 137 | Ga0157372_10303659 | 3300013307 | Bacteria | 1857 |
| 138 | Ga0157372_10348283 | 3300013307 | Bacteria | 1726 |
| 139 | Ga0157372_10587569 | 3300013307 | Bacteria | 1298 |
| 140 | Ga0157372_10714650 | 3300013307 | Bacteria | 1166 |
| 141 | Ga0157372_11625346 | 3300013307 | Bacteria | 744 |
| 142 | Ga0157375_10054251 | 3300013308 | Bacteria | 3947 |
| 143 | Ga0157375_10265303 | 3300013308 | Bacteria | 1879 |
| 144 | Ga0157375_10533564 | 3300013308 | Bacteria | 1336 |
| 145 | Ga0157375_10781492 | 3300013308 | Bacteria | 1104 |
| 146 | Ga0163163_10226706 | 3300014325 | Bacteria | 1917 |
| 147 | Ga0163163_10591933 | 3300014325 | Bacteria | 1172 |
| 148 | Ga0163163_10619740 | 3300014325 | Bacteria | 1145 |
| 149 | Ga0157380_10286609 | 3300014326 | Bacteria | 1510 |
| 150 | Ga0157380_10592238 | 3300014326 | Bacteria | 1095 |
| 151 | Ga0157380_10879707 | 3300014326 | Bacteria | 920 |
| 152 | Ga0157377_10049561 | 3300014745 | Bacteria | 2361 |
| 153 | Ga0157377_10087470 | 3300014745 | Bacteria | 1834 |
| 154 | Ga0157377_10482308 | 3300014745 | Bacteria | 863 |
| 155 | Ga0157379_10070517 | 3300014968 | Bacteria | 3126 |
| 156 | Ga0157376_10179509 | 3300014969 | Bacteria | 1934 |
| 157 | Ga0157376_10413331 | 3300014969 | Bacteria | 1307 |
| 158 | Ga0157376_10503587 | 3300014969 | Bacteria | 1191 |
| 159 | Ga0163161_10199130 | 3300017792 | Bacteria | 1543 |
| 160 | Ga0163161_10300485 | 3300017792 | Bacteria | 1264 |
| 161 | Ga0163161_10383642 | 3300017792 | Bacteria | 1124 |
| 162 | Ga0206355_1638430 | 3300020076 | Bacteria | 1584 |
| 163 | Ga0206354_11058171 | 3300020081 | Bacteria | 2227 |
| 164 | Ga0206353_10717811 | 3300020082 | Bacteria | 1943 |
| 165 | Ga0206353_11275066 | 3300020082 | Bacteria | 10737 |
| 166 | Ga0206353_11908677 | 3300020082 | Bacteria | 2819 |
| 167 | Ga0154015_1578179 | 3300020610 | Bacteria | 1441 |
| 168 | Ga0209148_1002946 | 3300025254 | Bacteria | 5156 |
| 169 | Ga0207656_10185256 | 3300025321 | Bacteria | 1001 |
| 170 | Ga0207642_10019038 | 3300025899 | Bacteria | 2649 |
| 171 | Ga0207688_10070644 | 3300025901 | Bacteria | 1980 |
| 172 | Ga0207688_10096616 | 3300025901 | Bacteria | 1702 |
| 173 | Ga0207688_10422310 | 3300025901 | Bacteria | 829 |
| 174 | Ga0207680_10235411 | 3300025903 | Bacteria | 1260 |
| 175 | Ga0207647_10007079 | 3300025904 | Bacteria | 8137 |
| 176 | Ga0207647_10053784 | 3300025904 | Bacteria | 2480 |
| 177 | Ga0207643_10019980 | 3300025908 | Bacteria | 3674 |
| 178 | Ga0207643_10061233 | 3300025908 | Bacteria | 2149 |
| 179 | Ga0207643_10193844 | 3300025908 | Bacteria | 1234 |
| 180 | Ga0207705_10152584 | 3300025909 | Bacteria | 1731 |
| 181 | Ga0207705_10567721 | 3300025909 | Bacteria | 882 |
| 182 | Ga0207707_10616593 | 3300025912 | Bacteria | 917 |
| 183 | Ga0207671_10723461 | 3300025914 | Bacteria | 791 |
| 184 | Ga0207657_10070936 | 3300025919 | Bacteria | 2951 |
| 185 | Ga0207652_10005990 | 3300025921 | Bacteria | 9836 |
| 186 | Ga0207652_10285550 | 3300025921 | Bacteria | 1489 |
| 187 | Ga0207652_10636286 | 3300025921 | Bacteria | 955 |
| 188 | Ga0207652_10831599 | 3300025921 | Bacteria | 819 |
| 189 | Ga0207687_10000975 | 3300025927 | Bacteria | 19466 |
| 190 | Ga0207644_10367146 | 3300025931 | Bacteria | 1172 |
| 191 | Ga0207644_10509067 | 3300025931 | Bacteria | 994 |
| 192 | Ga0207690_10020386 | 3300025932 | Bacteria | 4097 |
| 193 | Ga0207690_10147553 | 3300025932 | Bacteria | 1740 |
| 194 | Ga0207686_10028564 | 3300025934 | Bacteria | 3280 |
| 195 | Ga0207686_10237749 | 3300025934 | Bacteria | 1324 |
| 196 | Ga0207686_10241394 | 3300025934 | Bacteria | 1315 |
| 197 | Ga0207709_10019706 | 3300025935 | Bacteria | 3797 |
| 198 | Ga0207709_10549833 | 3300025935 | Bacteria | 908 |
| 199 | Ga0207704_10064582 | 3300025938 | Bacteria | 2287 |
| 200 | Ga0207704_10157422 | 3300025938 | Bacteria | 1612 |
| 201 | Ga0207691_10056406 | 3300025940 | Bacteria | 3578 |
| 202 | Ga0207691_10184428 | 3300025940 | Bacteria | 1822 |
| 203 | Ga0207711_10090767 | 3300025941 | Bacteria | 2686 |
| 204 | Ga0207711_10531205 | 3300025941 | Bacteria | 1097 |
| 205 | Ga0207689_10121423 | 3300025942 | Bacteria | 2149 |
| 206 | Ga0207689_10233425 | 3300025942 | Bacteria | 1520 |
| 207 | Ga0207661_10033929 | 3300025944 | Bacteria | 3964 |
| 208 | Ga0207661_10161869 | 3300025944 | Bacteria | 1942 |
| 209 | Ga0207661_10163546 | 3300025944 | Bacteria | 1932 |
| 210 | Ga0207679_10039966 | 3300025945 | Bacteria | 3354 |
| 211 | Ga0207679_10409392 | 3300025945 | Bacteria | 1194 |
| 212 | Ga0207679_11033656 | 3300025945 | Bacteria | 753 |
| 213 | Ga0207712_10238268 | 3300025961 | Bacteria | 1464 |
| 214 | Ga0207668_10086534 | 3300025972 | Bacteria | 2290 |
| 215 | Ga0207640_10101279 | 3300025981 | Bacteria | 2020 |
| 216 | Ga0207658_10014306 | 3300025986 | Bacteria | 5434 |
| 217 | Ga0207658_10359018 | 3300025986 | Bacteria | 1271 |
| 218 | Ga0207658_10738088 | 3300025986 | Bacteria | 891 |
| 219 | Ga0207677_10616986 | 3300026023 | Bacteria | 953 |
| 220 | Ga0207703_10384978 | 3300026035 | Bacteria | 1298 |
| 221 | Ga0207639_10148682 | 3300026041 | Bacteria | 1960 |
| 222 | Ga0207639_10365257 | 3300026041 | Bacteria | 1293 |
| 223 | Ga0207678_10058521 | 3300026067 | Bacteria | 3316 |
| 224 | Ga0207678_10276631 | 3300026067 | Bacteria | 1440 |
| 225 | Ga0207708_10120721 | 3300026075 | Bacteria | 2042 |
| 226 | Ga0207708_10257278 | 3300026075 | Bacteria | 1408 |
| 227 | Ga0207702_10068271 | 3300026078 | Bacteria | 3054 |
| 228 | Ga0207702_10330043 | 3300026078 | Bacteria | 1455 |
| 229 | Ga0207648_10019029 | 3300026089 | Bacteria | 6201 |
| 230 | Ga0207676_10054202 | 3300026095 | Bacteria | 3142 |
| 231 | Ga0207676_10222413 | 3300026095 | Bacteria | 1682 |
| 232 | Ga0207674_10077304 | 3300026116 | Bacteria | 3334 |
| 233 | Ga0207674_10348305 | 3300026116 | Bacteria | 1432 |
| 234 | Ga0207675_100015567 | 3300026118 | Bacteria | 7094 |
| 235 | Ga0207675_100323468 | 3300026118 | Bacteria | 1506 |
| 236 | Ga0207675_100572595 | 3300026118 | Bacteria | 1130 |
| 237 | Ga0207683_10227787 | 3300026121 | Bacteria | 1699 |
| 238 | Ga0207683_10312795 | 3300026121 | Bacteria | 1438 |
| 239 | Ga0207683_10882838 | 3300026121 | Bacteria | 830 |
| 240 | Ga0207683_10984044 | 3300026121 | Bacteria | 783 |
| 241 | Ga0207698_10121329 | 3300026142 | Bacteria | 2213 |
| 242 | Ga0207698_10173296 | 3300026142 | Bacteria | 1902 |
| 243 | Ga0207698_10855393 | 3300026142 | Bacteria | 915 |
| 244 | Ga0209813_10014234 | 3300027866 | Bacteria | 2139 |
| 245 | Ga0268266_10000339 | 3300028379 | Bacteria | 73355 |
| 246 | Ga0268266_10049149 | 3300028379 | Bacteria | 3616 |
| 247 | Ga0268266_10052078 | 3300028379 | Bacteria | 3515 |
| 248 | Ga0268265_10149910 | 3300028380 | Bacteria | 1966 |
| 249 | Ga0268264_10099057 | 3300028381 | Bacteria | 2529 |
| 250 | Ga0314311_1115994 | 3300030733 | Bacteria | 1369 |
| 251 | Ga0316179_1059643 | 3300030734 | Bacteria | 7862 |
| 252 | Ga0316181_1004558 | 3300030744 | Bacteria | 1853 |
| 253 | Ga0316181_1290401 | 3300030744 | Bacteria | 1405 |
| 254 | Ga0307513_10053179 | 3300031456 | Bacteria | 4355 |
| 255 | Ga0307513_10246378 | 3300031456 | Bacteria | 1587 |
| 256 | Ga0307516_10229463 | 3300031730 | Bacteria | 1561 |
| 257 | Ga0307405_10335075 | 3300031731 | Bacteria | 1161 |
| 258 | Ga0307413_10746730 | 3300031824 | Bacteria | 817 |
| 259 | Ga0307413_11188363 | 3300031824 | Bacteria | 663 |
| 260 | Ga0307410_10022295 | 3300031852 | Bacteria | 3911 |
| 261 | Ga0307410_10600775 | 3300031852 | Bacteria | 918 |
| 262 | Ga0307406_10286693 | 3300031901 | Bacteria | 1259 |
| 263 | Ga0307407_10002099 | 3300031903 | Bacteria | 7644 |
| 264 | Ga0307407_10375845 | 3300031903 | Bacteria | 1013 |
| 265 | Ga0307412_10530296 | 3300031911 | Bacteria | 985 |
| 266 | Ga0307409_100007425 | 3300031995 | Bacteria | 6555 |
| 267 | Ga0307409_100013359 | 3300031995 | Bacteria | 5281 |
| 268 | Ga0307409_100320139 | 3300031995 | Bacteria | 1451 |
| 269 | Ga0307416_100615821 | 3300032002 | Bacteria | 1167 |
| 270 | Ga0307411_10911211 | 3300032005 | Bacteria | 782 |
| 271 | Ga0307415_100273923 | 3300032126 | Bacteria | 1384 |
| 272 | Ga0307415_100623952 | 3300032126 | Bacteria | 963 |
| 273 | Ga0373941_0053866 | 3300035115 | Bacteria | 1288 |
| 274 | Ga0316574_0171341 | 3300035398 | Bacteria | 1397 |
| 275 | Ga0395899_0460525 | 3300037312 | Bacteria | 831 |
| 276 | Ga0395900_0013014 | 3300037418 | Bacteria | 8502 |
| 277 | Ga0395898_0004220 | 3300037466 | Bacteria | 15749 |
| 278 | Ga0395898_0555001 | 3300037466 | Bacteria | 1091 |
| 279 | Ga0395898_0617714 | 3300037466 | Bacteria | 1026 |
| 280 | Ga0395905_0266939 | 3300037471 | Bacteria | 1597 |
| 281 | Ga0436364_0601870 | 3300037853 | Bacteria | 1354 |
| 282 | Ga0395901_0022327 | 3300038443 | Bacteria | 6485 |
| 283 | Ga0395901_0092752 | 3300038443 | Bacteria | 3161 |
| 284 | Ga0395901_0446094 | 3300038443 | Bacteria | 1324 |
| 285 | Ga0395901_0446455 | 3300038443 | Bacteria | 1323 |
| 286 | Ga0395901_0594356 | 3300038443 | Bacteria | 1116 |
| 287 | Ga0439438_021489 | 3300041405 | Bacteria | 1799 |
| 288 | Ga0439447_020175 | 3300041407 | Bacteria | 1771 |
| 289 | Ga0439465_0095342 | 3300041413 | Bacteria | 1022 |
| 290 | Ga0451791_0367629 | 3300041451 | Bacteria | 7532 |
| 291 | Ga0451793_1760822 | 3300041452 | Bacteria | 12096 |
| 292 | Ga0451797_0009474 | 3300041453 | Bacteria | 2404 |
| 293 | Ga0451795_0984346 | 3300041456 | Bacteria | 1366 |
| 294 | Ga0451798_0992359 | 3300041458 | Bacteria | 1569 |
| 295 | Ga0451802_1992058 | 3300041460 | Bacteria | 2065 |
| 296 | Ga0451833_0001040 | 3300041491 | Bacteria | 912 |
| 297 | Ga0451837_0073120 | 3300041494 | Bacteria | 2136 |
| 298 | Ga0451839_0931637 | 3300041496 | Bacteria | 3150 |
| 299 | Ga0451851_1295780 | 3300041507 | Bacteria | 700 |
| 300 | Ga0451843_0552627 | 3300041509 | Bacteria | 1706 |
| 301 | Ga0451853_0068405 | 3300041512 | Bacteria | 1722 |
| 302 | Ga0451853_1568239 | 3300041512 | Bacteria | 782 |
| 303 | Ga0451853_3364545 | 3300041512 | Bacteria | 5549 |
| 304 | Ga0439431_0001100 | 3300041997 | Bacteria | 5862 |
| 305 | Ga0450907_012966 | 3300042146 | Bacteria | 1388 |
| 306 | Ga0439434_0006964 | 3300042435 | Bacteria | 3303 |
| 307 | Ga0466969_0147541 | 3300044656 | Bacteria | 1085 |
| 308 | Ga0466972_0012738 | 3300044658 | Bacteria | 4223 |
| 309 | Ga0466965_0009968 | 3300044683 | Bacteria | 4420 |
| 310 | Ga0466965_0069760 | 3300044683 | Bacteria | 1766 |
| 311 | Ga0466965_0077074 | 3300044683 | Bacteria | 1683 |
| 312 | Ga0466966_0002232 | 3300044684 | Bacteria | 12596 |
| 313 | Ga0466966_0176475 | 3300044684 | Bacteria | 1297 |
| 314 | Ga0466966_0408593 | 3300044684 | Bacteria | 816 |
| 315 | Ga0466961_0031192 | 3300044693 | Bacteria | 3426 |
| 316 | Ga0466963_0091333 | 3300044694 | Bacteria | 2074 |
| 317 | Ga0466963_0133261 | 3300044694 | Bacteria | 1718 |
| 318 | Ga0466963_0160892 | 3300044694 | Bacteria | 1562 |
| 319 | Ga0466963_0299280 | 3300044694 | Bacteria | 1131 |
| 320 | Ga0466964_0049049 | 3300044706 | Bacteria | 1728 |
| 321 | Ga0466971_0054838 | 3300044719 | Bacteria | 1796 |
| 322 | Ga0466971_0091734 | 3300044719 | Bacteria | 1391 |
| 323 | Ga0466971_0121766 | 3300044719 | Bacteria | 1208 |
| 324 | Ga0466968_0043669 | 3300044735 | Bacteria | 1899 |
| 325 | Ga0466968_0079664 | 3300044735 | Bacteria | 1437 |
| 326 | Ga0466970_0004715 | 3300044765 | Bacteria | 6733 |
| 327 | Ga0466970_0011782 | 3300044765 | Bacteria | 4459 |
| 328 | Ga0466970_0197478 | 3300044765 | Bacteria | 1119 |
| 329 | Ga0466970_0227946 | 3300044765 | Bacteria | 1041 |
| 330 | Ga0466957_0086798 | 3300044842 | Bacteria | 1955 |
| 331 | Ga0466960_0001672 | 3300044901 | Bacteria | 8125 |
| 332 | Ga0466960_0043179 | 3300044901 | Bacteria | 2143 |
| 333 | Ga0466960_0088596 | 3300044901 | Bacteria | 1573 |
| 334 | Ga0466960_0186812 | 3300044901 | Bacteria | 1126 |
| 335 | Ga0466960_0672939 | 3300044901 | Bacteria | 619 |
| 336 | Ga0466959_0065369 | 3300045049 | Bacteria | 2639 |
| 337 | Ga0466959_0231391 | 3300045049 | Bacteria | 1279 |
| 338 | Ga0451576_0186163 | 3300045051 | Bacteria | 2168 |
| 339 | Ga0466958_0030192 | 3300045836 | Bacteria | 3217 |
| 340 | Ga0466958_0225392 | 3300045836 | Bacteria | 1196 |
| 341 | Ga0466958_0500838 | 3300045836 | Bacteria | 788 |
| 342 | Ga0466967_0004034 | 3300045976 | Bacteria | 9796 |
| 343 | Ga0466967_0036244 | 3300045976 | Bacteria | 4208 |
| 344 | Ga0466967_0041142 | 3300045976 | Bacteria | 3982 |
| 345 | Ga0466967_0048066 | 3300045976 | Bacteria | 3724 |
| 346 | Ga0466967_0064983 | 3300045976 | Bacteria | 3246 |
| 347 | Ga0466967_0071103 | 3300045976 | Bacteria | 3114 |
| 348 | Ga0466967_0192089 | 3300045976 | Bacteria | 1930 |
| 349 | Ga0466967_0332473 | 3300045976 | Bacteria | 1467 |
| 350 | Ga0466967_0532229 | 3300045976 | Bacteria | 1155 |
| 351 | Ga0495627_009109 | 3300046453 | Bacteria | 3666 |
| 352 | Ga0495627_064663 | 3300046453 | Bacteria | 1076 |
| 353 | Ga0495603_0014559 | 3300046455 | Bacteria | 4758 |
| 354 | Ga0495603_0015645 | 3300046455 | Bacteria | 4590 |
| 355 | Ga0495603_0042236 | 3300046455 | Bacteria | 2726 |
| 356 | Ga0495603_0090766 | 3300046455 | Bacteria | 1786 |
| 357 | Ga0495629_0028468 | 3300046459 | Bacteria | 3967 |
| 358 | Ga0495629_0439612 | 3300046459 | Bacteria | 884 |
| 359 | Ga0495605_0230240 | 3300046474 | Bacteria | 798 |
| 360 | Ga0495585_0016493 | 3300046492 | Bacteria | 4280 |
| 361 | Ga0495594_0046976 | 3300046499 | Bacteria | 2371 |
| 362 | Ga0495644_0374680 | 3300046523 | Bacteria | 562 |
| 363 | Ga0495622_0177535 | 3300046557 | Bacteria | 956 |
| 364 | Ga0495622_0335732 | 3300046557 | Bacteria | 655 |
| 365 | Ga0495668_0397028 | 3300046616 | Bacteria | 758 |
| 366 | Ga0495625_0236807 | 3300046660 | Bacteria | 1190 |
| 367 | Ga0495659_0153137 | 3300046664 | Bacteria | 927 |
| 368 | Ga0495657_0275003 | 3300046675 | Bacteria | 1009 |
| 369 | Ga0495658_0105125 | 3300046683 | Bacteria | 1691 |
| 370 | Ga0495613_0002046 | 3300046689 | Bacteria | 15333 |
| 371 | Ga0495600_0053470 | 3300046809 | Bacteria | 2638 |
| 372 | Ga0495581_0138514 | 3300047315 | Bacteria | 1419 |
| 373 | Ga0495676_0003194 | 3300047321 | Bacteria | 14809 |
| 374 | Ga0495685_011792 | 3300047447 | Bacteria | 2955 |
| 375 | Ga0495593_0033151 | 3300047673 | Bacteria | 2814 |
| 376 | Ga0495614_0009974 | 3300048089 | Bacteria | 4192 |
| 377 | Ga0496100_0497226 | 3300048903 | Bacteria | 939 |
| 378 | Ga0496101_0002279 | 3300048904 | Bacteria | 11715 |
| 379 | Ga0496101_0037283 | 3300048904 | Bacteria | 3448 |
| 380 | Ga0496101_0362809 | 3300048904 | Bacteria | 1139 |
| 381 | Ga0496101_0853700 | 3300048904 | Bacteria | 717 |
| 382 | Ga0496102_0004783 | 3300048905 | Bacteria | 11457 |
| 383 | Ga0496102_0008685 | 3300048905 | Bacteria | 8721 |
| 384 | Ga0496102_0147222 | 3300048905 | Bacteria | 2211 |
| 385 | Ga0496102_0290238 | 3300048905 | Bacteria | 1542 |
| 386 | Ga0496103_0091386 | 3300048906 | Bacteria | 1921 |
| 387 | Ga0496103_0290125 | 3300048906 | Bacteria | 1052 |
| 388 | Ga0496104_0003236 | 3300048907 | Bacteria | 14024 |
| 389 | Ga0496104_0659864 | 3300048907 | Bacteria | 955 |
| 390 | Ga0496104_0820387 | 3300048907 | Bacteria | 836 |
| 391 | Ga0496105_0002891 | 3300048908 | Bacteria | 12594 |
| 392 | Ga0496105_0075963 | 3300048908 | Bacteria | 2774 |
| 393 | Ga0496105_0101748 | 3300048908 | Bacteria | 2373 |
| 394 | Ga0496105_0180866 | 3300048908 | Bacteria | 1727 |
| 395 | Ga0496106_0003302 | 3300048909 | Bacteria | 12032 |
| 396 | Ga0496106_0023140 | 3300048909 | Bacteria | 4615 |
| 397 | Ga0496106_0055184 | 3300048909 | Bacteria | 3002 |
| 398 | Ga0496106_0119469 | 3300048909 | Bacteria | 2059 |
| 399 | Ga0496106_0825247 | 3300048909 | Bacteria | 735 |
| 400 | Ga0496106_0830818 | 3300048909 | Bacteria | 732 |
| 401 | Ga0496107_0010526 | 3300048910 | Bacteria | 6427 |
| 402 | Ga0496107_0081450 | 3300048910 | Bacteria | 2361 |
| 403 | Ga0496107_0251492 | 3300048910 | Bacteria | 1315 |
| 404 | Ga0496107_0563268 | 3300048910 | Bacteria | 843 |
| 405 | Ga0496108_0004950 | 3300048911 | Bacteria | 10766 |
| 406 | Ga0496108_0078393 | 3300048911 | Bacteria | 2796 |
| 407 | Ga0496108_0101068 | 3300048911 | Bacteria | 2460 |
| 408 | Ga0496108_0143223 | 3300048911 | Bacteria | 2060 |
| 409 | Ga0496108_0167239 | 3300048911 | Bacteria | 1902 |
| 410 | Ga0496108_0237598 | 3300048911 | Bacteria | 1585 |
| 411 | Ga0496108_0305575 | 3300048911 | Bacteria | 1386 |
| 412 | Ga0496108_0455757 | 3300048911 | Bacteria | 1117 |
| 413 | Ga0496108_0593533 | 3300048911 | Bacteria | 965 |
| 414 | Ga0496108_0870201 | 3300048911 | Bacteria | 775 |
| 415 | Ga0496109_0035217 | 3300048912 | Bacteria | 4514 |
| 416 | Ga0496109_0072140 | 3300048912 | Bacteria | 3171 |
| 417 | Ga0496109_0095488 | 3300048912 | Bacteria | 2753 |
| 418 | Ga0496109_0207828 | 3300048912 | Bacteria | 1841 |
| 419 | Ga0496109_0436409 | 3300048912 | Bacteria | 1237 |
| 420 | Ga0496109_0695997 | 3300048912 | Bacteria | 954 |
| 421 | Ga0496110_0004658 | 3300048913 | Bacteria | 10665 |
| 422 | Ga0496110_0015561 | 3300048913 | Bacteria | 6335 |
| 423 | Ga0496110_0040125 | 3300048913 | Bacteria | 4080 |
| 424 | Ga0496110_0198172 | 3300048913 | Bacteria | 1824 |
| 425 | Ga0496111_0000445 | 3300048914 | Bacteria | 21022 |
| 426 | Ga0496111_0052115 | 3300048914 | Bacteria | 2954 |
| 427 | Ga0496111_0099747 | 3300048914 | Bacteria | 2133 |
| 428 | Ga0496111_0472035 | 3300048914 | Bacteria | 925 |
| 429 | Ga0496113_0023963 | 3300048916 | Bacteria | 4333 |
| 430 | Ga0496114_0012364 | 3300048917 | Bacteria | 6830 |
| 431 | Ga0496114_0038487 | 3300048917 | Bacteria | 3957 |
| 432 | Ga0496114_0087471 | 3300048917 | Bacteria | 2642 |
| 433 | Ga0496114_0115706 | 3300048917 | Bacteria | 2301 |
| 434 | Ga0496114_0178109 | 3300048917 | Bacteria | 1856 |
| 435 | Ga0496114_0324125 | 3300048917 | Bacteria | 1361 |
| 436 | Ga0496114_0329043 | 3300048917 | Bacteria | 1351 |
| 437 | Ga0496114_0736731 | 3300048917 | Bacteria | 862 |
| 438 | Ga0496115_0004962 | 3300048918 | Bacteria | 9666 |
| 439 | Ga0496115_0155631 | 3300048918 | Bacteria | 1888 |
| 440 | Ga0496118_0033332 | 3300048921 | Bacteria | 4228 |
| 441 | Ga0496126_0036899 | 3300048929 | Bacteria | 4566 |
| 442 | Ga0501306_026927 | 3300049127 | Bacteria | 835 |
| 443 | Ga0501309_007958 | 3300049129 | Bacteria | 1324 |
| 444 | Ga0501305_033203 | 3300049161 | Bacteria | 813 |
| 445 | Ga0501305_040962 | 3300049161 | Bacteria | 753 |
| 446 | Ga0501307_032963 | 3300049162 | Bacteria | 726 |
| 447 | Ga0501311_005359 | 3300049527 | Bacteria | 1404 |
| 448 | Ga0501312_023664 | 3300049528 | Bacteria | 926 |
| 449 | Ga0501317_009894 | 3300049533 | Bacteria | 1129 |
| 450 | Ga0501318_006519 | 3300049534 | Bacteria | 1194 |
| 451 | Ga0501321_001372 | 3300049537 | Bacteria | 1918 |
| 452 | Ga0501031_0016784 | 3300049568 | Bacteria | 4756 |
| 453 | Ga0501031_0181159 | 3300049568 | Bacteria | 1376 |
| 454 | Ga0501031_0295945 | 3300049568 | Bacteria | 1049 |
| 455 | Ga0501031_0325219 | 3300049568 | Bacteria | 996 |
| 456 | Ga0501031_0352050 | 3300049568 | Bacteria | 953 |
| 457 | Ga0501032_0000979 | 3300049569 | Bacteria | 23099 |
| 458 | Ga0501032_0008023 | 3300049569 | Bacteria | 7696 |
| 459 | Ga0501032_0224573 | 3300049569 | Bacteria | 1222 |
| 460 | Ga0501034_0103923 | 3300049571 | Bacteria | 2834 |
| 461 | Ga0501034_0155678 | 3300049571 | Bacteria | 2259 |
| 462 | Ga0501034_0269759 | 3300049571 | Bacteria | 1643 |
| 463 | Ga0501034_0523235 | 3300049571 | Bacteria | 1098 |
| 464 | Ga0501036_0037705 | 3300049572 | Bacteria | 4089 |
| 465 | Ga0501036_0117853 | 3300049572 | Bacteria | 2243 |
| 466 | Ga0501036_0142234 | 3300049572 | Bacteria | 2024 |
| 467 | Ga0501036_0603074 | 3300049572 | Bacteria | 911 |
| 468 | Ga0501037_0004167 | 3300049573 | Bacteria | 10484 |
| 469 | Ga0501037_0154466 | 3300049573 | Bacteria | 1639 |
| 470 | Ga0501037_0175091 | 3300049573 | Bacteria | 1524 |
| 471 | Ga0501038_0001575 | 3300049574 | Bacteria | 21127 |
| 472 | Ga0501038_0005029 | 3300049574 | Bacteria | 12281 |
| 473 | Ga0501038_0190064 | 3300049574 | Bacteria | 1653 |
| 474 | Ga0501038_0419576 | 3300049574 | Bacteria | 1033 |
| 475 | Ga0501039_0006688 | 3300049575 | Bacteria | 8766 |
| 476 | Ga0501039_0188907 | 3300049575 | Bacteria | 1620 |
| 477 | Ga0501039_0200319 | 3300049575 | Bacteria | 1570 |
| 478 | Ga0501039_0229699 | 3300049575 | Bacteria | 1459 |
| 479 | Ga0501039_0238528 | 3300049575 | Bacteria | 1430 |
| 480 | Ga0501041_0202109 | 3300049577 | Bacteria | 1246 |
| 481 | Ga0501042_0144878 | 3300049578 | Bacteria | 1713 |
| 482 | Ga0501042_0220601 | 3300049578 | Bacteria | 1368 |
| 483 | Ga0501042_0547110 | 3300049578 | Bacteria | 841 |
| 484 | Ga0501043_0004270 | 3300049579 | Bacteria | 11637 |
| 485 | Ga0501043_0016979 | 3300049579 | Bacteria | 5706 |
| 486 | Ga0501043_0056592 | 3300049579 | Bacteria | 3080 |
| 487 | Ga0501043_0530054 | 3300049579 | Bacteria | 877 |
| 488 | Ga0501046_0000862 | 3300049580 | Bacteria | 29490 |
| 489 | Ga0501046_0002697 | 3300049580 | Bacteria | 16521 |
| 490 | Ga0501046_0346820 | 3300049580 | Bacteria | 1078 |
| 491 | Ga0501047_0152323 | 3300049581 | Bacteria | 2187 |
| 492 | Ga0501047_0240702 | 3300049581 | Bacteria | 1660 |
| 493 | Ga0501047_0297051 | 3300049581 | Bacteria | 1458 |
| 494 | Ga0501048_0019702 | 3300049582 | Bacteria | 4947 |
| 495 | Ga0501048_0664852 | 3300049582 | Bacteria | 748 |
| 496 | Ga0501067_0002023 | 3300049583 | Bacteria | 11183 |
| 497 | Ga0501067_0002257 | 3300049583 | Bacteria | 10632 |
| 498 | Ga0501067_0028818 | 3300049583 | Bacteria | 3078 |
| 499 | Ga0501067_0083337 | 3300049583 | Bacteria | 1774 |
| 500 | Ga0501067_0344514 | 3300049583 | Bacteria | 830 |
| 501 | Ga0501067_0535172 | 3300049583 | Bacteria | 656 |
| 502 | Ga0501068_0012839 | 3300049584 | Bacteria | 4757 |
| 503 | Ga0501068_0063830 | 3300049584 | Bacteria | 2240 |
| 504 | Ga0501069_0065288 | 3300049585 | Bacteria | 2035 |
| 505 | Ga0501069_0086622 | 3300049585 | Bacteria | 1768 |
| 506 | Ga0501069_0182805 | 3300049585 | Bacteria | 1212 |
| 507 | Ga0501070_0001826 | 3300049586 | Bacteria | 18754 |
| 508 | Ga0501070_0024172 | 3300049586 | Bacteria | 5095 |
| 509 | Ga0501070_0084914 | 3300049586 | Bacteria | 2621 |
| 510 | Ga0501070_0373119 | 3300049586 | Bacteria | 1156 |
| 511 | Ga0501070_0713818 | 3300049586 | Bacteria | 792 |
| 512 | Ga0501071_0003531 | 3300049587 | Bacteria | 9783 |
| 513 | Ga0501071_0083759 | 3300049587 | Bacteria | 2336 |
| 514 | Ga0501071_0227395 | 3300049587 | Bacteria | 1405 |
| 515 | Ga0501071_0236721 | 3300049587 | Bacteria | 1376 |
| 516 | Ga0501071_0517937 | 3300049587 | Bacteria | 915 |
| 517 | Ga0501072_0029418 | 3300049588 | Bacteria | 4291 |
| 518 | Ga0501073_0003986 | 3300049589 | Bacteria | 11083 |
| 519 | Ga0501073_0038917 | 3300049589 | Bacteria | 3371 |
| 520 | Ga0501073_0049858 | 3300049589 | Bacteria | 2935 |
| 521 | Ga0501073_0067981 | 3300049589 | Bacteria | 2484 |
| 522 | Ga0501074_0001928 | 3300049590 | Bacteria | 14262 |
| 523 | Ga0501074_0044342 | 3300049590 | Bacteria | 3219 |
| 524 | Ga0501074_0073731 | 3300049590 | Bacteria | 2452 |
| 525 | Ga0501074_0119705 | 3300049590 | Bacteria | 1883 |
| 526 | Ga0501074_0130817 | 3300049590 | Bacteria | 1795 |
| 527 | Ga0501074_0170149 | 3300049590 | Bacteria | 1555 |
| 528 | Ga0501074_0343529 | 3300049590 | Bacteria | 1059 |
| 529 | Ga0501076_0359166 | 3300049592 | Bacteria | 1197 |
| 530 | Ga0501079_0062469 | 3300049741 | Bacteria | 2873 |
| 531 | Ga0501079_0402803 | 3300049741 | Bacteria | 1073 |
| 532 | Ga0501080_0010959 | 3300049742 | Bacteria | 8297 |
| 533 | Ga0501080_0035647 | 3300049742 | Bacteria | 4643 |
| 534 | Ga0501080_0545885 | 3300049742 | Bacteria | 1033 |
| 535 | Ga0501081_0748229 | 3300049743 | Bacteria | 734 |
| 536 | Ga0501083_0010562 | 3300049744 | Bacteria | 6499 |
| 537 | Ga0501083_0027023 | 3300049744 | Bacteria | 3963 |
| 538 | Ga0501035_0007240 | 3300049822 | Bacteria | 10383 |
| 539 | Ga0501035_0649016 | 3300049822 | Bacteria | 856 |
| 540 | Ga0501044_0005928 | 3300049823 | Bacteria | 13541 |
| 541 | Ga0501044_0097790 | 3300049823 | Bacteria | 2956 |
| 542 | Ga0501044_0110543 | 3300049823 | Bacteria | 2757 |
| 543 | Ga0501044_0552390 | 3300049823 | Bacteria | 1048 |
| 544 | Ga0501045_0214681 | 3300049824 | Bacteria | 1433 |
| 545 | Ga0501045_0379866 | 3300049824 | Bacteria | 1052 |
| 546 | Ga0501045_0436998 | 3300049824 | Bacteria | 973 |
| 547 | Ga0501045_0446288 | 3300049824 | Bacteria | 962 |
| 548 | nmdc:mga03683_12816_c1 | 3300050489 | Bacteria | 3070 |
| 549 | nmdc:mga03n38_16246_c1 | 3300050490 | Bacteria | 2893 |
| 550 | nmdc:mga03n38_5415_c1 | 3300050490 | Bacteria | 4345 |
| 551 | nmdc:mga03n38_5988_c1 | 3300050490 | Bacteria | 4191 |
| 552 | nmdc:mga00v17_142950_c1 | 3300050491 | Bacteria | 1535 |
| 553 | nmdc:mga00v17_77720_c1 | 3300050491 | Bacteria | 2067 |
| 554 | nmdc:mga00v17_96432_c1 | 3300050491 | Bacteria | 1863 |
| 555 | nmdc:mga0yw44_11665_c1 | 3300050492 | Bacteria | 4549 |
| 556 | nmdc:mga0yw44_204625_c1 | 3300050492 | Bacteria | 1304 |
| 557 | nmdc:mga0yw44_210284_c1 | 3300050492 | Bacteria | 1287 |
| 558 | nmdc:mga0yw44_261272_c1 | 3300050492 | Bacteria | 1154 |
| 559 | nmdc:mga0yw44_283166_c1 | 3300050492 | Bacteria | 1108 |
| 560 | nmdc:mga0yw44_353024_c1 | 3300050492 | Bacteria | 990 |
| 561 | nmdc:mga0yw44_39544_c1 | 3300050492 | Bacteria | 2798 |
| 562 | nmdc:mga0yw44_48178_c1 | 3300050492 | Bacteria | 2569 |
| 563 | nmdc:mga06z11_211351_c1 | 3300050494 | Bacteria | 1131 |
| 564 | nmdc:mga06z11_391716_c1 | 3300050494 | Bacteria | 835 |
| 565 | nmdc:mga04h51_10266_c1 | 3300050495 | Bacteria | 2568 |
| 566 | nmdc:mga07m45_17352_c1 | 3300050496 | Bacteria | 3865 |
| 567 | nmdc:mga07m45_2442_c1 | 3300050496 | Bacteria | 8724 |
| 568 | nmdc:mga09592_21517_c1 | 3300050508 | Bacteria | 5314 |
| 569 | nmdc:mga06r32_19000_c1 | 3300050510 | Bacteria | 6301 |
| 570 | Ga0495619_0385026 | 3300053085 | Bacteria | 969 |
| 571 | Ga0495619_0457292 | 3300053085 | Bacteria | 880 |
| 572 | Ga0500644_0000093 | 3300053088 | Bacteria | 55990 |
| 573 | Ga0500556_0000476 | 3300053104 | Bacteria | 27975 |
| 574 | Ga0500593_000182 | 3300053117 | Bacteria | 25634 |
| 575 | Ga0500573_0036006 | 3300053140 | Bacteria | 2857 |
| 576 | Ga0501084_0016035 | 3300054114 | Bacteria | 6218 |
| 577 | Ga0501084_0254818 | 3300054114 | Bacteria | 1481 |
| 578 | Ga0501084_0906769 | 3300054114 | Bacteria | 741 |
| 579 | Ga0501082_0006770 | 3300060353 | Bacteria | 9903 |
| 580 | Ga0501082_0060054 | 3300060353 | Bacteria | 3275 |
| 581 | Ga0501082_0141222 | 3300060353 | Bacteria | 2090 |
| 582 | Ga0466962_0085151 | 3300061719 | Bacteria | 1513 |
| 583 | Ga0530510_0409683 | 3300061734 | Bacteria | 1023 |
| 584 | 2585300159 | 2582581312 | Bacteria | 7308206 |
| 585 | 2643890282 | 2643221576 | Bacteria | 5214352 |
| 586 | 2643959338 | 2643221590 | Bacteria | 5214697 |
| 587 | 2644033210 | 2643221604 | Bacteria | 5014917 |
| 588 | 2644080680 | 2643221613 | Bacteria | 4622396 |
| 589 | 2644091214 | 2643221615 | Bacteria | 5487866 |
| 590 | 2644098273 | 2643221617 | Bacteria | 5139111 |
| 591 | 2644119000 | 2643221620 | Bacteria | 5134593 |
| 592 | 2644228798 | 2643221641 | Bacteria | 4490190 |
| 593 | 2644321017 | 2643221657 | Bacteria | 5490246 |
| 594 | 2644446837 | 2643221679 | Bacteria | 3839507 |
| 595 | 2644505002 | 2643221690 | Bacteria | 4654705 |
| 596 | 2644664003 | 2643221721 | Bacteria | 4486924 |
| 597 | 2729907162 | 2728369276 | Bacteria | 5610032 |
| 598 | 2740166241 | 2739367898 | Bacteria | 4367674 |
| 599 | 2760625428 | 2758568621 | Bacteria | 5967089 |
| 600 | 2774396519 | 2773857762 | Bacteria | 5971770 |
| 601 | 2809198185 | 2808606439 | Bacteria | 5952208 |
| 602 | 2812353143 | 2811994878 | Bacteria | 5992952 |
| 603 | 2857483304 | 2857481737 | Bacteria | 4761446 |
| 604 | 2887447105 | 2887443736 | Bacteria | 4426037 |
| 605 | 2891969229 | 2891968417 | Bacteria | 5821697 |
| 606 | 2919052867 | 2919051321 | Bacteria | 4210889 |
| 607 | 2932433727 | 2932431166 | Bacteria | 4215299 |
| 608 | 2935893153 | 2935890801 | Bacteria | 4593001 |
| 609 | 2946063525 | 2946059875 | Bacteria | 4386623 |
| 610 | 8004022816 | 8004021418 | Bacteria | 4313954 |
| 611 | 8004028859 | 8004025490 | Bacteria | 4327753 |
| 612 | 8033685415 | 8033684223 | Bacteria | 6906479 |
| 613 | 8054610087 | 8054609563 | Bacteria | 5170090 |
| 614 | 8056581219 | 8056579771 | Bacteria | 5840325 |
| 615 | Ga0501038_0442149 | |||
| 616 | JGI24740J21852_10012233 | |||
| 617 | JGI24740J21852_10020624 | |||
| 618 | JGI24739J22299_10011240 | |||
| 619 | JGI24739J22299_10068564 | |||
| 620 | Ga0055542_1002973 | |||
| 621 | Ga0065714_10077927 | |||
| 622 | Ga0070658_10006983 | |||
| 623 | Ga0070658_10008777 | |||
| 624 | Ga0070658_10547133 | |||
| 625 | Ga0070658_10790891 | |||
| 626 | Ga0070683_100002341 | |||
| 627 | Ga0070683_100004946 | |||
| 628 | Ga0070683_100418749 | |||
| 629 | Ga0070690_100494730 | |||
| 630 | Ga0070677_10085758 | |||
| 631 | Ga0068869_100130787 | |||
| 632 | Ga0070666_10438417 | |||
| 633 | Ga0070680_100316307 | |||
| 634 | Ga0070682_100007778 | |||
| 635 | Ga0070682_100064545 | |||
| 636 | Ga0070682_100438123 | |||
| 637 | Ga0068868_100024906 | |||
| 638 | Ga0070660_100014130 | |||
| 639 | Ga0070660_100027486 | |||
| 640 | Ga0070689_100585499 | |||
| 641 | Ga0070689_100720960 | |||
| 642 | Ga0070661_100574852 | |||
| 643 | Ga0070692_10006071 | |||
| 644 | Ga0070692_10011855 | |||
| 645 | Ga0070675_100385593 | |||
| 646 | Ga0070674_100228494 | |||
| 647 | Ga0070674_100714763 | |||
| 648 | Ga0070673_101163383 | |||
| 649 | Ga0070688_100051832 | |||
| 650 | Ga0070659_100032897 | |||
| 651 | Ga0070659_100115459 | |||
| 652 | Ga0070667_100151670 | |||
| 653 | Ga0070667_100205394 | |||
| 654 | Ga0070667_100213555 | |||
| 655 | Ga0070701_10008530 | |||
| 656 | Ga0070708_100332686 | |||
| 657 | Ga0070663_100116990 | |||
| 658 | Ga0070663_100416215 | |||
| 659 | Ga0070678_100116710 | |||
| 660 | Ga0070678_100185415 | |||
| 661 | Ga0070678_100236259 | |||
| 662 | Ga0070678_101291257 | |||
| 663 | Ga0068867_100029377 | |||
| 664 | Ga0070685_10417077 | |||
| 665 | Ga0070698_100021743 | |||
| 666 | Ga0070679_100467320 | |||
| 667 | Ga0070679_100741705 | |||
| 668 | Ga0070684_100004150 | |||
| 669 | Ga0070684_100033128 | |||
| 670 | Ga0068853_100046505 | |||
| 671 | Ga0070672_100095602 | |||
| 672 | Ga0070672_100297701 | |||
| 673 | Ga0070686_100237991 | |||
| 674 | Ga0070696_100018780 | |||
| 675 | Ga0070665_100000606 | |||
| 676 | Ga0070665_100058485 | |||
| 677 | Ga0070665_100441504 | |||
| 678 | Ga0070664_100088574 | |||
| 679 | Ga0070664_100242271 | |||
| 680 | Ga0068856_100509104 | |||
| 681 | Ga0070702_100171986 | |||
| 682 | Ga0070702_100458390 | |||
| 683 | Ga0068852_100005828 | |||
| 684 | Ga0068852_100216446 | |||
| 685 | Ga0068864_100020083 | |||
| 686 | Ga0068864_100713867 | |||
| 687 | Ga0068866_10023332 | |||
| 688 | Ga0068861_100048865 | |||
| 689 | Ga0068851_10164311 | |||
| 690 | Ga0068870_10017216 | |||
| 691 | Ga0068870_10045277 | |||
| 692 | Ga0068870_10260000 | |||
| 693 | Ga0068858_100055974 | |||
| 694 | Ga0068860_100120149 | |||
| 695 | Ga0068862_100407013 | |||
| 696 | Ga0081455_10058641 | |||
| 697 | Ga0075365_10001661 | |||
| 698 | Ga0075365_10001879 | |||
| 699 | Ga0075365_10053958 | |||
| 700 | Ga0075365_10352613 | |||
| 701 | Ga0075365_10496544 | |||
| 702 | Ga0075365_10695173 | |||
| 703 | Ga0075368_10000755 | |||
| 704 | Ga0075363_100006643 | |||
| 705 | Ga0075364_10003491 | |||
| 706 | Ga0075364_10034131 | |||
| 707 | Ga0075364_10121381 | |||
| 708 | Ga0075364_10228859 | |||
| 709 | Ga0075364_10525638 | |||
| 710 | Ga0075367_10002239 | |||
| 711 | Ga0097621_100365009 | |||
| 712 | Ga0075370_10005014 | |||
| 713 | Ga0075428_100961192 | |||
| 714 | Ga0075431_100718742 | |||
| 715 | Ga0075429_100074524 | |||
| 716 | Ga0111539_10102121 | |||
| 717 | Ga0111539_11149425 | |||
| 718 | Ga0105245_10001197 | |||
| 719 | Ga0105245_10013078 | |||
| 720 | Ga0105245_10112865 | |||
| 721 | Ga0114129_10839778 | |||
| 722 | Ga0105243_10005660 | |||
| 723 | Ga0105243_10028270 | |||
| 724 | Ga0105243_10072819 | |||
| 725 | Ga0105243_10833767 | |||
| 726 | Ga0105242_10097067 | |||
| 727 | Ga0105242_10107776 | |||
| 728 | Ga0105242_11085005 | |||
| 729 | Ga0105248_10132406 | |||
| 730 | Ga0105248_10142789 | |||
| 731 | Ga0105238_10166563 | |||
| 732 | Ga0105238_10169945 | |||
| 733 | Ga0105238_10761935 | |||
| 734 | Ga0105249_10099583 | |||
| 735 | Ga0105249_10549672 | |||
| 736 | Ga0105239_10001341 | |||
| 737 | Ga0105239_10125024 | |||
| 738 | Ga0105239_10135735 | |||
| 739 | Ga0105239_10377508 | |||
| 740 | Ga0105246_10001074 | |||
| 741 | Ga0105246_10247828 | |||
| 742 | Ga0105246_10390475 | |||
| 743 | Ga0157322_1003593 | |||
| 744 | Ga0157313_1016160 | |||
| 745 | Ga0157371_10338040 | |||
| 746 | Ga0157370_11084420 | |||
| 747 | Ga0157378_10725738 | |||
| 748 | Ga0163162_10355027 | |||
| 749 | Ga0163162_11443268 | |||
| 750 | Ga0157372_10002413 | |||
| 751 | Ga0157372_10303659 | |||
| 752 | Ga0157372_10348283 | |||
| 753 | Ga0157372_10587569 | |||
| 754 | Ga0157372_10714650 | |||
| 755 | Ga0157372_11625346 | |||
| 756 | Ga0157375_10054251 | |||
| 757 | Ga0157375_10265303 | |||
| 758 | Ga0157375_10533564 | |||
| 759 | Ga0157375_10781492 | |||
| 760 | Ga0163163_10226706 | |||
| 761 | Ga0163163_10591933 | |||
| 762 | Ga0163163_10619740 | |||
| 763 | Ga0157380_10286609 | |||
| 764 | Ga0157380_10592238 | |||
| 765 | Ga0157380_10879707 | |||
| 766 | Ga0157377_10049561 | |||
| 767 | Ga0157377_10087470 | |||
| 768 | Ga0157377_10482308 | |||
| 769 | Ga0157379_10070517 | |||
| 770 | Ga0157376_10179509 | |||
| 771 | Ga0157376_10413331 | |||
| 772 | Ga0157376_10503587 | |||
| 773 | Ga0163161_10199130 | |||
| 774 | Ga0163161_10300485 | |||
| 775 | Ga0163161_10383642 | |||
| 776 | Ga0206355_1638430 | |||
| 777 | Ga0206354_11058171 | |||
| 778 | Ga0206353_10717811 | |||
| 779 | Ga0206353_11275066 | |||
| 780 | Ga0206353_11908677 | |||
| 781 | Ga0154015_1578179 | |||
| 782 | Ga0209148_1002946 | |||
| 783 | Ga0207656_10185256 | |||
| 784 | Ga0207642_10019038 | |||
| 785 | Ga0207688_10070644 | |||
| 786 | Ga0207688_10096616 | |||
| 787 | Ga0207688_10422310 | |||
| 788 | Ga0207680_10235411 | |||
| 789 | Ga0207647_10007079 | |||
| 790 | Ga0207647_10053784 | |||
| 791 | Ga0207643_10019980 | |||
| 792 | Ga0207643_10061233 | |||
| 793 | Ga0207643_10193844 | |||
| 794 | Ga0207705_10152584 | |||
| 795 | Ga0207705_10567721 | |||
| 796 | Ga0207707_10616593 | |||
| 797 | Ga0207671_10723461 | |||
| 798 | Ga0207657_10070936 | |||
| 799 | Ga0207652_10005990 | |||
| 800 | Ga0207652_10285550 | |||
| 801 | Ga0207652_10636286 | |||
| 802 | Ga0207652_10831599 | |||
| 803 | Ga0207687_10000975 | |||
| 804 | Ga0207644_10367146 | |||
| 805 | Ga0207644_10509067 | |||
| 806 | Ga0207690_10020386 | |||
| 807 | Ga0207690_10147553 | |||
| 808 | Ga0207686_10028564 | |||
| 809 | Ga0207686_10237749 | |||
| 810 | Ga0207686_10241394 | |||
| 811 | Ga0207709_10019706 | |||
| 812 | Ga0207709_10549833 | |||
| 813 | Ga0207704_10064582 | |||
| 814 | Ga0207704_10157422 | |||
| 815 | Ga0207691_10056406 | |||
| 816 | Ga0207691_10184428 | |||
| 817 | Ga0207711_10090767 | |||
| 818 | Ga0207711_10531205 | |||
| 819 | Ga0207689_10121423 | |||
| 820 | Ga0207689_10233425 | |||
| 821 | Ga0207661_10033929 | |||
| 822 | Ga0207661_10161869 | |||
| 823 | Ga0207661_10163546 | |||
| 824 | Ga0207679_10039966 | |||
| 825 | Ga0207679_10409392 | |||
| 826 | Ga0207679_11033656 | |||
| 827 | Ga0207712_10238268 | |||
| 828 | Ga0207668_10086534 | |||
| 829 | Ga0207640_10101279 | |||
| 830 | Ga0207658_10014306 | |||
| 831 | Ga0207658_10359018 | |||
| 832 | Ga0207658_10738088 | |||
| 833 | Ga0207677_10616986 | |||
| 834 | Ga0207703_10384978 | |||
| 835 | Ga0207639_10148682 | |||
| 836 | Ga0207639_10365257 | |||
| 837 | Ga0207678_10058521 | |||
| 838 | Ga0207678_10276631 | |||
| 839 | Ga0207708_10120721 | |||
| 840 | Ga0207708_10257278 | |||
| 841 | Ga0207702_10068271 | |||
| 842 | Ga0207702_10330043 | |||
| 843 | Ga0207648_10019029 | |||
| 844 | Ga0207676_10054202 | |||
| 845 | Ga0207676_10222413 | |||
| 846 | Ga0207674_10077304 | |||
| 847 | Ga0207674_10348305 | |||
| 848 | Ga0207675_100015567 | |||
| 849 | Ga0207675_100323468 | |||
| 850 | Ga0207675_100572595 | |||
| 851 | Ga0207683_10227787 | |||
| 852 | Ga0207683_10312795 | |||
| 853 | Ga0207683_10882838 | |||
| 854 | Ga0207683_10984044 | |||
| 855 | Ga0207698_10121329 | |||
| 856 | Ga0207698_10173296 | |||
| 857 | Ga0207698_10855393 | |||
| 858 | Ga0209813_10014234 | |||
| 859 | Ga0268266_10000339 | |||
| 860 | Ga0268266_10049149 | |||
| 861 | Ga0268266_10052078 | |||
| 862 | Ga0268265_10149910 | |||
| 863 | Ga0268264_10099057 | |||
| 864 | Ga0314311_1115994 | |||
| 865 | Ga0316179_1059643 | |||
| 866 | Ga0316181_1004558 | |||
| 867 | Ga0316181_1290401 | |||
| 868 | Ga0307513_10053179 | |||
| 869 | Ga0307513_10246378 | |||
| 870 | Ga0307516_10229463 | |||
| 871 | Ga0307405_10335075 | |||
| 872 | Ga0307413_10746730 | |||
| 873 | Ga0307413_11188363 | |||
| 874 | Ga0307410_10022295 | |||
| 875 | Ga0307410_10600775 | |||
| 876 | Ga0307406_10286693 | |||
| 877 | Ga0307407_10002099 | |||
| 878 | Ga0307407_10375845 | |||
| 879 | Ga0307412_10530296 | |||
| 880 | Ga0307409_100007425 | |||
| 881 | Ga0307409_100013359 | |||
| 882 | Ga0307409_100320139 | |||
| 883 | Ga0307416_100615821 | |||
| 884 | Ga0307411_10911211 | |||
| 885 | Ga0307415_100273923 | |||
| 886 | Ga0307415_100623952 | |||
| 887 | Ga0373941_0053866 | |||
| 888 | Ga0316574_0171341 | |||
| 889 | Ga0395899_0460525 | |||
| 890 | Ga0395900_0013014 | |||
| 891 | Ga0395898_0004220 | |||
| 892 | Ga0395898_0555001 | |||
| 893 | Ga0395898_0617714 | |||
| 894 | Ga0395905_0266939 | |||
| 895 | Ga0436364_0601870 | |||
| 896 | Ga0395901_0022327 | |||
| 897 | Ga0395901_0092752 | |||
| 898 | Ga0395901_0446094 | |||
| 899 | Ga0395901_0446455 | |||
| 900 | Ga0395901_0594356 | |||
| 901 | Ga0439438_021489 | |||
| 902 | Ga0439447_020175 | |||
| 903 | Ga0439465_0095342 | |||
| 904 | Ga0451791_0367629 | |||
| 905 | Ga0451793_1760822 | |||
| 906 | Ga0451797_0009474 | |||
| 907 | Ga0451795_0984346 | |||
| 908 | Ga0451798_0992359 | |||
| 909 | Ga0451802_1992058 | |||
| 910 | Ga0451833_0001040 | |||
| 911 | Ga0451837_0073120 | |||
| 912 | Ga0451839_0931637 | |||
| 913 | Ga0451851_1295780 | |||
| 914 | Ga0451843_0552627 | |||
| 915 | Ga0451853_0068405 | |||
| 916 | Ga0451853_1568239 | |||
| 917 | Ga0451853_3364545 | |||
| 918 | Ga0439431_0001100 | |||
| 919 | Ga0450907_012966 | |||
| 920 | Ga0439434_0006964 | |||
| 921 | Ga0466969_0147541 | |||
| 922 | Ga0466972_0012738 | |||
| 923 | Ga0466965_0009968 | |||
| 924 | Ga0466965_0069760 | |||
| 925 | Ga0466965_0077074 | |||
| 926 | Ga0466966_0002232 | |||
| 927 | Ga0466966_0176475 | |||
| 928 | Ga0466966_0408593 | |||
| 929 | Ga0466961_0031192 | |||
| 930 | Ga0466963_0091333 | |||
| 931 | Ga0466963_0133261 | |||
| 932 | Ga0466963_0160892 | |||
| 933 | Ga0466963_0299280 | |||
| 934 | Ga0466964_0049049 | |||
| 935 | Ga0466971_0054838 | |||
| 936 | Ga0466971_0091734 | |||
| 937 | Ga0466971_0121766 | |||
| 938 | Ga0466968_0043669 | |||
| 939 | Ga0466968_0079664 | |||
| 940 | Ga0466970_0004715 | |||
| 941 | Ga0466970_0011782 | |||
| 942 | Ga0466970_0197478 | |||
| 943 | Ga0466970_0227946 | |||
| 944 | Ga0466957_0086798 | |||
| 945 | Ga0466960_0001672 | |||
| 946 | Ga0466960_0043179 | |||
| 947 | Ga0466960_0088596 | |||
| 948 | Ga0466960_0186812 | |||
| 949 | Ga0466960_0672939 | |||
| 950 | Ga0466959_0065369 | |||
| 951 | Ga0466959_0231391 | |||
| 952 | Ga0451576_0186163 | |||
| 953 | Ga0466958_0030192 | |||
| 954 | Ga0466958_0225392 | |||
| 955 | Ga0466958_0500838 | |||
| 956 | Ga0466967_0004034 | |||
| 957 | Ga0466967_0036244 | |||
| 958 | Ga0466967_0041142 | |||
| 959 | Ga0466967_0048066 | |||
| 960 | Ga0466967_0064983 | |||
| 961 | Ga0466967_0071103 | |||
| 962 | Ga0466967_0192089 | |||
| 963 | Ga0466967_0332473 | |||
| 964 | Ga0466967_0532229 | |||
| 965 | Ga0495627_009109 | |||
| 966 | Ga0495627_064663 | |||
| 967 | Ga0495603_0014559 | |||
| 968 | Ga0495603_0015645 | |||
| 969 | Ga0495603_0042236 | |||
| 970 | Ga0495603_0090766 | |||
| 971 | Ga0495629_0028468 | |||
| 972 | Ga0495629_0439612 | |||
| 973 | Ga0495605_0230240 | |||
| 974 | Ga0495585_0016493 | |||
| 975 | Ga0495594_0046976 | |||
| 976 | Ga0495644_0374680 | |||
| 977 | Ga0495622_0177535 | |||
| 978 | Ga0495622_0335732 | |||
| 979 | Ga0495668_0397028 | |||
| 980 | Ga0495625_0236807 | |||
| 981 | Ga0495659_0153137 | |||
| 982 | Ga0495657_0275003 | |||
| 983 | Ga0495658_0105125 | |||
| 984 | Ga0495613_0002046 | |||
| 985 | Ga0495600_0053470 | |||
| 986 | Ga0495581_0138514 | |||
| 987 | Ga0495676_0003194 | |||
| 988 | Ga0495685_011792 | |||
| 989 | Ga0495593_0033151 | |||
| 990 | Ga0495614_0009974 | |||
| 991 | Ga0496100_0497226 | |||
| 992 | Ga0496101_0002279 | |||
| 993 | Ga0496101_0037283 | |||
| 994 | Ga0496101_0362809 | |||
| 995 | Ga0496101_0853700 | |||
| 996 | Ga0496102_0004783 | |||
| 997 | Ga0496102_0008685 | |||
| 998 | Ga0496102_0147222 | |||
| 999 | Ga0496102_0290238 | |||
| 1000 | Ga0496103_0091386 | |||
| 1001 | Ga0496103_0290125 | |||
| 1002 | Ga0496104_0003236 | |||
| 1003 | Ga0496104_0659864 | |||
| 1004 | Ga0496104_0820387 | |||
| 1005 | Ga0496105_0002891 | |||
| 1006 | Ga0496105_0075963 | |||
| 1007 | Ga0496105_0101748 | |||
| 1008 | Ga0496105_0180866 | |||
| 1009 | Ga0496106_0003302 | |||
| 1010 | Ga0496106_0023140 | |||
| 1011 | Ga0496106_0055184 | |||
| 1012 | Ga0496106_0119469 | |||
| 1013 | Ga0496106_0825247 | |||
| 1014 | Ga0496106_0830818 | |||
| 1015 | Ga0496107_0010526 | |||
| 1016 | Ga0496107_0081450 | |||
| 1017 | Ga0496107_0251492 | |||
| 1018 | Ga0496107_0563268 | |||
| 1019 | Ga0496108_0004950 | |||
| 1020 | Ga0496108_0078393 | |||
| 1021 | Ga0496108_0101068 | |||
| 1022 | Ga0496108_0143223 | |||
| 1023 | Ga0496108_0167239 | |||
| 1024 | Ga0496108_0237598 | |||
| 1025 | Ga0496108_0305575 | |||
| 1026 | Ga0496108_0455757 | |||
| 1027 | Ga0496108_0593533 | |||
| 1028 | Ga0496108_0870201 | |||
| 1029 | Ga0496109_0035217 | |||
| 1030 | Ga0496109_0072140 | |||
| 1031 | Ga0496109_0095488 | |||
| 1032 | Ga0496109_0207828 | |||
| 1033 | Ga0496109_0436409 | |||
| 1034 | Ga0496109_0695997 | |||
| 1035 | Ga0496110_0004658 | |||
| 1036 | Ga0496110_0015561 | |||
| 1037 | Ga0496110_0040125 | |||
| 1038 | Ga0496110_0198172 | |||
| 1039 | Ga0496111_0000445 | |||
| 1040 | Ga0496111_0052115 | |||
| 1041 | Ga0496111_0099747 | |||
| 1042 | Ga0496111_0472035 | |||
| 1043 | Ga0496113_0023963 | |||
| 1044 | Ga0496114_0012364 | |||
| 1045 | Ga0496114_0038487 | |||
| 1046 | Ga0496114_0087471 | |||
| 1047 | Ga0496114_0115706 | |||
| 1048 | Ga0496114_0178109 | |||
| 1049 | Ga0496114_0324125 | |||
| 1050 | Ga0496114_0329043 | |||
| 1051 | Ga0496114_0736731 | |||
| 1052 | Ga0496115_0004962 | |||
| 1053 | Ga0496115_0155631 | |||
| 1054 | Ga0496118_0033332 | |||
| 1055 | Ga0496126_0036899 | |||
| 1056 | Ga0501306_026927 | |||
| 1057 | Ga0501309_007958 | |||
| 1058 | Ga0501305_033203 | |||
| 1059 | Ga0501305_040962 | |||
| 1060 | Ga0501307_032963 | |||
| 1061 | Ga0501311_005359 | |||
| 1062 | Ga0501312_023664 | |||
| 1063 | Ga0501317_009894 | |||
| 1064 | Ga0501318_006519 | |||
| 1065 | Ga0501321_001372 | |||
| 1066 | Ga0501031_0016784 | |||
| 1067 | Ga0501031_0181159 | |||
| 1068 | Ga0501031_0295945 | |||
| 1069 | Ga0501031_0325219 | |||
| 1070 | Ga0501031_0352050 | |||
| 1071 | Ga0501032_0000979 | |||
| 1072 | Ga0501032_0008023 | |||
| 1073 | Ga0501032_0224573 | |||
| 1074 | Ga0501034_0103923 | |||
| 1075 | Ga0501034_0155678 | |||
| 1076 | Ga0501034_0269759 | |||
| 1077 | Ga0501034_0523235 | |||
| 1078 | Ga0501036_0037705 | |||
| 1079 | Ga0501036_0117853 | |||
| 1080 | Ga0501036_0142234 | |||
| 1081 | Ga0501036_0603074 | |||
| 1082 | Ga0501037_0004167 | |||
| 1083 | Ga0501037_0154466 | |||
| 1084 | Ga0501037_0175091 | |||
| 1085 | Ga0501038_0001575 | |||
| 1086 | Ga0501038_0005029 | |||
| 1087 | Ga0501038_0190064 | |||
| 1088 | Ga0501038_0419576 | |||
| 1089 | Ga0501039_0006688 | |||
| 1090 | Ga0501039_0188907 | |||
| 1091 | Ga0501039_0200319 | |||
| 1092 | Ga0501039_0229699 | |||
| 1093 | Ga0501039_0238528 | |||
| 1094 | Ga0501041_0202109 | |||
| 1095 | Ga0501042_0144878 | |||
| 1096 | Ga0501042_0220601 | |||
| 1097 | Ga0501042_0547110 | |||
| 1098 | Ga0501043_0004270 | |||
| 1099 | Ga0501043_0016979 | |||
| 1100 | Ga0501043_0056592 | |||
| 1101 | Ga0501043_0530054 | |||
| 1102 | Ga0501046_0000862 | |||
| 1103 | Ga0501046_0002697 | |||
| 1104 | Ga0501046_0346820 | |||
| 1105 | Ga0501047_0152323 | |||
| 1106 | Ga0501047_0240702 | |||
| 1107 | Ga0501047_0297051 | |||
| 1108 | Ga0501048_0019702 | |||
| 1109 | Ga0501048_0664852 | |||
| 1110 | Ga0501067_0002023 | |||
| 1111 | Ga0501067_0002257 | |||
| 1112 | Ga0501067_0028818 | |||
| 1113 | Ga0501067_0083337 | |||
| 1114 | Ga0501067_0344514 | |||
| 1115 | Ga0501067_0535172 | |||
| 1116 | Ga0501068_0012839 | |||
| 1117 | Ga0501068_0063830 | |||
| 1118 | Ga0501069_0065288 | |||
| 1119 | Ga0501069_0086622 | |||
| 1120 | Ga0501069_0182805 | |||
| 1121 | Ga0501070_0001826 | |||
| 1122 | Ga0501070_0024172 | |||
| 1123 | Ga0501070_0084914 | |||
| 1124 | Ga0501070_0373119 | |||
| 1125 | Ga0501070_0713818 | |||
| 1126 | Ga0501071_0003531 | |||
| 1127 | Ga0501071_0083759 | |||
| 1128 | Ga0501071_0227395 | |||
| 1129 | Ga0501071_0236721 | |||
| 1130 | Ga0501071_0517937 | |||
| 1131 | Ga0501072_0029418 | |||
| 1132 | Ga0501073_0003986 | |||
| 1133 | Ga0501073_0038917 | |||
| 1134 | Ga0501073_0049858 | |||
| 1135 | Ga0501073_0067981 | |||
| 1136 | Ga0501074_0001928 | |||
| 1137 | Ga0501074_0044342 | |||
| 1138 | Ga0501074_0073731 | |||
| 1139 | Ga0501074_0119705 | |||
| 1140 | Ga0501074_0130817 | |||
| 1141 | Ga0501074_0170149 | |||
| 1142 | Ga0501074_0343529 | |||
| 1143 | Ga0501076_0359166 | |||
| 1144 | Ga0501079_0062469 | |||
| 1145 | Ga0501079_0402803 | |||
| 1146 | Ga0501080_0010959 | |||
| 1147 | Ga0501080_0035647 | |||
| 1148 | Ga0501080_0545885 | |||
| 1149 | Ga0501081_0748229 | |||
| 1150 | Ga0501083_0010562 | |||
| 1151 | Ga0501083_0027023 | |||
| 1152 | Ga0501035_0007240 | |||
| 1153 | Ga0501035_0649016 | |||
| 1154 | Ga0501044_0005928 | |||
| 1155 | Ga0501044_0097790 | |||
| 1156 | Ga0501044_0110543 | |||
| 1157 | Ga0501044_0552390 | |||
| 1158 | Ga0501045_0214681 | |||
| 1159 | Ga0501045_0379866 | |||
| 1160 | Ga0501045_0436998 | |||
| 1161 | Ga0501045_0446288 | |||
| 1162 | nmdc:mga03683_12816_c1 | |||
| 1163 | nmdc:mga03n38_16246_c1 | |||
| 1164 | nmdc:mga03n38_5415_c1 | |||
| 1165 | nmdc:mga03n38_5988_c1 | |||
| 1166 | nmdc:mga00v17_142950_c1 | |||
| 1167 | nmdc:mga00v17_77720_c1 | |||
| 1168 | nmdc:mga00v17_96432_c1 | |||
| 1169 | nmdc:mga0yw44_11665_c1 | |||
| 1170 | nmdc:mga0yw44_204625_c1 | |||
| 1171 | nmdc:mga0yw44_210284_c1 | |||
| 1172 | nmdc:mga0yw44_261272_c1 | |||
| 1173 | nmdc:mga0yw44_283166_c1 | |||
| 1174 | nmdc:mga0yw44_353024_c1 | |||
| 1175 | nmdc:mga0yw44_39544_c1 | |||
| 1176 | nmdc:mga0yw44_48178_c1 | |||
| 1177 | nmdc:mga06z11_211351_c1 | |||
| 1178 | nmdc:mga06z11_391716_c1 | |||
| 1179 | nmdc:mga04h51_10266_c1 | |||
| 1180 | nmdc:mga07m45_17352_c1 | |||
| 1181 | nmdc:mga07m45_2442_c1 | |||
| 1182 | nmdc:mga09592_21517_c1 | |||
| 1183 | nmdc:mga06r32_19000_c1 | |||
| 1184 | Ga0495619_0385026 | |||
| 1185 | Ga0495619_0457292 | |||
| 1186 | Ga0500644_0000093 | |||
| 1187 | Ga0500556_0000476 | |||
| 1188 | Ga0500593_000182 | |||
| 1189 | Ga0500573_0036006 | |||
| 1190 | Ga0501084_0016035 | |||
| 1191 | Ga0501084_0254818 | |||
| 1192 | Ga0501084_0906769 | |||
| 1193 | Ga0501082_0006770 | |||
| 1194 | Ga0501082_0060054 | |||
| 1195 | Ga0501082_0141222 | |||
| 1196 | Ga0466962_0085151 | |||
| 1197 | Ga0530510_0409683 | |||
| 1198 | 2585300159 | |||
| 1199 | 2643890282 | |||
| 1200 | 2643959338 | |||
| 1201 | 2644033210 | |||
| 1202 | 2644080680 | |||
| 1203 | 2644091214 | |||
| 1204 | 2644098273 | |||
| 1205 | 2644119000 | |||
| 1206 | 2644228798 | |||
| 1207 | 2644321017 | |||
| 1208 | 2644446837 | |||
| 1209 | 2644505002 | |||
| 1210 | 2644664003 | |||
| 1211 | 2729907162 | |||
| 1212 | 2740166241 | |||
| 1213 | 2760625428 | |||
| 1214 | 2774396519 | |||
| 1215 | 2809198185 | |||
| 1216 | 2812353143 | |||
| 1217 | 2857483304 | |||
| 1218 | 2887447105 | |||
| 1219 | 2891969229 | |||
| 1220 | 2919052867 | |||
| 1221 | 2932433727 | |||
| 1222 | 2935893153 | |||
| 1223 | 2946063525 | |||
| 1224 | 8004022816 | |||
| 1225 | 8004028859 | |||
| 1226 | 8033685415 | |||
| 1227 | 8054610087 | |||
| 1228 | 8056581219 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.9838 | 4 | 190 |
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9822 | 4 | 177 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9743 | 4 | 190 |
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.9635 | 4 | 190 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9592 | 4 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54V95_265_452_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9532 | 64 | 190 | 3.40.50.1470 |
| 4q55B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9416 | 5 | 190 | 3.40.50.1470 |
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9324 | 6 | 190 | 3.40.50.1470 |
| 1rynA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9283 | 3 | 189 | 3.40.50.1470 |
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9244 | 1 | 189 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M9BG41-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9915 | 2 | 190 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A7T5WPR7-F1-model_v4 | deleted | 0.9906 | 7 | 189 |
|
| AF-A0A4R2DKB0-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9905 | 1 | 188 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-D6Y8B0-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9893 | 5 | 189 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A354XPW4-F1-model_v4 | deleted | 0.9891 | 5 | 190 |
|