F469316
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 613 | 292 | 605 | 315 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2855730933|2855731676 |
| Length | 354 |
| Sequence | VRATLASRVACVTPIAGIARCIANCIAHYARHARAALITAGTLGLTLTATAATAAGYPNNPIRIIVPFAAGGTSDLVTRILAQAMGTELKVAVIVDNRPGAGGNIGSELVARAAPDGYTLLMGTVATHGINASLYKSMPFDPVKDFAPVSLVASTPSVLEVNPALPVKSVAELIAYAKAHPGKLYFGSAGNGSSHHLAGELFDSMAGVKMTHVPYRGTAAAVTDTMGGQVQVIFDTLPSAMPFVKSGQLRALAVTSAQRDPALPDLPTLAEAGLPGYEVGSWYGLLAPAGTPPEIVDKVSKLVAELVRRPDIKQKLQAQGATAVGSTPAEFATHIAGEIKKWRPVVQESGARVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 2 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 3 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 4 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 5 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 6 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 272 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 282 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 283 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 284 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 286 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 287 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 288 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 292 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.69 |
| Metatranscriptomes | 0 |
| Isolates | 1.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.57 |
| Nodule | 0.33 |
| Rhizoplane | 3.26 |
| Rhizosphere | 90.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000075 | 3300003187 | Bacteria | 135181 |
| 2 | Ga0065712_10150630 | 3300005290 | Bacteria | 1373 |
| 3 | Ga0065707_10088917 | 3300005295 | Bacteria | 4513 |
| 4 | Ga0070658_10076319 | 3300005327 | Unclassified | 2749 |
| 5 | Ga0070658_10203236 | 3300005327 | Bacteria | 1672 |
| 6 | Ga0070676_10019688 | 3300005328 | Bacteria | 3759 |
| 7 | Ga0070676_10091785 | 3300005328 | Unclassified | 1862 |
| 8 | Ga0070683_100008196 | 3300005329 | Bacteria | 8875 |
| 9 | Ga0070683_100049514 | 3300005329 | Unclassified | 3886 |
| 10 | Ga0070683_100220487 | 3300005329 | Unclassified | 1803 |
| 11 | Ga0070690_100003566 | 3300005330 | Bacteria | 8541 |
| 12 | Ga0070690_100019776 | 3300005330 | Bacteria | 4095 |
| 13 | Ga0070690_100067937 | 3300005330 | Bacteria | 2311 |
| 14 | Ga0070670_100003427 | 3300005331 | Bacteria | 13164 |
| 15 | Ga0070670_100008142 | 3300005331 | Bacteria | 8923 |
| 16 | Ga0070670_100078639 | 3300005331 | Unclassified | 2833 |
| 17 | Ga0070670_100181329 | 3300005331 | Unclassified | 1828 |
| 18 | Ga0070670_100192338 | 3300005331 | Bacteria | 1772 |
| 19 | Ga0070670_100259926 | 3300005331 | Unclassified | 1513 |
| 20 | Ga0070677_10018484 | 3300005333 | Bacteria | 2510 |
| 21 | Ga0070677_10023294 | 3300005333 | Bacteria | 2292 |
| 22 | Ga0070677_10075123 | 3300005333 | Bacteria | 1431 |
| 23 | Ga0068869_100000262 | 3300005334 | Bacteria | 27673 |
| 24 | Ga0068869_100004150 | 3300005334 | Bacteria | 8986 |
| 25 | Ga0068869_100245364 | 3300005334 | Bacteria | 1428 |
| 26 | Ga0070666_10013740 | 3300005335 | Bacteria | 5141 |
| 27 | Ga0070666_10042430 | 3300005335 | Bacteria | 3044 |
| 28 | Ga0070680_100152001 | 3300005336 | Bacteria | 1943 |
| 29 | Ga0070682_100001657 | 3300005337 | Bacteria | 12385 |
| 30 | Ga0068868_100025100 | 3300005338 | Bacteria | 4527 |
| 31 | Ga0068868_100104231 | 3300005338 | Bacteria | 2298 |
| 32 | Ga0068868_100226871 | 3300005338 | Unclassified | 1566 |
| 33 | Ga0068868_100244961 | 3300005338 | Bacteria | 1507 |
| 34 | Ga0070689_100007621 | 3300005340 | Bacteria | 7580 |
| 35 | Ga0070689_100041882 | 3300005340 | Bacteria | 3515 |
| 36 | Ga0070689_100137134 | 3300005340 | Bacteria | 1965 |
| 37 | Ga0070691_10002481 | 3300005341 | Bacteria | 8203 |
| 38 | Ga0070687_100000189 | 3300005343 | Bacteria | 21407 |
| 39 | Ga0070687_100035873 | 3300005343 | Bacteria | 2467 |
| 40 | Ga0070661_100001413 | 3300005344 | Bacteria | 16755 |
| 41 | Ga0070661_100010643 | 3300005344 | Bacteria | 6401 |
| 42 | Ga0070661_100100592 | 3300005344 | Bacteria | 2149 |
| 43 | Ga0070661_100148343 | 3300005344 | Unclassified | 1772 |
| 44 | Ga0070661_100173043 | 3300005344 | Bacteria | 1640 |
| 45 | Ga0070661_100255867 | 3300005344 | Unclassified | 1352 |
| 46 | Ga0070692_10014109 | 3300005345 | Bacteria | 3742 |
| 47 | Ga0070668_100032129 | 3300005347 | Bacteria | 3995 |
| 48 | Ga0070668_100088437 | 3300005347 | Bacteria | 2439 |
| 49 | Ga0070669_100020709 | 3300005353 | Bacteria | 4698 |
| 50 | Ga0070669_100105300 | 3300005353 | Bacteria | 2134 |
| 51 | Ga0070675_100001164 | 3300005354 | Bacteria | 19023 |
| 52 | Ga0070675_100007866 | 3300005354 | Bacteria | 8261 |
| 53 | Ga0070675_100011711 | 3300005354 | Bacteria | 6873 |
| 54 | Ga0070675_100015675 | 3300005354 | Bacteria | 5998 |
| 55 | Ga0070675_100029983 | 3300005354 | Bacteria | 4389 |
| 56 | Ga0070675_100055090 | 3300005354 | Unclassified | 3273 |
| 57 | Ga0070675_100089147 | 3300005354 | Bacteria | 2582 |
| 58 | Ga0070671_100003945 | 3300005355 | Bacteria | 11675 |
| 59 | Ga0070671_100051833 | 3300005355 | Unclassified | 3413 |
| 60 | Ga0070671_100116052 | 3300005355 | Unclassified | 2251 |
| 61 | Ga0070674_100102328 | 3300005356 | Bacteria | 2089 |
| 62 | Ga0070674_100107416 | 3300005356 | Bacteria | 2043 |
| 63 | Ga0070674_100184445 | 3300005356 | Bacteria | 1601 |
| 64 | Ga0070673_100001390 | 3300005364 | Bacteria | 14156 |
| 65 | Ga0070673_100003829 | 3300005364 | Bacteria | 9436 |
| 66 | Ga0070673_100029732 | 3300005364 | Bacteria | 4077 |
| 67 | Ga0070673_100036888 | 3300005364 | Bacteria | 3721 |
| 68 | Ga0070673_100130877 | 3300005364 | Bacteria | 2105 |
| 69 | Ga0070673_100148629 | 3300005364 | Bacteria | 1982 |
| 70 | Ga0070673_100182610 | 3300005364 | Unclassified | 1797 |
| 71 | Ga0070688_100031599 | 3300005365 | Bacteria | 3186 |
| 72 | Ga0070688_100097047 | 3300005365 | Bacteria | 1937 |
| 73 | Ga0070688_100154518 | 3300005365 | Bacteria | 1571 |
| 74 | Ga0070659_100230114 | 3300005366 | Bacteria | 1532 |
| 75 | Ga0070667_100037677 | 3300005367 | Unclassified | 4054 |
| 76 | Ga0070667_100117532 | 3300005367 | Bacteria | 2310 |
| 77 | Ga0070667_100151652 | 3300005367 | Bacteria | 2036 |
| 78 | Ga0070667_100184171 | 3300005367 | Bacteria | 1848 |
| 79 | Ga0070667_100244664 | 3300005367 | Bacteria | 1602 |
| 80 | Ga0070709_10191406 | 3300005434 | Bacteria | 1443 |
| 81 | Ga0070714_100013143 | 3300005435 | Bacteria | 6629 |
| 82 | Ga0070701_10106445 | 3300005438 | Bacteria | 1561 |
| 83 | Ga0070705_100000307 | 3300005440 | Bacteria | 28982 |
| 84 | Ga0070705_100003253 | 3300005440 | Bacteria | 7985 |
| 85 | Ga0070705_100164985 | 3300005440 | Bacteria | 1485 |
| 86 | Ga0070700_100000145 | 3300005441 | Bacteria | 42177 |
| 87 | Ga0070700_100035152 | 3300005441 | Bacteria | 3031 |
| 88 | Ga0070694_100011291 | 3300005444 | Bacteria | 5530 |
| 89 | Ga0070708_100000371 | 3300005445 | Bacteria | 33951 |
| 90 | Ga0070678_100002266 | 3300005456 | Bacteria | 10472 |
| 91 | Ga0070678_100011313 | 3300005456 | Bacteria | 5498 |
| 92 | Ga0070678_100018760 | 3300005456 | Bacteria | 4491 |
| 93 | Ga0070678_100070057 | 3300005456 | Bacteria | 2620 |
| 94 | Ga0070678_100074615 | 3300005456 | Bacteria | 2550 |
| 95 | Ga0070678_100173458 | 3300005456 | Bacteria | 1758 |
| 96 | Ga0070678_100269644 | 3300005456 | Bacteria | 1435 |
| 97 | Ga0070662_100016778 | 3300005457 | Bacteria | 4922 |
| 98 | Ga0070662_100121081 | 3300005457 | Unclassified | 2006 |
| 99 | Ga0070681_10000916 | 3300005458 | Bacteria | 24937 |
| 100 | Ga0070681_10016128 | 3300005458 | Bacteria | 7448 |
| 101 | Ga0070681_10086470 | 3300005458 | Unclassified | 3088 |
| 102 | Ga0070681_10091688 | 3300005458 | Bacteria | 2988 |
| 103 | Ga0068867_100011207 | 3300005459 | Bacteria | 6324 |
| 104 | Ga0068867_100012147 | 3300005459 | Bacteria | 6084 |
| 105 | Ga0068867_100160325 | 3300005459 | Bacteria | 1773 |
| 106 | Ga0068867_100296037 | 3300005459 | Unclassified | 1332 |
| 107 | Ga0070706_100102790 | 3300005467 | Unclassified | 2657 |
| 108 | Ga0070706_100216055 | 3300005467 | Bacteria | 1790 |
| 109 | Ga0070707_100017332 | 3300005468 | Bacteria | 6771 |
| 110 | Ga0070679_100290388 | 3300005530 | Bacteria | 1587 |
| 111 | Ga0070679_100320991 | 3300005530 | Bacteria | 1498 |
| 112 | Ga0070684_100022030 | 3300005535 | Bacteria | 5309 |
| 113 | Ga0070684_100400446 | 3300005535 | Bacteria | 1265 |
| 114 | Ga0070684_100431559 | 3300005535 | Bacteria | 1217 |
| 115 | Ga0070697_100043526 | 3300005536 | Bacteria | 3636 |
| 116 | Ga0068853_100054906 | 3300005539 | Bacteria | 3433 |
| 117 | Ga0068853_100096395 | 3300005539 | Bacteria | 2610 |
| 118 | Ga0068853_100320915 | 3300005539 | Unclassified | 1436 |
| 119 | Ga0070672_100002353 | 3300005543 | Bacteria | 11956 |
| 120 | Ga0070672_100002997 | 3300005543 | Bacteria | 10881 |
| 121 | Ga0070672_100014473 | 3300005543 | Bacteria | 5592 |
| 122 | Ga0070672_100042837 | 3300005543 | Unclassified | 3487 |
| 123 | Ga0070672_100062363 | 3300005543 | Unclassified | 2942 |
| 124 | Ga0070672_100078982 | 3300005543 | Bacteria | 2633 |
| 125 | Ga0070672_100117325 | 3300005543 | Bacteria | 2176 |
| 126 | Ga0070672_100122065 | 3300005543 | Bacteria | 2134 |
| 127 | Ga0070686_100002139 | 3300005544 | Bacteria | 10886 |
| 128 | Ga0070695_100000178 | 3300005545 | Bacteria | 30212 |
| 129 | Ga0070696_100000248 | 3300005546 | Bacteria | 32432 |
| 130 | Ga0070696_100007039 | 3300005546 | Bacteria | 7509 |
| 131 | Ga0070693_100011756 | 3300005547 | Bacteria | 4414 |
| 132 | Ga0070693_100097190 | 3300005547 | Bacteria | 1787 |
| 133 | Ga0070665_100010470 | 3300005548 | Bacteria | 9386 |
| 134 | Ga0070665_100013602 | 3300005548 | Bacteria | 8184 |
| 135 | Ga0070665_100101673 | 3300005548 | Bacteria | 2878 |
| 136 | Ga0070665_100220673 | 3300005548 | Unclassified | 1896 |
| 137 | Ga0070665_100326416 | 3300005548 | Unclassified | 1539 |
| 138 | Ga0070704_100002435 | 3300005549 | Bacteria | 10440 |
| 139 | Ga0068855_100034194 | 3300005563 | Bacteria | 6063 |
| 140 | Ga0070664_100005343 | 3300005564 | Bacteria | 10305 |
| 141 | Ga0070664_100015050 | 3300005564 | Bacteria | 6315 |
| 142 | Ga0070664_100035236 | 3300005564 | Bacteria | 4201 |
| 143 | Ga0070664_100117619 | 3300005564 | Unclassified | 2325 |
| 144 | Ga0070664_100212699 | 3300005564 | Bacteria | 1728 |
| 145 | Ga0068857_100000810 | 3300005577 | Bacteria | 23378 |
| 146 | Ga0068854_100002668 | 3300005578 | Bacteria | 11066 |
| 147 | Ga0068854_100005409 | 3300005578 | Bacteria | 8063 |
| 148 | Ga0068854_100012218 | 3300005578 | Bacteria | 5618 |
| 149 | Ga0068856_100014288 | 3300005614 | Bacteria | 7678 |
| 150 | Ga0068856_100084522 | 3300005614 | Bacteria | 3152 |
| 151 | Ga0070702_100000014 | 3300005615 | Bacteria | 51486 |
| 152 | Ga0070702_100048117 | 3300005615 | Bacteria | 2426 |
| 153 | Ga0070702_100175751 | 3300005615 | Bacteria | 1397 |
| 154 | Ga0068852_100001129 | 3300005616 | Bacteria | 17663 |
| 155 | Ga0068852_100004563 | 3300005616 | Bacteria | 9804 |
| 156 | Ga0068852_100006161 | 3300005616 | Bacteria | 8652 |
| 157 | Ga0068852_100444419 | 3300005616 | Bacteria | 1282 |
| 158 | Ga0068859_100003654 | 3300005617 | Bacteria | 15676 |
| 159 | Ga0068859_100309978 | 3300005617 | Bacteria | 1672 |
| 160 | Ga0068864_100006436 | 3300005618 | Bacteria | 9625 |
| 161 | Ga0068864_100024434 | 3300005618 | Bacteria | 5083 |
| 162 | Ga0068864_100058463 | 3300005618 | Bacteria | 3332 |
| 163 | Ga0068864_100059590 | 3300005618 | Bacteria | 3303 |
| 164 | Ga0068864_100098739 | 3300005618 | Bacteria | 2586 |
| 165 | Ga0068864_100115580 | 3300005618 | Bacteria | 2393 |
| 166 | Ga0068864_100366317 | 3300005618 | Bacteria | 1363 |
| 167 | Ga0068866_10000777 | 3300005718 | Bacteria | 14329 |
| 168 | Ga0068866_10027411 | 3300005718 | Bacteria | 2701 |
| 169 | Ga0068866_10028281 | 3300005718 | Bacteria | 2670 |
| 170 | Ga0068861_100000581 | 3300005719 | Bacteria | 21649 |
| 171 | Ga0068861_100072525 | 3300005719 | Bacteria | 2672 |
| 172 | Ga0068861_100085480 | 3300005719 | Bacteria | 2477 |
| 173 | Ga0068851_10027476 | 3300005834 | Bacteria | 2805 |
| 174 | Ga0068851_10129008 | 3300005834 | Unclassified | 1366 |
| 175 | Ga0068870_10001592 | 3300005840 | Bacteria | 9236 |
| 176 | Ga0068863_100001012 | 3300005841 | Bacteria | 28130 |
| 177 | Ga0068863_100010386 | 3300005841 | Bacteria | 9046 |
| 178 | Ga0068863_100026715 | 3300005841 | Bacteria | 5505 |
| 179 | Ga0068863_100051165 | 3300005841 | Bacteria | 3916 |
| 180 | Ga0068863_100063854 | 3300005841 | Bacteria | 3482 |
| 181 | Ga0068863_100069212 | 3300005841 | Bacteria | 3337 |
| 182 | Ga0068863_100091751 | 3300005841 | Bacteria | 2881 |
| 183 | Ga0068863_100121625 | 3300005841 | Unclassified | 2490 |
| 184 | Ga0068863_100159625 | 3300005841 | Bacteria | 2160 |
| 185 | Ga0068863_100355842 | 3300005841 | Bacteria | 1426 |
| 186 | Ga0068858_100004586 | 3300005842 | Bacteria | 13531 |
| 187 | Ga0068858_100020243 | 3300005842 | Bacteria | 6222 |
| 188 | Ga0068858_100264368 | 3300005842 | Bacteria | 1636 |
| 189 | Ga0068860_100028614 | 3300005843 | Bacteria | 5364 |
| 190 | Ga0068860_100049738 | 3300005843 | Bacteria | 3991 |
| 191 | Ga0068860_100152987 | 3300005843 | Bacteria | 2222 |
| 192 | Ga0068860_100207226 | 3300005843 | Bacteria | 1902 |
| 193 | Ga0068860_100215735 | 3300005843 | Bacteria | 1862 |
| 194 | Ga0068862_100006705 | 3300005844 | Bacteria | 9555 |
| 195 | Ga0068862_100057883 | 3300005844 | Bacteria | 3325 |
| 196 | Ga0068862_100093479 | 3300005844 | Bacteria | 2622 |
| 197 | Ga0068862_100104913 | 3300005844 | Bacteria | 2477 |
| 198 | Ga0075365_10045523 | 3300006038 | Bacteria | 2878 |
| 199 | Ga0075364_10044609 | 3300006051 | Bacteria | 2884 |
| 200 | Ga0075362_10077345 | 3300006177 | Bacteria | 1529 |
| 201 | Ga0075369_10009342 | 3300006186 | Bacteria | 3807 |
| 202 | Ga0075366_10013151 | 3300006195 | Bacteria | 4706 |
| 203 | Ga0075366_10142074 | 3300006195 | Bacteria | 1452 |
| 204 | Ga0097621_100000283 | 3300006237 | Bacteria | 34080 |
| 205 | Ga0097621_100000525 | 3300006237 | Bacteria | 26865 |
| 206 | Ga0097621_100004947 | 3300006237 | Bacteria | 9343 |
| 207 | Ga0097621_100037722 | 3300006237 | Unclassified | 3875 |
| 208 | Ga0097621_100211021 | 3300006237 | Bacteria | 1689 |
| 209 | Ga0075370_10064194 | 3300006353 | Bacteria | 2094 |
| 210 | Ga0068871_100000889 | 3300006358 | Bacteria | 19922 |
| 211 | Ga0068871_100003413 | 3300006358 | Bacteria | 10918 |
| 212 | Ga0068871_100074990 | 3300006358 | Bacteria | 2792 |
| 213 | Ga0068871_100132068 | 3300006358 | Unclassified | 2118 |
| 214 | Ga0068871_100271326 | 3300006358 | Bacteria | 1482 |
| 215 | Ga0075428_100092295 | 3300006844 | Bacteria | 3301 |
| 216 | Ga0075430_100008305 | 3300006846 | Bacteria | 8770 |
| 217 | Ga0075431_100003044 | 3300006847 | Bacteria | 16219 |
| 218 | Ga0075431_100257581 | 3300006847 | Bacteria | 1771 |
| 219 | Ga0075433_10089533 | 3300006852 | Bacteria | 2720 |
| 220 | Ga0075433_10237043 | 3300006852 | Bacteria | 1620 |
| 221 | Ga0075434_100034198 | 3300006871 | Bacteria | 5018 |
| 222 | Ga0075429_100011263 | 3300006880 | Bacteria | 7741 |
| 223 | Ga0068865_100012523 | 3300006881 | Bacteria | 5340 |
| 224 | Ga0068865_100095237 | 3300006881 | Bacteria | 2169 |
| 225 | Ga0097620_100003654 | 3300006931 | Bacteria | 15676 |
| 226 | Ga0097620_100309968 | 3300006931 | Bacteria | 1672 |
| 227 | Ga0075435_100023975 | 3300007076 | Bacteria | 4728 |
| 228 | Ga0099794_10041717 | 3300007265 | Bacteria | 2185 |
| 229 | Ga0105240_10001807 | 3300009093 | Bacteria | 36004 |
| 230 | Ga0111539_10264637 | 3300009094 | Bacteria | 2002 |
| 231 | Ga0105245_10001140 | 3300009098 | Bacteria | 24024 |
| 232 | Ga0114129_10236899 | 3300009147 | Bacteria | 2455 |
| 233 | Ga0105243_10011356 | 3300009148 | Bacteria | 6742 |
| 234 | Ga0105243_10018014 | 3300009148 | Bacteria | 5343 |
| 235 | Ga0105243_10049412 | 3300009148 | Bacteria | 3318 |
| 236 | Ga0105241_10018045 | 3300009174 | Bacteria | 5187 |
| 237 | Ga0105242_10000610 | 3300009176 | Bacteria | 27965 |
| 238 | Ga0105242_10119875 | 3300009176 | Bacteria | 2256 |
| 239 | Ga0105242_10181902 | 3300009176 | Bacteria | 1855 |
| 240 | Ga0105242_10338682 | 3300009176 | Unclassified | 1385 |
| 241 | Ga0105248_10046548 | 3300009177 | Bacteria | 4862 |
| 242 | Ga0105248_10133814 | 3300009177 | Unclassified | 2797 |
| 243 | Ga0105248_10452116 | 3300009177 | Bacteria | 1447 |
| 244 | Ga0105237_10274330 | 3300009545 | Bacteria | 1689 |
| 245 | Ga0105238_10001317 | 3300009551 | Bacteria | 24891 |
| 246 | Ga0105249_10023298 | 3300009553 | Bacteria | 5555 |
| 247 | Ga0105239_10071817 | 3300010375 | Bacteria | 3803 |
| 248 | Ga0105246_10035336 | 3300011119 | Bacteria | 3340 |
| 249 | Ga0157371_10161204 | 3300013102 | Bacteria | 1602 |
| 250 | Ga0157370_10025696 | 3300013104 | Bacteria | 5827 |
| 251 | Ga0157374_10003535 | 3300013296 | Bacteria | 13146 |
| 252 | Ga0157374_10061974 | 3300013296 | Bacteria | 3504 |
| 253 | Ga0157374_10100744 | 3300013296 | Bacteria | 2769 |
| 254 | Ga0157374_10253304 | 3300013296 | Bacteria | 1733 |
| 255 | Ga0157378_10001659 | 3300013297 | Bacteria | 20115 |
| 256 | Ga0157378_10005177 | 3300013297 | Bacteria | 11451 |
| 257 | Ga0157378_10025324 | 3300013297 | Bacteria | 5225 |
| 258 | Ga0157378_10087176 | 3300013297 | Unclassified | 2831 |
| 259 | Ga0157378_10245304 | 3300013297 | Bacteria | 1713 |
| 260 | Ga0163162_10014588 | 3300013306 | Bacteria | 7677 |
| 261 | Ga0163162_10042429 | 3300013306 | Bacteria | 4553 |
| 262 | Ga0163162_10062607 | 3300013306 | Bacteria | 3761 |
| 263 | Ga0163162_10559061 | 3300013306 | Bacteria | 1272 |
| 264 | Ga0163162_10773903 | 3300013306 | Bacteria | 1078 |
| 265 | Ga0157375_10004326 | 3300013308 | Bacteria | 12329 |
| 266 | Ga0157375_10006008 | 3300013308 | Bacteria | 10585 |
| 267 | Ga0157375_10091090 | 3300013308 | Bacteria | 3110 |
| 268 | Ga0157375_10100213 | 3300013308 | Bacteria | 2977 |
| 269 | Ga0157375_10102627 | 3300013308 | Unclassified | 2946 |
| 270 | Ga0157375_10175165 | 3300013308 | Bacteria | 2294 |
| 271 | Ga0157375_10656799 | 3300013308 | Bacteria | 1204 |
| 272 | Ga0163163_10005091 | 3300014325 | Bacteria | 11327 |
| 273 | Ga0157380_10113295 | 3300014326 | Bacteria | 2283 |
| 274 | Ga0157377_10032877 | 3300014745 | Bacteria | 2828 |
| 275 | Ga0157377_10151750 | 3300014745 | Bacteria | 1433 |
| 276 | Ga0157379_10026196 | 3300014968 | Bacteria | 5189 |
| 277 | Ga0157379_10058641 | 3300014968 | Bacteria | 3443 |
| 278 | Ga0157376_10004059 | 3300014969 | Bacteria | 10129 |
| 279 | Ga0157376_10008580 | 3300014969 | Bacteria | 7383 |
| 280 | Ga0157376_10014370 | 3300014969 | Bacteria | 5941 |
| 281 | Ga0157376_10132948 | 3300014969 | Bacteria | 2223 |
| 282 | Ga0157376_10179628 | 3300014969 | Unclassified | 1933 |
| 283 | Ga0163161_10006520 | 3300017792 | Bacteria | 8082 |
| 284 | Ga0163161_10114587 | 3300017792 | Bacteria | 2019 |
| 285 | Ga0163161_10169871 | 3300017792 | Bacteria | 1667 |
| 286 | Ga0213876_10127407 | 3300021384 | Bacteria | 1352 |
| 287 | Ga0209025_1000027 | 3300025294 | Bacteria | 505882 |
| 288 | Ga0209758_1004073 | 3300025297 | Bacteria | 12567 |
| 289 | Ga0207426_1005137 | 3300025302 | Bacteria | 6100 |
| 290 | Ga0207426_1026574 | 3300025302 | Bacteria | 1937 |
| 291 | Ga0207697_10014647 | 3300025315 | Bacteria | 3251 |
| 292 | Ga0207697_10074865 | 3300025315 | Bacteria | 1422 |
| 293 | Ga0207656_10053728 | 3300025321 | Unclassified | 1749 |
| 294 | Ga0207653_10025498 | 3300025885 | Bacteria | 1891 |
| 295 | Ga0207682_10006116 | 3300025893 | Bacteria | 4863 |
| 296 | Ga0207682_10010493 | 3300025893 | Bacteria | 3631 |
| 297 | Ga0207682_10116211 | 3300025893 | Bacteria | 1182 |
| 298 | Ga0207642_10000667 | 3300025899 | Bacteria | 10555 |
| 299 | Ga0207688_10071130 | 3300025901 | Bacteria | 1974 |
| 300 | Ga0207645_10019277 | 3300025907 | Bacteria | 4473 |
| 301 | Ga0207645_10020048 | 3300025907 | Bacteria | 4379 |
| 302 | Ga0207645_10061196 | 3300025907 | Bacteria | 2405 |
| 303 | Ga0207645_10070940 | 3300025907 | Unclassified | 2229 |
| 304 | Ga0207645_10145847 | 3300025907 | Bacteria | 1543 |
| 305 | Ga0207643_10030155 | 3300025908 | Bacteria | 3018 |
| 306 | Ga0207643_10077376 | 3300025908 | Bacteria | 1923 |
| 307 | Ga0207707_10001576 | 3300025912 | Bacteria | 21009 |
| 308 | Ga0207707_10005380 | 3300025912 | Bacteria | 11196 |
| 309 | Ga0207707_10019952 | 3300025912 | Bacteria | 5850 |
| 310 | Ga0207707_10086051 | 3300025912 | Bacteria | 2747 |
| 311 | Ga0207671_10250582 | 3300025914 | Bacteria | 1392 |
| 312 | Ga0207660_10006068 | 3300025917 | Bacteria | 7841 |
| 313 | Ga0207660_10323856 | 3300025917 | Bacteria | 1231 |
| 314 | Ga0207662_10000021 | 3300025918 | Bacteria | 72688 |
| 315 | Ga0207662_10017902 | 3300025918 | Bacteria | 4012 |
| 316 | Ga0207657_10012171 | 3300025919 | Bacteria | 8501 |
| 317 | Ga0207649_10004308 | 3300025920 | Bacteria | 7736 |
| 318 | Ga0207649_10027243 | 3300025920 | Bacteria | 3352 |
| 319 | Ga0207649_10053986 | 3300025920 | Bacteria | 2500 |
| 320 | Ga0207649_10117399 | 3300025920 | Unclassified | 1788 |
| 321 | Ga0207649_10245104 | 3300025920 | Unclassified | 1288 |
| 322 | Ga0207652_10274502 | 3300025921 | Bacteria | 1521 |
| 323 | Ga0207646_10139994 | 3300025922 | Bacteria | 2179 |
| 324 | Ga0207681_10051742 | 3300025923 | Bacteria | 2783 |
| 325 | Ga0207681_10125986 | 3300025923 | Bacteria | 1886 |
| 326 | Ga0207681_10318787 | 3300025923 | Bacteria | 1235 |
| 327 | Ga0207694_10003964 | 3300025924 | Bacteria | 11677 |
| 328 | Ga0207650_10004028 | 3300025925 | Bacteria | 10048 |
| 329 | Ga0207650_10004272 | 3300025925 | Bacteria | 9751 |
| 330 | Ga0207650_10005988 | 3300025925 | Bacteria | 8297 |
| 331 | Ga0207650_10006311 | 3300025925 | Bacteria | 8080 |
| 332 | Ga0207650_10180802 | 3300025925 | Bacteria | 1680 |
| 333 | Ga0207650_10378416 | 3300025925 | Bacteria | 1169 |
| 334 | Ga0207659_10002215 | 3300025926 | Bacteria | 11568 |
| 335 | Ga0207659_10048261 | 3300025926 | Bacteria | 3015 |
| 336 | Ga0207659_10070130 | 3300025926 | Bacteria | 2555 |
| 337 | Ga0207659_10085294 | 3300025926 | Unclassified | 2346 |
| 338 | Ga0207687_10000833 | 3300025927 | Bacteria | 20808 |
| 339 | Ga0207644_10000418 | 3300025931 | Bacteria | 27576 |
| 340 | Ga0207644_10046132 | 3300025931 | Unclassified | 3103 |
| 341 | Ga0207706_10021394 | 3300025933 | Bacteria | 5809 |
| 342 | Ga0207706_10021395 | 3300025933 | Bacteria | 5809 |
| 343 | Ga0207686_10000804 | 3300025934 | Bacteria | 19247 |
| 344 | Ga0207686_10006730 | 3300025934 | Bacteria | 6191 |
| 345 | Ga0207709_10178215 | 3300025935 | Bacteria | 1498 |
| 346 | Ga0207670_10003028 | 3300025936 | Bacteria | 8861 |
| 347 | Ga0207670_10133756 | 3300025936 | Bacteria | 1821 |
| 348 | Ga0207669_10023510 | 3300025937 | Bacteria | 3294 |
| 349 | Ga0207669_10042744 | 3300025937 | Bacteria | 2648 |
| 350 | Ga0207704_10000327 | 3300025938 | Bacteria | 22154 |
| 351 | Ga0207691_10000110 | 3300025940 | Bacteria | 73418 |
| 352 | Ga0207691_10002261 | 3300025940 | Bacteria | 18855 |
| 353 | Ga0207691_10002783 | 3300025940 | Bacteria | 17058 |
| 354 | Ga0207691_10006961 | 3300025940 | Bacteria | 10908 |
| 355 | Ga0207691_10007330 | 3300025940 | Bacteria | 10639 |
| 356 | Ga0207691_10012533 | 3300025940 | Bacteria | 8127 |
| 357 | Ga0207691_10013997 | 3300025940 | Bacteria | 7652 |
| 358 | Ga0207691_10187378 | 3300025940 | Bacteria | 1806 |
| 359 | Ga0207691_10253876 | 3300025940 | Bacteria | 1517 |
| 360 | Ga0207711_10019453 | 3300025941 | Bacteria | 5652 |
| 361 | Ga0207689_10000426 | 3300025942 | Bacteria | 39509 |
| 362 | Ga0207689_10005712 | 3300025942 | Bacteria | 11064 |
| 363 | Ga0207689_10021896 | 3300025942 | Bacteria | 5375 |
| 364 | Ga0207661_10005122 | 3300025944 | Bacteria | 9203 |
| 365 | Ga0207661_10053144 | 3300025944 | Unclassified | 3240 |
| 366 | Ga0207661_10070397 | 3300025944 | Bacteria | 2856 |
| 367 | Ga0207661_10158312 | 3300025944 | Unclassified | 1963 |
| 368 | Ga0207661_10208585 | 3300025944 | Bacteria | 1721 |
| 369 | Ga0207679_10004251 | 3300025945 | Bacteria | 8901 |
| 370 | Ga0207679_10041185 | 3300025945 | Bacteria | 3310 |
| 371 | Ga0207679_10064662 | 3300025945 | Bacteria | 2735 |
| 372 | Ga0207679_10153338 | 3300025945 | Unclassified | 1878 |
| 373 | Ga0207667_10010866 | 3300025949 | Bacteria | 10616 |
| 374 | Ga0207667_10016330 | 3300025949 | Bacteria | 8390 |
| 375 | Ga0207651_10011098 | 3300025960 | Bacteria | 5026 |
| 376 | Ga0207651_10011420 | 3300025960 | Bacteria | 4974 |
| 377 | Ga0207651_10013977 | 3300025960 | Bacteria | 4619 |
| 378 | Ga0207651_10015843 | 3300025960 | Bacteria | 4395 |
| 379 | Ga0207651_10096744 | 3300025960 | Bacteria | 2178 |
| 380 | Ga0207651_10114530 | 3300025960 | Bacteria | 2031 |
| 381 | Ga0207651_10144412 | 3300025960 | Unclassified | 1843 |
| 382 | Ga0207712_10180410 | 3300025961 | Bacteria | 1658 |
| 383 | Ga0207668_10026327 | 3300025972 | Bacteria | 3775 |
| 384 | Ga0207668_10032629 | 3300025972 | Bacteria | 3443 |
| 385 | Ga0207640_10020311 | 3300025981 | Bacteria | 3942 |
| 386 | Ga0207640_10150603 | 3300025981 | Bacteria | 1709 |
| 387 | Ga0207658_10026531 | 3300025986 | Unclassified | 4062 |
| 388 | Ga0207658_10049526 | 3300025986 | Bacteria | 3088 |
| 389 | Ga0207658_10084382 | 3300025986 | Bacteria | 2444 |
| 390 | Ga0207658_10306745 | 3300025986 | Bacteria | 1370 |
| 391 | Ga0207658_10327854 | 3300025986 | Bacteria | 1327 |
| 392 | Ga0207677_10011562 | 3300026023 | Bacteria | 5039 |
| 393 | Ga0207677_10014356 | 3300026023 | Bacteria | 4624 |
| 394 | Ga0207703_10012010 | 3300026035 | Bacteria | 6745 |
| 395 | Ga0207703_10016185 | 3300026035 | Bacteria | 5813 |
| 396 | Ga0207703_10562953 | 3300026035 | Bacteria | 1076 |
| 397 | Ga0207639_10041571 | 3300026041 | Bacteria | 3441 |
| 398 | Ga0207639_10224277 | 3300026041 | Bacteria | 1625 |
| 399 | Ga0207708_10000231 | 3300026075 | Bacteria | 44046 |
| 400 | Ga0207708_10057661 | 3300026075 | Bacteria | 2963 |
| 401 | Ga0207708_10061180 | 3300026075 | Bacteria | 2875 |
| 402 | Ga0207702_10003982 | 3300026078 | Bacteria | 13259 |
| 403 | Ga0207641_10001097 | 3300026088 | Bacteria | 27224 |
| 404 | Ga0207641_10013145 | 3300026088 | Bacteria | 6787 |
| 405 | Ga0207641_10089468 | 3300026088 | Unclassified | 2691 |
| 406 | Ga0207641_10122835 | 3300026088 | Bacteria | 2320 |
| 407 | Ga0207648_10007171 | 3300026089 | Bacteria | 10989 |
| 408 | Ga0207648_10017646 | 3300026089 | Bacteria | 6483 |
| 409 | Ga0207648_10025041 | 3300026089 | Bacteria | 5319 |
| 410 | Ga0207648_10033234 | 3300026089 | Unclassified | 4550 |
| 411 | Ga0207648_10034169 | 3300026089 | Unclassified | 4483 |
| 412 | Ga0207648_10040042 | 3300026089 | Bacteria | 4118 |
| 413 | Ga0207648_10078985 | 3300026089 | Bacteria | 2871 |
| 414 | Ga0207648_10093737 | 3300026089 | Bacteria | 2626 |
| 415 | Ga0207648_10151836 | 3300026089 | Bacteria | 2044 |
| 416 | Ga0207676_10001836 | 3300026095 | Bacteria | 15555 |
| 417 | Ga0207676_10007102 | 3300026095 | Bacteria | 7936 |
| 418 | Ga0207676_10021023 | 3300026095 | Unclassified | 4783 |
| 419 | Ga0207676_10067883 | 3300026095 | Bacteria | 2850 |
| 420 | Ga0207676_10254630 | 3300026095 | Bacteria | 1582 |
| 421 | Ga0207674_10000418 | 3300026116 | Bacteria | 55342 |
| 422 | Ga0207675_100000086 | 3300026118 | Bacteria | 72707 |
| 423 | Ga0207675_100089172 | 3300026118 | Bacteria | 2897 |
| 424 | Ga0207675_100092116 | 3300026118 | Bacteria | 2851 |
| 425 | Ga0207683_10002093 | 3300026121 | Bacteria | 17577 |
| 426 | Ga0207683_10003538 | 3300026121 | Bacteria | 13623 |
| 427 | Ga0207683_10007943 | 3300026121 | Bacteria | 9079 |
| 428 | Ga0207683_10009224 | 3300026121 | Bacteria | 8408 |
| 429 | Ga0207683_10010606 | 3300026121 | Bacteria | 7859 |
| 430 | Ga0207683_10018176 | 3300026121 | Bacteria | 5996 |
| 431 | Ga0207683_10019117 | 3300026121 | Bacteria | 5847 |
| 432 | Ga0207683_10083523 | 3300026121 | Bacteria | 2838 |
| 433 | Ga0207683_10197483 | 3300026121 | Bacteria | 1828 |
| 434 | Ga0207698_10002351 | 3300026142 | Bacteria | 11203 |
| 435 | Ga0207698_10020906 | 3300026142 | Bacteria | 4516 |
| 436 | Ga0207698_10106297 | 3300026142 | Bacteria | 2340 |
| 437 | Ga0207428_10133780 | 3300027907 | Bacteria | 1896 |
| 438 | Ga0207428_10303870 | 3300027907 | Unclassified | 1180 |
| 439 | Ga0268266_10020803 | 3300028379 | Bacteria | 5595 |
| 440 | Ga0268266_10058090 | 3300028379 | Bacteria | 3330 |
| 441 | Ga0268266_10213896 | 3300028379 | Bacteria | 1769 |
| 442 | Ga0268265_10022052 | 3300028380 | Bacteria | 4470 |
| 443 | Ga0268265_10038684 | 3300028380 | Bacteria | 3510 |
| 444 | Ga0268265_10040634 | 3300028380 | Bacteria | 3437 |
| 445 | Ga0268264_10001620 | 3300028381 | Bacteria | 20799 |
| 446 | Ga0268264_10013339 | 3300028381 | Bacteria | 6763 |
| 447 | Ga0268264_10023675 | 3300028381 | Bacteria | 5007 |
| 448 | Ga0268264_10133825 | 3300028381 | Bacteria | 2202 |
| 449 | Ga0268264_10164105 | 3300028381 | Bacteria | 2004 |
| 450 | Ga0265334_10014823 | 3300028573 | Bacteria | 3245 |
| 451 | Ga0265334_10045098 | 3300028573 | Bacteria | 1709 |
| 452 | Ga0265318_10004630 | 3300028577 | Bacteria | 6622 |
| 453 | Ga0307517_10075043 | 3300028786 | Bacteria | 2972 |
| 454 | Ga0265338_10107800 | 3300028800 | Bacteria | 2252 |
| 455 | Ga0307511_10000019 | 3300030521 | Bacteria | 117947 |
| 456 | Ga0265330_10024986 | 3300031235 | Bacteria | 2709 |
| 457 | Ga0265332_10004725 | 3300031238 | Bacteria | 6353 |
| 458 | Ga0265328_10002094 | 3300031239 | Bacteria | 9005 |
| 459 | Ga0265320_10045903 | 3300031240 | Bacteria | 2144 |
| 460 | Ga0265329_10005279 | 3300031242 | Bacteria | 5244 |
| 461 | Ga0265331_10001778 | 3300031250 | Bacteria | 15399 |
| 462 | Ga0265327_10010421 | 3300031251 | Bacteria | 6545 |
| 463 | Ga0265327_10016633 | 3300031251 | Bacteria | 4660 |
| 464 | Ga0265327_10050784 | 3300031251 | Bacteria | 2168 |
| 465 | Ga0307513_10158733 | 3300031456 | Bacteria | 2157 |
| 466 | Ga0307408_100172257 | 3300031548 | Bacteria | 1729 |
| 467 | Ga0265314_10002233 | 3300031711 | Bacteria | 20138 |
| 468 | Ga0265342_10016999 | 3300031712 | Bacteria | 4740 |
| 469 | Ga0307413_10007784 | 3300031824 | Bacteria | 5006 |
| 470 | Ga0307407_10069634 | 3300031903 | Bacteria | 2089 |
| 471 | Ga0307412_10076632 | 3300031911 | Bacteria | 2298 |
| 472 | Ga0307409_100040847 | 3300031995 | Bacteria | 3458 |
| 473 | Ga0307409_100483537 | 3300031995 | Unclassified | 1202 |
| 474 | Ga0307414_10047027 | 3300032004 | Bacteria | 2967 |
| 475 | Ga0307414_10136529 | 3300032004 | Bacteria | 1913 |
| 476 | Ga0307411_10171098 | 3300032005 | Bacteria | 1638 |
| 477 | Ga0307415_100171527 | 3300032126 | Bacteria | 1692 |
| 478 | Ga0373949_0006402 | 3300035090 | Bacteria | 2590 |
| 479 | Ga0373952_0003060 | 3300035092 | Bacteria | 3016 |
| 480 | Ga0373952_0020009 | 3300035092 | Bacteria | 1399 |
| 481 | Ga0373923_0047129 | 3300035111 | Bacteria | 1795 |
| 482 | Ga0373932_0001975 | 3300035112 | Bacteria | 5413 |
| 483 | Ga0373939_0000701 | 3300035114 | Bacteria | 8291 |
| 484 | Ga0373941_0017773 | 3300035115 | Bacteria | 1954 |
| 485 | Ga0373960_0046934 | 3300035121 | Bacteria | 1269 |
| 486 | Ga0373955_0058411 | 3300035172 | Bacteria | 2123 |
| 487 | Ga0373931_0001220 | 3300035691 | Bacteria | 10999 |
| 488 | Ga0373931_0036760 | 3300035691 | Bacteria | 2554 |
| 489 | Ga0373931_0192453 | 3300035691 | Bacteria | 1214 |
| 490 | Ga0373935_0276388 | 3300035692 | Bacteria | 1182 |
| 491 | Ga0373933_0180357 | 3300035724 | Bacteria | 1347 |
| 492 | Ga0373947_0057448 | 3300035725 | Bacteria | 2355 |
| 493 | Ga0373937_0105102 | 3300036401 | Bacteria | 2624 |
| 494 | Ga0373937_0107231 | 3300036401 | Bacteria | 2597 |
| 495 | Ga0373937_0497660 | 3300036401 | Bacteria | 1158 |
| 496 | Ga0373925_0290173 | 3300037068 | Bacteria | 1319 |
| 497 | Ga0395899_0005693 | 3300037312 | Bacteria | 9673 |
| 498 | Ga0395899_0008434 | 3300037312 | Bacteria | 7938 |
| 499 | Ga0395900_0034401 | 3300037418 | Bacteria | 5217 |
| 500 | Ga0395900_0044109 | 3300037418 | Bacteria | 4596 |
| 501 | Ga0395898_0006517 | 3300037466 | Bacteria | 12473 |
| 502 | Ga0395898_0031484 | 3300037466 | Bacteria | 5299 |
| 503 | Ga0395905_0004405 | 3300037471 | Bacteria | 14646 |
| 504 | Ga0395905_0006862 | 3300037471 | Bacteria | 11385 |
| 505 | Ga0395901_0007572 | 3300038443 | Bacteria | 10966 |
| 506 | Ga0395901_0012635 | 3300038443 | Bacteria | 8568 |
| 507 | Ga0436365_1111801 | 3300039437 | Bacteria | 1588 |
| 508 | Ga0439447_020607 | 3300041407 | Bacteria | 1746 |
| 509 | Ga0451577_0011129 | 3300042876 | Bacteria | 8536 |
| 510 | Ga0453684_0169670 | 3300044712 | Bacteria | 2573 |
| 511 | Ga0466960_0063179 | 3300044901 | Bacteria | 1822 |
| 512 | Ga0451576_0008768 | 3300045051 | Bacteria | 11831 |
| 513 | Ga0466958_0117392 | 3300045836 | Bacteria | 1664 |
| 514 | Ga0495592_0122363 | 3300046454 | Bacteria | 1829 |
| 515 | Ga0495632_0002900 | 3300046519 | Bacteria | 12607 |
| 516 | Ga0495598_0073683 | 3300046537 | Bacteria | 1081 |
| 517 | Ga0495621_0029949 | 3300046539 | Bacteria | 1858 |
| 518 | Ga0495621_0049146 | 3300046539 | Bacteria | 1504 |
| 519 | Ga0495633_0004166 | 3300046558 | Bacteria | 9293 |
| 520 | Ga0495656_0049377 | 3300046615 | Bacteria | 1792 |
| 521 | Ga0495669_0051905 | 3300046684 | Bacteria | 1841 |
| 522 | Ga0495649_0003265 | 3300046694 | Bacteria | 11048 |
| 523 | Ga0495676_0157214 | 3300047321 | Bacteria | 1612 |
| 524 | Ga0495687_001187 | 3300047443 | Bacteria | 25022 |
| 525 | Ga0496100_0073425 | 3300048903 | Unclassified | 2289 |
| 526 | Ga0496101_0119938 | 3300048904 | Bacteria | 1987 |
| 527 | Ga0496102_0079592 | 3300048905 | Unclassified | 3018 |
| 528 | Ga0496102_0431719 | 3300048905 | Unclassified | 1237 |
| 529 | Ga0496102_0511775 | 3300048905 | Bacteria | 1123 |
| 530 | Ga0496104_0353608 | 3300048907 | Bacteria | 1382 |
| 531 | Ga0496105_0265990 | 3300048908 | Bacteria | 1386 |
| 532 | Ga0496106_0279115 | 3300048909 | Bacteria | 1338 |
| 533 | Ga0496108_0008518 | 3300048911 | Bacteria | 8317 |
| 534 | Ga0496109_0165277 | 3300048912 | Unclassified | 2074 |
| 535 | Ga0496109_0216930 | 3300048912 | Bacteria | 1799 |
| 536 | Ga0496110_0013289 | 3300048913 | Bacteria | 6801 |
| 537 | Ga0496110_0028831 | 3300048913 | Unclassified | 4771 |
| 538 | Ga0496110_0057664 | 3300048913 | Bacteria | 3419 |
| 539 | Ga0496112_0174022 | 3300048915 | Unclassified | 2118 |
| 540 | Ga0496112_0445867 | 3300048915 | Bacteria | 1232 |
| 541 | Ga0496113_0245800 | 3300048916 | Unclassified | 1428 |
| 542 | Ga0496113_0383944 | 3300048916 | Bacteria | 1127 |
| 543 | Ga0496114_0120627 | 3300048917 | Bacteria | 2255 |
| 544 | Ga0496114_0169237 | 3300048917 | Unclassified | 1903 |
| 545 | Ga0501033_0000891 | 3300049570 | Bacteria | 27301 |
| 546 | Ga0501033_0038018 | 3300049570 | Bacteria | 3601 |
| 547 | Ga0501037_0078480 | 3300049573 | Bacteria | 2396 |
| 548 | Ga0501039_0021818 | 3300049575 | Bacteria | 4913 |
| 549 | Ga0501040_0003627 | 3300049576 | Bacteria | 9997 |
| 550 | Ga0501040_0037972 | 3300049576 | Bacteria | 3274 |
| 551 | Ga0501040_0145115 | 3300049576 | Bacteria | 1673 |
| 552 | Ga0501041_0011051 | 3300049577 | Bacteria | 5332 |
| 553 | Ga0501041_0224494 | 3300049577 | Bacteria | 1179 |
| 554 | Ga0501042_0021693 | 3300049578 | Bacteria | 4478 |
| 555 | Ga0501042_0079039 | 3300049578 | Bacteria | 2356 |
| 556 | Ga0501046_0062584 | 3300049580 | Bacteria | 2907 |
| 557 | Ga0501047_0103739 | 3300049581 | Bacteria | 2724 |
| 558 | Ga0501048_0003839 | 3300049582 | Bacteria | 11458 |
| 559 | Ga0501071_0011203 | 3300049587 | Bacteria | 6032 |
| 560 | Ga0501072_0002755 | 3300049588 | Bacteria | 13207 |
| 561 | Ga0501072_0135022 | 3300049588 | Bacteria | 1967 |
| 562 | Ga0501073_0104758 | 3300049589 | Bacteria | 1963 |
| 563 | Ga0501075_0001234 | 3300049591 | Bacteria | 16573 |
| 564 | Ga0501075_0248412 | 3300049591 | Bacteria | 1356 |
| 565 | Ga0501079_0012875 | 3300049741 | Bacteria | 6385 |
| 566 | Ga0501079_0369702 | 3300049741 | Bacteria | 1124 |
| 567 | Ga0501080_0018189 | 3300049742 | Bacteria | 6505 |
| 568 | Ga0501081_0001544 | 3300049743 | Bacteria | 14163 |
| 569 | Ga0501081_0174279 | 3300049743 | Bacteria | 1554 |
| 570 | Ga0501083_0098685 | 3300049744 | Bacteria | 1927 |
| 571 | Ga0501035_0177637 | 3300049822 | Bacteria | 1836 |
| 572 | Ga0501044_0333629 | 3300049823 | Bacteria | 1439 |
| 573 | Ga0501045_0000154 | 3300049824 | Bacteria | 36954 |
| 574 | nmdc:mga00v17_21077_c1 | 3300050491 | Bacteria | 3743 |
| 575 | nmdc:mga0yw44_132864_c1 | 3300050492 | Bacteria | 1613 |
| 576 | nmdc:mga0yw44_77214_c1 | 3300050492 | Bacteria | 2080 |
| 577 | nmdc:mga0k408_2808_c1 | 3300050493 | Bacteria | 9249 |
| 578 | nmdc:mga0k408_30058_c1 | 3300050493 | Bacteria | 3096 |
| 579 | nmdc:mga06z11_203820_c1 | 3300050494 | Bacteria | 1150 |
| 580 | nmdc:mga07m45_16546_c1 | 3300050496 | Bacteria | 3948 |
| 581 | nmdc:mga05p37_278921_c1 | 3300050507 | Bacteria | 1994 |
| 582 | nmdc:mga0qj67_39957_c1 | 3300050509 | Bacteria | 3686 |
| 583 | nmdc:mga06r32_12503_c1 | 3300050510 | Bacteria | 7661 |
| 584 | nmdc:mga06r32_224243_c1 | 3300050510 | Bacteria | 1868 |
| 585 | nmdc:mga06r32_330750_c1 | 3300050510 | Bacteria | 1509 |
| 586 | nmdc:mga08y16_103389_c1 | 3300050511 | Bacteria | 2966 |
| 587 | nmdc:mga08y16_190416_c1 | 3300050511 | Bacteria | 2128 |
| 588 | nmdc:mga08y16_218739_c1 | 3300050511 | Bacteria | 1972 |
| 589 | nmdc:mga0n895_133549_c1 | 3300050512 | Bacteria | 2508 |
| 590 | nmdc:mga0n895_258723_c1 | 3300050512 | Bacteria | 1766 |
| 591 | nmdc:mga0rr50_12742_c1 | 3300050513 | Bacteria | 5448 |
| 592 | nmdc:mga0a205_11698_c1 | 3300050515 | Bacteria | 4927 |
| 593 | Ga0500643_003287 | 3300053087 | Bacteria | 7859 |
| 594 | Ga0500566_0000231 | 3300053094 | Bacteria | 29903 |
| 595 | Ga0500593_060314 | 3300053117 | Bacteria | 1667 |
| 596 | Ga0500559_0007488 | 3300053136 | Bacteria | 4831 |
| 597 | Ga0500573_0047637 | 3300053140 | Bacteria | 2468 |
| 598 | Ga0500604_0001141 | 3300053151 | Bacteria | 7378 |
| 599 | Ga0500616_0003403 | 3300053153 | Bacteria | 12207 |
| 600 | Ga0500634_0030352 | 3300053161 | Bacteria | 2946 |
| 601 | Ga0500634_0053920 | 3300053161 | Bacteria | 2155 |
| 602 | Ga0501084_0006792 | 3300054114 | Bacteria | 9410 |
| 603 | Ga0501084_0127922 | 3300054114 | Bacteria | 2138 |
| 604 | Ga0501082_0006485 | 3300060353 | Bacteria | 10142 |
| 605 | Ga0530510_0001503 | 3300061734 | Bacteria | 15668 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035121 | Ga0373960_0046934 | Ga0373960_0046934_432_1244 | 239 |
| 2 | 3300005841 | Ga0068863_100121625 | Ga0068863_1001216253 | 251 |
| 3 | 3300005546 | Ga0070696_100007039 | Ga0070696_1000070393 | 258 |
| 4 | 3300044901 | Ga0466960_0063179 | Ga0466960_0063179_270_1223 | 259 |
| 5 | 3300035092 | Ga0373952_0020009 | Ga0373952_0020009_498_1373 | 261 |
| 6 | 3300005440 | Ga0070705_100003253 | Ga0070705_1000032534 | 270 |
| 7 | 3300005536 | Ga0070697_100043526 | Ga0070697_1000435262 | 270 |
| 8 | 3300014325 | Ga0163163_10005091 | Ga0163163_100050914 | 278 |
| 9 | 3300048912 | Ga0496109_0216930 | Ga0496109_0216930_549_1514 | 278 |
| 10 | 3300048915 | Ga0496112_0445867 | Ga0496112_0445867_245_1210 | 278 |
| 11 | 3300035115 | Ga0373941_0017773 | Ga0373941_0017773_60_1013 | 279 |
| 12 | 3300049573 | Ga0501037_0078480 | Ga0501037_0078480_82_1020 | 282 |
| 13 | 3300048908 | Ga0496105_0265990 | Ga0496105_0265990_188_1162 | 283 |
| 14 | 3300009177 | Ga0105248_10452116 | Ga0105248_104521162 | 284 |
| 15 | 3300005458 | Ga0070681_10000916 | Ga0070681_1000091621 | 285 |
| 16 | 3300005530 | Ga0070679_100320991 | Ga0070679_1003209912 | 285 |
| 17 | 3300005539 | Ga0068853_100320915 | Ga0068853_1003209152 | 285 |
| 18 | 3300005834 | Ga0068851_10129008 | Ga0068851_101290082 | 285 |
| 19 | 3300006358 | Ga0068871_100132068 | Ga0068871_1001320681 | 285 |
| 20 | 3300009177 | Ga0105248_10133814 | Ga0105248_101338143 | 285 |
| 21 | 3300025321 | Ga0207656_10053728 | Ga0207656_100537282 | 285 |
| 22 | 3300025912 | Ga0207707_10001576 | Ga0207707_1000157622 | 285 |
| 23 | 3300025931 | Ga0207644_10046132 | Ga0207644_100461322 | 285 |
| 24 | 3300026095 | Ga0207676_10067883 | Ga0207676_100678833 | 285 |
| 25 | 3300046684 | Ga0495669_0051905 | Ga0495669_0051905_606_1589 | 285 |
| 26 | 3300005331 | Ga0070670_100003427 | Ga0070670_1000034278 | 286 |
| 27 | 3300005618 | Ga0068864_100006436 | Ga0068864_1000064368 | 286 |
| 28 | 3300005841 | Ga0068863_100001012 | Ga0068863_1000010124 | 286 |
| 29 | 3300025925 | Ga0207650_10004272 | Ga0207650_100042728 | 286 |
| 30 | 3300026088 | Ga0207641_10001097 | Ga0207641_1000109712 | 286 |
| 31 | 3300026095 | Ga0207676_10007102 | Ga0207676_100071024 | 286 |
| 32 | 3300054114 | Ga0501084_0127922 | Ga0501084_0127922_881_1837 | 286 |
| 33 | 3300005327 | Ga0070658_10076319 | Ga0070658_100763193 | 287 |
| 34 | 3300005328 | Ga0070676_10091785 | Ga0070676_100917852 | 287 |
| 35 | 3300005329 | Ga0070683_100049514 | Ga0070683_1000495142 | 287 |
| 36 | 3300005331 | Ga0070670_100078639 | Ga0070670_1000786393 | 287 |
| 37 | 3300005334 | Ga0068869_100245364 | Ga0068869_1002453642 | 287 |
| 38 | 3300005335 | Ga0070666_10013740 | Ga0070666_100137403 | 287 |
| 39 | 3300005344 | Ga0070661_100010643 | Ga0070661_1000106437 | 287 |
| 40 | 3300005354 | Ga0070675_100001164 | Ga0070675_10000116412 | 287 |
| 41 | 3300005355 | Ga0070671_100003945 | Ga0070671_1000039456 | 287 |
| 42 | 3300005364 | Ga0070673_100001390 | Ga0070673_10000139013 | 287 |
| 43 | 3300005456 | Ga0070678_100002266 | Ga0070678_1000022662 | 287 |
| 44 | 3300005543 | Ga0070672_100002997 | Ga0070672_1000029973 | 287 |
| 45 | 3300005564 | Ga0070664_100005343 | Ga0070664_1000053432 | 287 |
| 46 | 3300005578 | Ga0068854_100002668 | Ga0068854_10000266810 | 287 |
| 47 | 3300005616 | Ga0068852_100006161 | Ga0068852_1000061613 | 287 |
| 48 | 3300005618 | Ga0068864_100024434 | Ga0068864_1000244344 | 287 |
| 49 | 3300006237 | Ga0097621_100004947 | Ga0097621_10000494711 | 287 |
| 50 | 3300006358 | Ga0068871_100000889 | Ga0068871_10000088913 | 287 |
| 51 | 3300013296 | Ga0157374_10003535 | Ga0157374_100035354 | 287 |
| 52 | 3300013297 | Ga0157378_10005177 | Ga0157378_100051773 | 287 |
| 53 | 3300013306 | Ga0163162_10014588 | Ga0163162_1001458811 | 287 |
| 54 | 3300013308 | Ga0157375_10006008 | Ga0157375_1000600814 | 287 |
| 55 | 3300014745 | Ga0157377_10151750 | Ga0157377_101517501 | 287 |
| 56 | 3300014969 | Ga0157376_10004059 | Ga0157376_1000405913 | 287 |
| 57 | 3300025907 | Ga0207645_10070940 | Ga0207645_100709402 | 287 |
| 58 | 3300025920 | Ga0207649_10004308 | Ga0207649_100043089 | 287 |
| 59 | 3300025920 | Ga0207649_10027243 | Ga0207649_100272435 | 287 |
| 60 | 3300025925 | Ga0207650_10004028 | Ga0207650_1000402812 | 287 |
| 61 | 3300025926 | Ga0207659_10002215 | Ga0207659_100022153 | 287 |
| 62 | 3300025931 | Ga0207644_10000418 | Ga0207644_1000041826 | 287 |
| 63 | 3300025940 | Ga0207691_10000110 | Ga0207691_1000011012 | 287 |
| 64 | 3300025944 | Ga0207661_10158312 | Ga0207661_101583122 | 287 |
| 65 | 3300025945 | Ga0207679_10004251 | Ga0207679_1000425111 | 287 |
| 66 | 3300025960 | Ga0207651_10011098 | Ga0207651_100110983 | 287 |
| 67 | 3300026089 | Ga0207648_10034169 | Ga0207648_100341696 | 287 |
| 68 | 3300026095 | Ga0207676_10021023 | Ga0207676_100210236 | 287 |
| 69 | 3300026121 | Ga0207683_10002093 | Ga0207683_100020934 | 287 |
| 70 | 3300026142 | Ga0207698_10002351 | Ga0207698_100023513 | 287 |
| 71 | 3300048903 | Ga0496100_0073425 | Ga0496100_0073425_1143_2114 | 287 |
| 72 | 3300048904 | Ga0496101_0119938 | Ga0496101_0119938_700_1671 | 287 |
| 73 | 3300048905 | Ga0496102_0079592 | Ga0496102_0079592_1950_2921 | 287 |
| 74 | 3300048909 | Ga0496106_0279115 | Ga0496106_0279115_60_1031 | 287 |
| 75 | 3300048911 | Ga0496108_0008518 | Ga0496108_0008518_954_1925 | 287 |
| 76 | 3300048912 | Ga0496109_0165277 | Ga0496109_0165277_132_1103 | 287 |
| 77 | 3300048913 | Ga0496110_0013289 | Ga0496110_0013289_284_1255 | 287 |
| 78 | 3300048915 | Ga0496112_0174022 | Ga0496112_0174022_188_1159 | 287 |
| 79 | 3300048917 | Ga0496114_0120627 | Ga0496114_0120627_617_1588 | 287 |
| 80 | 3300049576 | Ga0501040_0037972 | Ga0501040_0037972_203_1159 | 287 |
| 81 | 3300049577 | Ga0501041_0011051 | Ga0501041_0011051_3633_4589 | 287 |
| 82 | 3300049578 | Ga0501042_0079039 | Ga0501042_0079039_130_1086 | 287 |
| 83 | 3300049580 | Ga0501046_0062584 | Ga0501046_0062584_18_974 | 287 |
| 84 | 3300049588 | Ga0501072_0135022 | Ga0501072_0135022_38_994 | 287 |
| 85 | 3300049743 | Ga0501081_0174279 | Ga0501081_0174279_565_1521 | 287 |
| 86 | 3300009176 | Ga0105242_10119875 | Ga0105242_101198752 | 288 |
| 87 | 3300005564 | Ga0070664_100117619 | Ga0070664_1001176192 | 289 |
| 88 | 3300005616 | Ga0068852_100004563 | Ga0068852_1000045637 | 289 |
| 89 | 3300005618 | Ga0068864_100058463 | Ga0068864_1000584632 | 289 |
| 90 | 3300025945 | Ga0207679_10041185 | Ga0207679_100411852 | 289 |
| 91 | 3300025960 | Ga0207651_10096744 | Ga0207651_100967442 | 289 |
| 92 | 3300026121 | Ga0207683_10019117 | Ga0207683_100191174 | 289 |
| 93 | 3300005329 | Ga0070683_100008196 | Ga0070683_1000081966 | 290 |
| 94 | 3300005344 | Ga0070661_100001413 | Ga0070661_1000014137 | 290 |
| 95 | 3300005435 | Ga0070714_100013143 | Ga0070714_1000131434 | 290 |
| 96 | 3300005458 | Ga0070681_10016128 | Ga0070681_100161283 | 290 |
| 97 | 3300005535 | Ga0070684_100022030 | Ga0070684_1000220306 | 290 |
| 98 | 3300005539 | Ga0068853_100054906 | Ga0068853_1000549063 | 290 |
| 99 | 3300005564 | Ga0070664_100035236 | Ga0070664_1000352365 | 290 |
| 100 | 3300005577 | Ga0068857_100000810 | Ga0068857_10000081015 | 290 |
| 101 | 3300005578 | Ga0068854_100012218 | Ga0068854_1000122186 | 290 |
| 102 | 3300005614 | Ga0068856_100014288 | Ga0068856_1000142886 | 290 |
| 103 | 3300005616 | Ga0068852_100001129 | Ga0068852_1000011296 | 290 |
| 104 | 3300009093 | Ga0105240_10001807 | Ga0105240_1000180728 | 290 |
| 105 | 3300009545 | Ga0105237_10274330 | Ga0105237_102743302 | 290 |
| 106 | 3300009551 | Ga0105238_10001317 | Ga0105238_1000131715 | 290 |
| 107 | 3300013102 | Ga0157371_10161204 | Ga0157371_101612042 | 290 |
| 108 | 3300013104 | Ga0157370_10025696 | Ga0157370_100256965 | 290 |
| 109 | 3300013296 | Ga0157374_10061974 | Ga0157374_100619743 | 290 |
| 110 | 3300025912 | Ga0207707_10086051 | Ga0207707_100860511 | 290 |
| 111 | 3300025914 | Ga0207671_10250582 | Ga0207671_102505822 | 290 |
| 112 | 3300025919 | Ga0207657_10012171 | Ga0207657_100121712 | 290 |
| 113 | 3300025924 | Ga0207694_10003964 | Ga0207694_100039644 | 290 |
| 114 | 3300025944 | Ga0207661_10005122 | Ga0207661_100051225 | 290 |
| 115 | 3300025981 | Ga0207640_10150603 | Ga0207640_101506032 | 290 |
| 116 | 3300026041 | Ga0207639_10041571 | Ga0207639_100415713 | 290 |
| 117 | 3300026078 | Ga0207702_10003982 | Ga0207702_100039827 | 290 |
| 118 | 3300026116 | Ga0207674_10000418 | Ga0207674_1000041829 | 290 |
| 119 | 3300026142 | Ga0207698_10020906 | Ga0207698_100209062 | 290 |
| 120 | 3300048905 | Ga0496102_0431719 | Ga0496102_0431719_10_891 | 290 |
| 121 | 3300005364 | Ga0070673_100148629 | Ga0070673_1001486292 | 291 |
| 122 | 3300025893 | Ga0207682_10116211 | Ga0207682_101162111 | 291 |
| 123 | 3300005564 | Ga0070664_100212699 | Ga0070664_1002126992 | 292 |
| 124 | 3300005844 | Ga0068862_100057883 | Ga0068862_1000578832 | 292 |
| 125 | 3300035172 | Ga0373955_0058411 | Ga0373955_0058411_203_1177 | 293 |
| 126 | 3300036401 | Ga0373937_0105102 | Ga0373937_0105102_1270_2244 | 293 |
| 127 | 3300045836 | Ga0466958_0117392 | Ga0466958_0117392_66_1079 | 293 |
| 128 | 3300046539 | Ga0495621_0029949 | Ga0495621_0029949_137_1105 | 293 |
| 129 | 3300005366 | Ga0070659_100230114 | Ga0070659_1002301142 | 295 |
| 130 | 3300025945 | Ga0207679_10064662 | Ga0207679_100646622 | 295 |
| 131 | 3300031824 | Ga0307413_10007784 | Ga0307413_100077845 | 296 |
| 132 | 3300031995 | Ga0307409_100040847 | Ga0307409_1000408473 | 296 |
| 133 | 3300032004 | Ga0307414_10047027 | Ga0307414_100470271 | 296 |
| 134 | 3300049587 | Ga0501071_0011203 | Ga0501071_0011203_3174_4133 | 296 |
| 135 | 3300005330 | Ga0070690_100067937 | Ga0070690_1000679372 | 298 |
| 136 | 3300005456 | Ga0070678_100074615 | Ga0070678_1000746152 | 298 |
| 137 | 3300005543 | Ga0070672_100122065 | Ga0070672_1001220652 | 298 |
| 138 | 3300005615 | Ga0070702_100048117 | Ga0070702_1000481172 | 298 |
| 139 | 3300026121 | Ga0207683_10083523 | Ga0207683_100835232 | 298 |
| 140 | 3300035692 | Ga0373935_0276388 | Ga0373935_0276388_169_1131 | 298 |
| 141 | 3300005330 | Ga0070690_100019776 | Ga0070690_1000197764 | 299 |
| 142 | 3300005333 | Ga0070677_10075123 | Ga0070677_100751232 | 299 |
| 143 | 3300005334 | Ga0068869_100004150 | Ga0068869_1000041504 | 299 |
| 144 | 3300005340 | Ga0070689_100041882 | Ga0070689_1000418822 | 299 |
| 145 | 3300005354 | Ga0070675_100007866 | Ga0070675_1000078668 | 299 |
| 146 | 3300005356 | Ga0070674_100107416 | Ga0070674_1001074163 | 299 |
| 147 | 3300005364 | Ga0070673_100003829 | Ga0070673_1000038299 | 299 |
| 148 | 3300005365 | Ga0070688_100097047 | Ga0070688_1000970472 | 299 |
| 149 | 3300005367 | Ga0070667_100184171 | Ga0070667_1001841713 | 299 |
| 150 | 3300005440 | Ga0070705_100164985 | Ga0070705_1001649851 | 299 |
| 151 | 3300005445 | Ga0070708_100000371 | Ga0070708_10000037112 | 299 |
| 152 | 3300005459 | Ga0068867_100160325 | Ga0068867_1001603252 | 299 |
| 153 | 3300005618 | Ga0068864_100059590 | Ga0068864_1000595902 | 299 |
| 154 | 3300005841 | Ga0068863_100063854 | Ga0068863_1000638543 | 299 |
| 155 | 3300005844 | Ga0068862_100093479 | Ga0068862_1000934792 | 299 |
| 156 | 3300013297 | Ga0157378_10025324 | Ga0157378_100253245 | 299 |
| 157 | 3300013308 | Ga0157375_10004326 | Ga0157375_1000432610 | 299 |
| 158 | 3300013308 | Ga0157375_10175165 | Ga0157375_101751652 | 299 |
| 159 | 3300014969 | Ga0157376_10014370 | Ga0157376_100143704 | 299 |
| 160 | 3300017792 | Ga0163161_10169871 | Ga0163161_101698712 | 299 |
| 161 | 3300025926 | Ga0207659_10048261 | Ga0207659_100482613 | 299 |
| 162 | 3300025942 | Ga0207689_10005712 | Ga0207689_100057125 | 299 |
| 163 | 3300025960 | Ga0207651_10011420 | Ga0207651_100114202 | 299 |
| 164 | 3300025986 | Ga0207658_10084382 | Ga0207658_100843823 | 299 |
| 165 | 3300025986 | Ga0207658_10327854 | Ga0207658_103278542 | 299 |
| 166 | 3300026089 | Ga0207648_10007171 | Ga0207648_1000717111 | 299 |
| 167 | 3300026089 | Ga0207648_10151836 | Ga0207648_101518363 | 299 |
| 168 | 3300028381 | Ga0268264_10164105 | Ga0268264_101641052 | 299 |
| 169 | 3300005354 | Ga0070675_100011711 | Ga0070675_1000117117 | 300 |
| 170 | 3300005434 | Ga0070709_10191406 | Ga0070709_101914061 | 300 |
| 171 | 3300005438 | Ga0070701_10106445 | Ga0070701_101064452 | 300 |
| 172 | 3300005441 | Ga0070700_100035152 | Ga0070700_1000351523 | 300 |
| 173 | 3300005456 | Ga0070678_100070057 | Ga0070678_1000700572 | 300 |
| 174 | 3300005543 | Ga0070672_100014473 | Ga0070672_1000144734 | 300 |
| 175 | 3300005843 | Ga0068860_100207226 | Ga0068860_1002072262 | 300 |
| 176 | 3300006881 | Ga0068865_100095237 | Ga0068865_1000952372 | 300 |
| 177 | 3300009148 | Ga0105243_10011356 | Ga0105243_100113567 | 300 |
| 178 | 3300025923 | Ga0207681_10318787 | Ga0207681_103187872 | 300 |
| 179 | 3300025926 | Ga0207659_10070130 | Ga0207659_100701302 | 300 |
| 180 | 3300025940 | Ga0207691_10007330 | Ga0207691_100073309 | 300 |
| 181 | 3300025986 | Ga0207658_10306745 | Ga0207658_103067451 | 300 |
| 182 | 3300026075 | Ga0207708_10061180 | Ga0207708_100611802 | 300 |
| 183 | 3300026121 | Ga0207683_10009224 | Ga0207683_100092248 | 300 |
| 184 | 3300028380 | Ga0268265_10038684 | Ga0268265_100386843 | 300 |
| 185 | 3300005335 | Ga0070666_10042430 | Ga0070666_100424302 | 301 |
| 186 | 3300005456 | Ga0070678_100018760 | Ga0070678_1000187602 | 301 |
| 187 | 3300005543 | Ga0070672_100117325 | Ga0070672_1001173254 | 301 |
| 188 | 3300005548 | Ga0070665_100013602 | Ga0070665_1000136025 | 301 |
| 189 | 3300006358 | Ga0068871_100271326 | Ga0068871_1002713261 | 301 |
| 190 | 3300006852 | Ga0075433_10237043 | Ga0075433_102370432 | 301 |
| 191 | 3300013297 | Ga0157378_10245304 | Ga0157378_102453042 | 301 |
| 192 | 3300013308 | Ga0157375_10100213 | Ga0157375_101002132 | 301 |
| 193 | 3300014969 | Ga0157376_10008580 | Ga0157376_100085804 | 301 |
| 194 | 3300025940 | Ga0207691_10013997 | Ga0207691_100139974 | 301 |
| 195 | 3300026089 | Ga0207648_10093737 | Ga0207648_100937371 | 301 |
| 196 | 3300026121 | Ga0207683_10007943 | Ga0207683_100079434 | 301 |
| 197 | 3300028379 | Ga0268266_10058090 | Ga0268266_100580902 | 301 |
| 198 | 3300050511 | nmdc:mga08y16_190416_c1 | nmdc:mga08y16_190416_c1_98_1054 | 301 |
| 199 | 3300005347 | Ga0070668_100032129 | Ga0070668_1000321292 | 302 |
| 200 | 3300005353 | Ga0070669_100020709 | Ga0070669_1000207094 | 302 |
| 201 | 3300005354 | Ga0070675_100029983 | Ga0070675_1000299833 | 302 |
| 202 | 3300005364 | Ga0070673_100029732 | Ga0070673_1000297323 | 302 |
| 203 | 3300005367 | Ga0070667_100117532 | Ga0070667_1001175323 | 302 |
| 204 | 3300005457 | Ga0070662_100016778 | Ga0070662_1000167784 | 302 |
| 205 | 3300005543 | Ga0070672_100002353 | Ga0070672_1000023534 | 302 |
| 206 | 3300005617 | Ga0068859_100309978 | Ga0068859_1003099781 | 302 |
| 207 | 3300005719 | Ga0068861_100072525 | Ga0068861_1000725253 | 302 |
| 208 | 3300005841 | Ga0068863_100069212 | Ga0068863_1000692123 | 302 |
| 209 | 3300005842 | Ga0068858_100020243 | Ga0068858_1000202434 | 302 |
| 210 | 3300006931 | Ga0097620_100309968 | Ga0097620_1003099683 | 302 |
| 211 | 3300014326 | Ga0157380_10113295 | Ga0157380_101132954 | 302 |
| 212 | 3300014968 | Ga0157379_10026196 | Ga0157379_100261964 | 302 |
| 213 | 3300017792 | Ga0163161_10114587 | Ga0163161_101145872 | 302 |
| 214 | 3300025933 | Ga0207706_10021394 | Ga0207706_100213944 | 302 |
| 215 | 3300025937 | Ga0207669_10042744 | Ga0207669_100427443 | 302 |
| 216 | 3300025940 | Ga0207691_10002783 | Ga0207691_100027838 | 302 |
| 217 | 3300025960 | Ga0207651_10013977 | Ga0207651_100139772 | 302 |
| 218 | 3300025986 | Ga0207658_10049526 | Ga0207658_100495262 | 302 |
| 219 | 3300026035 | Ga0207703_10016185 | Ga0207703_100161855 | 302 |
| 220 | 3300026118 | Ga0207675_100089172 | Ga0207675_1000891722 | 302 |
| 221 | 3300026121 | Ga0207683_10197483 | Ga0207683_101974832 | 302 |
| 222 | 3300028381 | Ga0268264_10013339 | Ga0268264_100133392 | 302 |
| 223 | 3300028577 | Ga0265318_10004630 | Ga0265318_100046301 | 302 |
| 224 | 3300031235 | Ga0265330_10024986 | Ga0265330_100249863 | 302 |
| 225 | 3300031238 | Ga0265332_10004725 | Ga0265332_100047255 | 302 |
| 226 | 3300031239 | Ga0265328_10002094 | Ga0265328_100020941 | 302 |
| 227 | 3300031240 | Ga0265320_10045903 | Ga0265320_100459033 | 302 |
| 228 | 3300031242 | Ga0265329_10005279 | Ga0265329_100052794 | 302 |
| 229 | 3300031250 | Ga0265331_10001778 | Ga0265331_100017788 | 302 |
| 230 | 3300031251 | Ga0265327_10050784 | Ga0265327_100507841 | 302 |
| 231 | 3300031711 | Ga0265314_10002233 | Ga0265314_100022334 | 302 |
| 232 | 3300031712 | Ga0265342_10016999 | Ga0265342_100169994 | 302 |
| 233 | 3300025302 | Ga0207426_1026574 | Ga0207426_10265742 | 304 |
| 234 | 3300049576 | Ga0501040_0003627 | Ga0501040_0003627_6192_7121 | 307 |
| 235 | 3300006186 | Ga0075369_10009342 | Ga0075369_100093423 | 309 |
| 236 | 3300050494 | nmdc:mga06z11_203820_c1 | nmdc:mga06z11_203820_c1_158_1099 | 311 |
| 237 | 3300005290 | Ga0065712_10150630 | Ga0065712_101506302 | 312 |
| 238 | 3300005331 | Ga0070670_100192338 | Ga0070670_1001923382 | 312 |
| 239 | 3300005333 | Ga0070677_10023294 | Ga0070677_100232943 | 312 |
| 240 | 3300005354 | Ga0070675_100089147 | Ga0070675_1000891472 | 312 |
| 241 | 3300005367 | Ga0070667_100244664 | Ga0070667_1002446642 | 312 |
| 242 | 3300005456 | Ga0070678_100173458 | Ga0070678_1001734582 | 312 |
| 243 | 3300005618 | Ga0068864_100098739 | Ga0068864_1000987392 | 312 |
| 244 | 3300005618 | Ga0068864_100366317 | Ga0068864_1003663171 | 312 |
| 245 | 3300005841 | Ga0068863_100355842 | Ga0068863_1003558422 | 312 |
| 246 | 3300013296 | Ga0157374_10253304 | Ga0157374_102533042 | 312 |
| 247 | 3300025893 | Ga0207682_10006116 | Ga0207682_100061162 | 312 |
| 248 | 3300025907 | Ga0207645_10019277 | Ga0207645_100192773 | 312 |
| 249 | 3300025908 | Ga0207643_10077376 | Ga0207643_100773762 | 312 |
| 250 | 3300025925 | Ga0207650_10005988 | Ga0207650_100059887 | 312 |
| 251 | 3300025925 | Ga0207650_10180802 | Ga0207650_101808022 | 312 |
| 252 | 3300025940 | Ga0207691_10253876 | Ga0207691_102538762 | 312 |
| 253 | 3300025942 | Ga0207689_10021896 | Ga0207689_100218963 | 312 |
| 254 | 3300025960 | Ga0207651_10015843 | Ga0207651_100158432 | 312 |
| 255 | 3300026088 | Ga0207641_10013145 | Ga0207641_100131455 | 312 |
| 256 | 3300026095 | Ga0207676_10001836 | Ga0207676_1000183612 | 312 |
| 257 | 3300026095 | Ga0207676_10254630 | Ga0207676_102546302 | 312 |
| 258 | 3300046539 | Ga0495621_0049146 | Ga0495621_0049146_502_1485 | 312 |
| 259 | 3300053161 | Ga0500634_0030352 | Ga0500634_0030352_1849_2838 | 312 |
| 260 | 3300005327 | Ga0070658_10203236 | Ga0070658_102032362 | 313 |
| 261 | 3300005338 | Ga0068868_100025100 | Ga0068868_1000251002 | 313 |
| 262 | 3300005340 | Ga0070689_100137134 | Ga0070689_1001371342 | 313 |
| 263 | 3300005343 | Ga0070687_100035873 | Ga0070687_1000358732 | 313 |
| 264 | 3300005344 | Ga0070661_100148343 | Ga0070661_1001483431 | 313 |
| 265 | 3300005347 | Ga0070668_100088437 | Ga0070668_1000884371 | 313 |
| 266 | 3300005355 | Ga0070671_100116052 | Ga0070671_1001160522 | 313 |
| 267 | 3300005356 | Ga0070674_100184445 | Ga0070674_1001844451 | 313 |
| 268 | 3300005456 | Ga0070678_100011313 | Ga0070678_1000113133 | 313 |
| 269 | 3300005457 | Ga0070662_100121081 | Ga0070662_1001210812 | 313 |
| 270 | 3300005459 | Ga0068867_100296037 | Ga0068867_1002960372 | 313 |
| 271 | 3300005530 | Ga0070679_100290388 | Ga0070679_1002903881 | 313 |
| 272 | 3300005548 | Ga0070665_100326416 | Ga0070665_1003264162 | 313 |
| 273 | 3300005718 | Ga0068866_10027411 | Ga0068866_100274112 | 313 |
| 274 | 3300005834 | Ga0068851_10027476 | Ga0068851_100274764 | 313 |
| 275 | 3300005841 | Ga0068863_100051165 | Ga0068863_1000511654 | 313 |
| 276 | 3300006237 | Ga0097621_100211021 | Ga0097621_1002110212 | 313 |
| 277 | 3300009148 | Ga0105243_10049412 | Ga0105243_100494123 | 313 |
| 278 | 3300009176 | Ga0105242_10181902 | Ga0105242_101819022 | 313 |
| 279 | 3300009177 | Ga0105248_10046548 | Ga0105248_100465485 | 313 |
| 280 | 3300013296 | Ga0157374_10100744 | Ga0157374_101007442 | 313 |
| 281 | 3300013306 | Ga0163162_10559061 | Ga0163162_105590612 | 313 |
| 282 | 3300014968 | Ga0157379_10058641 | Ga0157379_100586413 | 313 |
| 283 | 3300025912 | Ga0207707_10005380 | Ga0207707_100053802 | 313 |
| 284 | 3300025917 | Ga0207660_10323856 | Ga0207660_103238562 | 313 |
| 285 | 3300025918 | Ga0207662_10017902 | Ga0207662_100179023 | 313 |
| 286 | 3300025920 | Ga0207649_10117399 | Ga0207649_101173991 | 313 |
| 287 | 3300025921 | Ga0207652_10274502 | Ga0207652_102745022 | 313 |
| 288 | 3300025925 | Ga0207650_10006311 | Ga0207650_100063111 | 313 |
| 289 | 3300025937 | Ga0207669_10023510 | Ga0207669_100235103 | 313 |
| 290 | 3300025940 | Ga0207691_10006961 | Ga0207691_1000696111 | 313 |
| 291 | 3300025945 | Ga0207679_10153338 | Ga0207679_101533381 | 313 |
| 292 | 3300025961 | Ga0207712_10180410 | Ga0207712_101804102 | 313 |
| 293 | 3300026075 | Ga0207708_10057661 | Ga0207708_100576614 | 313 |
| 294 | 3300026089 | Ga0207648_10033234 | Ga0207648_100332347 | 313 |
| 295 | 3300026089 | Ga0207648_10078985 | Ga0207648_100789853 | 313 |
| 296 | 3300026121 | Ga0207683_10018176 | Ga0207683_100181765 | 313 |
| 297 | 3300035691 | Ga0373931_0036760 | Ga0373931_0036760_1290_2240 | 313 |
| 298 | 3300048907 | Ga0496104_0353608 | Ga0496104_0353608_209_1174 | 313 |
| 299 | 3300048913 | Ga0496110_0028831 | Ga0496110_0028831_3181_4146 | 313 |
| 300 | 3300048917 | Ga0496114_0169237 | Ga0496114_0169237_233_1198 | 313 |
| 301 | 3300050510 | nmdc:mga06r32_330750_c1 | nmdc:mga06r32_330750_c1_540_1493 | 313 |
| 302 | 3300053117 | Ga0500593_060314 | Ga0500593_060314_581_1549 | 314 |
| 303 | iso_pu_bacteria | 2887375801 | 2887376779 | 314 |
| 304 | 3300005329 | Ga0070683_100220487 | Ga0070683_1002204871 | 315 |
| 305 | 3300005354 | Ga0070675_100015675 | Ga0070675_1000156751 | 315 |
| 306 | 3300005841 | Ga0068863_100010386 | Ga0068863_1000103862 | 315 |
| 307 | 3300005843 | Ga0068860_100049738 | Ga0068860_1000497381 | 315 |
| 308 | 3300005844 | Ga0068862_100104913 | Ga0068862_1001049132 | 315 |
| 309 | 3300006847 | Ga0075431_100257581 | Ga0075431_1002575812 | 315 |
| 310 | 3300025297 | Ga0209758_1004073 | Ga0209758_10040739 | 315 |
| 311 | 3300025315 | Ga0207697_10014647 | Ga0207697_100146474 | 315 |
| 312 | 3300025934 | Ga0207686_10006730 | Ga0207686_100067304 | 315 |
| 313 | 3300026142 | Ga0207698_10106297 | Ga0207698_101062972 | 315 |
| 314 | 3300028380 | Ga0268265_10040634 | Ga0268265_100406343 | 315 |
| 315 | 3300036401 | Ga0373937_0497660 | Ga0373937_0497660_55_1008 | 315 |
| 316 | 3300050510 | nmdc:mga06r32_224243_c1 | nmdc:mga06r32_224243_c1_148_1098 | 315 |
| 317 | 3300005458 | Ga0070681_10091688 | Ga0070681_100916882 | 316 |
| 318 | 3300005467 | Ga0070706_100102790 | Ga0070706_1001027902 | 316 |
| 319 | 3300005467 | Ga0070706_100216055 | Ga0070706_1002160552 | 316 |
| 320 | 3300005841 | Ga0068863_100091751 | Ga0068863_1000917513 | 316 |
| 321 | 3300025922 | Ga0207646_10139994 | Ga0207646_101399942 | 316 |
| 322 | 3300025940 | Ga0207691_10187378 | Ga0207691_101873782 | 316 |
| 323 | 3300028786 | Ga0307517_10075043 | Ga0307517_100750432 | 316 |
| 324 | 3300046454 | Ga0495592_0122363 | Ga0495592_0122363_69_1052 | 316 |
| 325 | 3300046519 | Ga0495632_0002900 | Ga0495632_0002900_3855_4817 | 316 |
| 326 | 3300046694 | Ga0495649_0003265 | Ga0495649_0003265_7806_8768 | 316 |
| 327 | 3300047321 | Ga0495676_0157214 | Ga0495676_0157214_522_1505 | 316 |
| 328 | 3300047443 | Ga0495687_001187 | Ga0495687_001187_8794_9756 | 316 |
| 329 | 3300050512 | nmdc:mga0n895_258723_c1 | nmdc:mga0n895_258723_c1_692_1660 | 316 |
| 330 | iso_pu_bacteria | 2842747753 | 2842750356 | 316 |
| 331 | 3300005295 | Ga0065707_10088917 | Ga0065707_100889173 | 317 |
| 332 | 3300005328 | Ga0070676_10019688 | Ga0070676_100196884 | 317 |
| 333 | 3300005330 | Ga0070690_100003566 | Ga0070690_1000035668 | 317 |
| 334 | 3300005334 | Ga0068869_100000262 | Ga0068869_1000002624 | 317 |
| 335 | 3300005336 | Ga0070680_100152001 | Ga0070680_1001520012 | 317 |
| 336 | 3300005337 | Ga0070682_100001657 | Ga0070682_1000016575 | 317 |
| 337 | 3300005340 | Ga0070689_100007621 | Ga0070689_1000076217 | 317 |
| 338 | 3300005341 | Ga0070691_10002481 | Ga0070691_100024817 | 317 |
| 339 | 3300005343 | Ga0070687_100000189 | Ga0070687_10000018919 | 317 |
| 340 | 3300005344 | Ga0070661_100173043 | Ga0070661_1001730432 | 317 |
| 341 | 3300005345 | Ga0070692_10014109 | Ga0070692_100141093 | 317 |
| 342 | 3300005364 | Ga0070673_100130877 | Ga0070673_1001308772 | 317 |
| 343 | 3300005365 | Ga0070688_100154518 | Ga0070688_1001545182 | 317 |
| 344 | 3300005440 | Ga0070705_100000307 | Ga0070705_1000003072 | 317 |
| 345 | 3300005441 | Ga0070700_100000145 | Ga0070700_10000014516 | 317 |
| 346 | 3300005444 | Ga0070694_100011291 | Ga0070694_1000112912 | 317 |
| 347 | 3300005456 | Ga0070678_100269644 | Ga0070678_1002696442 | 317 |
| 348 | 3300005459 | Ga0068867_100012147 | Ga0068867_1000121474 | 317 |
| 349 | 3300005535 | Ga0070684_100431559 | Ga0070684_1004315591 | 317 |
| 350 | 3300005539 | Ga0068853_100096395 | Ga0068853_1000963952 | 317 |
| 351 | 3300005543 | Ga0070672_100078982 | Ga0070672_1000789822 | 317 |
| 352 | 3300005544 | Ga0070686_100002139 | Ga0070686_1000021399 | 317 |
| 353 | 3300005545 | Ga0070695_100000178 | Ga0070695_10000017810 | 317 |
| 354 | 3300005546 | Ga0070696_100000248 | Ga0070696_10000024819 | 317 |
| 355 | 3300005547 | Ga0070693_100011756 | Ga0070693_1000117564 | 317 |
| 356 | 3300005547 | Ga0070693_100097190 | Ga0070693_1000971902 | 317 |
| 357 | 3300005548 | Ga0070665_100101673 | Ga0070665_1001016731 | 317 |
| 358 | 3300005549 | Ga0070704_100002435 | Ga0070704_1000024356 | 317 |
| 359 | 3300005563 | Ga0068855_100034194 | Ga0068855_1000341944 | 317 |
| 360 | 3300005564 | Ga0070664_100015050 | Ga0070664_1000150504 | 317 |
| 361 | 3300005578 | Ga0068854_100005409 | Ga0068854_1000054092 | 317 |
| 362 | 3300005614 | Ga0068856_100084522 | Ga0068856_1000845222 | 317 |
| 363 | 3300005615 | Ga0070702_100000014 | Ga0070702_10000001419 | 317 |
| 364 | 3300005617 | Ga0068859_100003654 | Ga0068859_1000036548 | 317 |
| 365 | 3300005718 | Ga0068866_10000777 | Ga0068866_100007778 | 317 |
| 366 | 3300005719 | Ga0068861_100000581 | Ga0068861_10000058119 | 317 |
| 367 | 3300005840 | Ga0068870_10001592 | Ga0068870_100015924 | 317 |
| 368 | 3300005842 | Ga0068858_100004586 | Ga0068858_1000045869 | 317 |
| 369 | 3300005843 | Ga0068860_100028614 | Ga0068860_1000286142 | 317 |
| 370 | 3300005844 | Ga0068862_100006705 | Ga0068862_1000067057 | 317 |
| 371 | 3300006051 | Ga0075364_10044609 | Ga0075364_100446091 | 317 |
| 372 | 3300006195 | Ga0075366_10013151 | Ga0075366_100131512 | 317 |
| 373 | 3300006237 | Ga0097621_100000525 | Ga0097621_10000052521 | 317 |
| 374 | 3300006353 | Ga0075370_10064194 | Ga0075370_100641942 | 317 |
| 375 | 3300006358 | Ga0068871_100003413 | Ga0068871_1000034137 | 317 |
| 376 | 3300006881 | Ga0068865_100012523 | Ga0068865_1000125232 | 317 |
| 377 | 3300006931 | Ga0097620_100003654 | Ga0097620_1000036548 | 317 |
| 378 | 3300007076 | Ga0075435_100023975 | Ga0075435_1000239755 | 317 |
| 379 | 3300007265 | Ga0099794_10041717 | Ga0099794_100417172 | 317 |
| 380 | 3300009098 | Ga0105245_10001140 | Ga0105245_1000114018 | 317 |
| 381 | 3300009148 | Ga0105243_10018014 | Ga0105243_100180142 | 317 |
| 382 | 3300009174 | Ga0105241_10018045 | Ga0105241_100180457 | 317 |
| 383 | 3300009176 | Ga0105242_10000610 | Ga0105242_1000061023 | 317 |
| 384 | 3300009553 | Ga0105249_10023298 | Ga0105249_100232988 | 317 |
| 385 | 3300010375 | Ga0105239_10071817 | Ga0105239_100718174 | 317 |
| 386 | 3300011119 | Ga0105246_10035336 | Ga0105246_100353362 | 317 |
| 387 | 3300013297 | Ga0157378_10001659 | Ga0157378_100016592 | 317 |
| 388 | 3300013306 | Ga0163162_10773903 | Ga0163162_107739031 | 317 |
| 389 | 3300013308 | Ga0157375_10656799 | Ga0157375_106567991 | 317 |
| 390 | 3300014745 | Ga0157377_10032877 | Ga0157377_100328772 | 317 |
| 391 | 3300025315 | Ga0207697_10074865 | Ga0207697_100748652 | 317 |
| 392 | 3300025885 | Ga0207653_10025498 | Ga0207653_100254982 | 317 |
| 393 | 3300025899 | Ga0207642_10000667 | Ga0207642_100006676 | 317 |
| 394 | 3300025901 | Ga0207688_10071130 | Ga0207688_100711302 | 317 |
| 395 | 3300025907 | Ga0207645_10020048 | Ga0207645_100200483 | 317 |
| 396 | 3300025908 | Ga0207643_10030155 | Ga0207643_100301554 | 317 |
| 397 | 3300025917 | Ga0207660_10006068 | Ga0207660_100060684 | 317 |
| 398 | 3300025918 | Ga0207662_10000021 | Ga0207662_1000002166 | 317 |
| 399 | 3300025927 | Ga0207687_10000833 | Ga0207687_1000083318 | 317 |
| 400 | 3300025934 | Ga0207686_10000804 | Ga0207686_1000080412 | 317 |
| 401 | 3300025936 | Ga0207670_10003028 | Ga0207670_100030282 | 317 |
| 402 | 3300025938 | Ga0207704_10000327 | Ga0207704_100003278 | 317 |
| 403 | 3300025942 | Ga0207689_10000426 | Ga0207689_100004269 | 317 |
| 404 | 3300025944 | Ga0207661_10208585 | Ga0207661_102085852 | 317 |
| 405 | 3300025949 | Ga0207667_10016330 | Ga0207667_100163307 | 317 |
| 406 | 3300025972 | Ga0207668_10032629 | Ga0207668_100326294 | 317 |
| 407 | 3300025981 | Ga0207640_10020311 | Ga0207640_100203115 | 317 |
| 408 | 3300026023 | Ga0207677_10014356 | Ga0207677_100143562 | 317 |
| 409 | 3300026035 | Ga0207703_10012010 | Ga0207703_100120109 | 317 |
| 410 | 3300026035 | Ga0207703_10562953 | Ga0207703_105629531 | 317 |
| 411 | 3300026041 | Ga0207639_10224277 | Ga0207639_102242772 | 317 |
| 412 | 3300026075 | Ga0207708_10000231 | Ga0207708_1000023118 | 317 |
| 413 | 3300026089 | Ga0207648_10025041 | Ga0207648_100250412 | 317 |
| 414 | 3300026089 | Ga0207648_10040042 | Ga0207648_100400424 | 317 |
| 415 | 3300026118 | Ga0207675_100000086 | Ga0207675_1000000867 | 317 |
| 416 | 3300027907 | Ga0207428_10303870 | Ga0207428_103038702 | 317 |
| 417 | 3300028379 | Ga0268266_10213896 | Ga0268266_102138963 | 317 |
| 418 | 3300028380 | Ga0268265_10022052 | Ga0268265_100220524 | 317 |
| 419 | 3300028381 | Ga0268264_10001620 | Ga0268264_100016202 | 317 |
| 420 | 3300035090 | Ga0373949_0006402 | Ga0373949_0006402_136_1122 | 317 |
| 421 | 3300035092 | Ga0373952_0003060 | Ga0373952_0003060_544_1530 | 317 |
| 422 | 3300035112 | Ga0373932_0001975 | Ga0373932_0001975_1455_2441 | 317 |
| 423 | 3300035114 | Ga0373939_0000701 | Ga0373939_0000701_4802_5788 | 317 |
| 424 | 3300035691 | Ga0373931_0001220 | Ga0373931_0001220_6540_7526 | 317 |
| 425 | 3300035725 | Ga0373947_0057448 | Ga0373947_0057448_1039_2025 | 317 |
| 426 | 3300037068 | Ga0373925_0290173 | Ga0373925_0290173_45_1031 | 317 |
| 427 | 3300045051 | Ga0451576_0008768 | Ga0451576_0008768_3384_4370 | 317 |
| 428 | 3300049570 | Ga0501033_0000891 | Ga0501033_0000891_1226_2185 | 317 |
| 429 | 3300050491 | nmdc:mga00v17_21077_c1 | nmdc:mga00v17_21077_c1_2058_3038 | 317 |
| 430 | 3300050492 | nmdc:mga0yw44_132864_c1 | nmdc:mga0yw44_132864_c1_227_1207 | 317 |
| 431 | 3300050493 | nmdc:mga0k408_2808_c1 | nmdc:mga0k408_2808_c1_5244_6218 | 317 |
| 432 | 3300050493 | nmdc:mga0k408_30058_c1 | nmdc:mga0k408_30058_c1_1890_2870 | 317 |
| 433 | 3300050496 | nmdc:mga07m45_16546_c1 | nmdc:mga07m45_16546_c1_1682_2656 | 317 |
| 434 | 3300050511 | nmdc:mga08y16_218739_c1 | nmdc:mga08y16_218739_c1_630_1616 | 317 |
| 435 | 3300050513 | nmdc:mga0rr50_12742_c1 | nmdc:mga0rr50_12742_c1_3978_4934 | 317 |
| 436 | 3300053087 | Ga0500643_003287 | Ga0500643_003287_5729_6712 | 317 |
| 437 | iso_pu_bacteria | 2881412998 | 2881413428 | 317 |
| 438 | 3300005615 | Ga0070702_100175751 | Ga0070702_1001757511 | 318 |
| 439 | 3300005719 | Ga0068861_100085480 | Ga0068861_1000854804 | 318 |
| 440 | 3300005841 | Ga0068863_100159625 | Ga0068863_1001596252 | 318 |
| 441 | 3300006852 | Ga0075433_10089533 | Ga0075433_100895332 | 318 |
| 442 | 3300006871 | Ga0075434_100034198 | Ga0075434_1000341984 | 318 |
| 443 | 3300014969 | Ga0157376_10132948 | Ga0157376_101329482 | 318 |
| 444 | 3300025923 | Ga0207681_10125986 | Ga0207681_101259862 | 318 |
| 445 | 3300025972 | Ga0207668_10026327 | Ga0207668_100263272 | 318 |
| 446 | 3300026088 | Ga0207641_10122835 | Ga0207641_101228352 | 318 |
| 447 | 3300026118 | Ga0207675_100092116 | Ga0207675_1000921164 | 318 |
| 448 | 3300027907 | Ga0207428_10133780 | Ga0207428_101337803 | 318 |
| 449 | 3300028573 | Ga0265334_10045098 | Ga0265334_100450982 | 318 |
| 450 | 3300028800 | Ga0265338_10107800 | Ga0265338_101078003 | 318 |
| 451 | 3300035691 | Ga0373931_0192453 | Ga0373931_0192453_116_1087 | 318 |
| 452 | 3300046537 | Ga0495598_0073683 | Ga0495598_0073683_55_1026 | 318 |
| 453 | 3300046615 | Ga0495656_0049377 | Ga0495656_0049377_657_1628 | 318 |
| 454 | 3300048905 | Ga0496102_0511775 | Ga0496102_0511775_29_994 | 318 |
| 455 | 3300053094 | Ga0500566_0000231 | Ga0500566_0000231_24783_25772 | 318 |
| 456 | 3300053153 | Ga0500616_0003403 | Ga0500616_0003403_10948_11922 | 318 |
| 457 | 3300053161 | Ga0500634_0053920 | Ga0500634_0053920_408_1397 | 318 |
| 458 | 3300006844 | Ga0075428_100092295 | Ga0075428_1000922953 | 319 |
| 459 | 3300009147 | Ga0114129_10236899 | Ga0114129_102368993 | 319 |
| 460 | 3300025936 | Ga0207670_10133756 | Ga0207670_101337561 | 319 |
| 461 | 3300035724 | Ga0373933_0180357 | Ga0373933_0180357_305_1270 | 319 |
| 462 | 3300036401 | Ga0373937_0107231 | Ga0373937_0107231_587_1552 | 319 |
| 463 | 3300037312 | Ga0395899_0005693 | Ga0395899_0005693_6876_7853 | 319 |
| 464 | 3300037312 | Ga0395899_0008434 | Ga0395899_0008434_1423_2400 | 319 |
| 465 | 3300037418 | Ga0395900_0034401 | Ga0395900_0034401_4075_5052 | 319 |
| 466 | 3300037418 | Ga0395900_0044109 | Ga0395900_0044109_1228_2205 | 319 |
| 467 | 3300037466 | Ga0395898_0006517 | Ga0395898_0006517_5135_6112 | 319 |
| 468 | 3300037466 | Ga0395898_0031484 | Ga0395898_0031484_2760_3737 | 319 |
| 469 | 3300037471 | Ga0395905_0004405 | Ga0395905_0004405_7015_7992 | 319 |
| 470 | 3300037471 | Ga0395905_0006862 | Ga0395905_0006862_10055_11032 | 319 |
| 471 | 3300038443 | Ga0395901_0007572 | Ga0395901_0007572_6413_7390 | 319 |
| 472 | 3300038443 | Ga0395901_0012635 | Ga0395901_0012635_4242_5219 | 319 |
| 473 | 3300041407 | Ga0439447_020607 | Ga0439447_020607_556_1536 | 319 |
| 474 | 3300048916 | Ga0496113_0383944 | Ga0496113_0383944_37_1068 | 319 |
| 475 | 3300049744 | Ga0501083_0098685 | Ga0501083_0098685_250_1221 | 319 |
| 476 | 3300050507 | nmdc:mga05p37_278921_c1 | nmdc:mga05p37_278921_c1_331_1296 | 319 |
| 477 | 3300005548 | Ga0070665_100010470 | Ga0070665_1000104703 | 320 |
| 478 | 3300005842 | Ga0068858_100264368 | Ga0068858_1002643682 | 320 |
| 479 | 3300006195 | Ga0075366_10142074 | Ga0075366_101420742 | 320 |
| 480 | 3300025302 | Ga0207426_1005137 | Ga0207426_10051376 | 320 |
| 481 | 3300025912 | Ga0207707_10019952 | Ga0207707_100199523 | 320 |
| 482 | 3300025925 | Ga0207650_10378416 | Ga0207650_103784161 | 320 |
| 483 | 3300025949 | Ga0207667_10010866 | Ga0207667_100108666 | 320 |
| 484 | 3300028379 | Ga0268266_10020803 | Ga0268266_100208033 | 320 |
| 485 | 3300031548 | Ga0307408_100172257 | Ga0307408_1001722571 | 320 |
| 486 | 3300031903 | Ga0307407_10069634 | Ga0307407_100696342 | 320 |
| 487 | 3300031911 | Ga0307412_10076632 | Ga0307412_100766322 | 320 |
| 488 | 3300031995 | Ga0307409_100483537 | Ga0307409_1004835372 | 320 |
| 489 | 3300032004 | Ga0307414_10136529 | Ga0307414_101365292 | 320 |
| 490 | 3300032126 | Ga0307415_100171527 | Ga0307415_1001715272 | 320 |
| 491 | 3300046558 | Ga0495633_0004166 | Ga0495633_0004166_1409_2425 | 320 |
| 492 | 3300053136 | Ga0500559_0007488 | Ga0500559_0007488_828_1799 | 320 |
| 493 | 3300053140 | Ga0500573_0047637 | Ga0500573_0047637_48_1019 | 320 |
| 494 | 3300005331 | Ga0070670_100181329 | Ga0070670_1001813292 | 321 |
| 495 | 3300005365 | Ga0070688_100031599 | Ga0070688_1000315992 | 321 |
| 496 | 3300005367 | Ga0070667_100151652 | Ga0070667_1001516522 | 321 |
| 497 | 3300006038 | Ga0075365_10045523 | Ga0075365_100455233 | 321 |
| 498 | 3300006177 | Ga0075362_10077345 | Ga0075362_100773452 | 321 |
| 499 | 3300009094 | Ga0111539_10264637 | Ga0111539_102646372 | 321 |
| 500 | 3300025920 | Ga0207649_10053986 | Ga0207649_100539863 | 321 |
| 501 | 3300025944 | Ga0207661_10070397 | Ga0207661_100703974 | 321 |
| 502 | 3300030521 | Ga0307511_10000019 | Ga0307511_1000001940 | 321 |
| 503 | 3300031251 | Ga0265327_10010421 | Ga0265327_100104214 | 321 |
| 504 | 3300042876 | Ga0451577_0011129 | Ga0451577_0011129_5355_6362 | 321 |
| 505 | 3300044712 | Ga0453684_0169670 | Ga0453684_0169670_852_1859 | 321 |
| 506 | 3300049570 | Ga0501033_0038018 | Ga0501033_0038018_691_1668 | 321 |
| 507 | 3300049575 | Ga0501039_0021818 | Ga0501039_0021818_1749_2726 | 321 |
| 508 | 3300049578 | Ga0501042_0021693 | Ga0501042_0021693_2402_3379 | 321 |
| 509 | 3300049582 | Ga0501048_0003839 | Ga0501048_0003839_5860_6837 | 321 |
| 510 | 3300049588 | Ga0501072_0002755 | Ga0501072_0002755_2522_3499 | 321 |
| 511 | 3300049589 | Ga0501073_0104758 | Ga0501073_0104758_498_1475 | 321 |
| 512 | 3300049591 | Ga0501075_0001234 | Ga0501075_0001234_9743_10720 | 321 |
| 513 | 3300049741 | Ga0501079_0012875 | Ga0501079_0012875_1480_2457 | 321 |
| 514 | 3300049742 | Ga0501080_0018189 | Ga0501080_0018189_3490_4467 | 321 |
| 515 | 3300049743 | Ga0501081_0001544 | Ga0501081_0001544_805_1782 | 321 |
| 516 | 3300049822 | Ga0501035_0177637 | Ga0501035_0177637_578_1555 | 321 |
| 517 | 3300049824 | Ga0501045_0000154 | Ga0501045_0000154_11217_12194 | 321 |
| 518 | 3300050492 | nmdc:mga0yw44_77214_c1 | nmdc:mga0yw44_77214_c1_97_1098 | 321 |
| 519 | 3300050511 | nmdc:mga08y16_103389_c1 | nmdc:mga08y16_103389_c1_610_1596 | 321 |
| 520 | 3300050512 | nmdc:mga0n895_133549_c1 | nmdc:mga0n895_133549_c1_1062_2048 | 321 |
| 521 | 3300050515 | nmdc:mga0a205_11698_c1 | nmdc:mga0a205_11698_c1_408_1394 | 321 |
| 522 | 3300054114 | Ga0501084_0006792 | Ga0501084_0006792_4356_5333 | 321 |
| 523 | 3300060353 | Ga0501082_0006485 | Ga0501082_0006485_6152_7129 | 321 |
| 524 | 3300061734 | Ga0530510_0001503 | Ga0530510_0001503_13854_14831 | 321 |
| 525 | 3300005535 | Ga0070684_100400446 | Ga0070684_1004004461 | 322 |
| 526 | 3300021384 | Ga0213876_10127407 | Ga0213876_101274071 | 322 |
| 527 | 3300039437 | Ga0436365_1111801 | Ga0436365_1111801_400_1380 | 322 |
| 528 | 3300049576 | Ga0501040_0145115 | Ga0501040_0145115_50_1036 | 322 |
| 529 | 3300049577 | Ga0501041_0224494 | Ga0501041_0224494_166_1152 | 322 |
| 530 | 3300049581 | Ga0501047_0103739 | Ga0501047_0103739_1681_2700 | 322 |
| 531 | 3300049591 | Ga0501075_0248412 | Ga0501075_0248412_295_1281 | 322 |
| 532 | 3300049741 | Ga0501079_0369702 | Ga0501079_0369702_26_1012 | 322 |
| 533 | 3300049823 | Ga0501044_0333629 | Ga0501044_0333629_238_1257 | 322 |
| 534 | iso_pu_bacteria | 2881412998 | 2881416261 | 322 |
| 535 | iso_pu_bacteria | 2881927736 | 2881930615 | 322 |
| 536 | iso_pu_bacteria | 8055225921 | 8055227400 | 322 |
| 537 | 3300005331 | Ga0070670_100008142 | Ga0070670_1000081422 | 323 |
| 538 | 3300005331 | Ga0070670_100259926 | Ga0070670_1002599262 | 323 |
| 539 | 3300005333 | Ga0070677_10018484 | Ga0070677_100184842 | 323 |
| 540 | 3300005338 | Ga0068868_100226871 | Ga0068868_1002268712 | 323 |
| 541 | 3300005338 | Ga0068868_100244961 | Ga0068868_1002449612 | 323 |
| 542 | 3300005344 | Ga0070661_100100592 | Ga0070661_1001005922 | 323 |
| 543 | 3300005344 | Ga0070661_100255867 | Ga0070661_1002558671 | 323 |
| 544 | 3300005353 | Ga0070669_100105300 | Ga0070669_1001053002 | 323 |
| 545 | 3300005354 | Ga0070675_100055090 | Ga0070675_1000550902 | 323 |
| 546 | 3300005355 | Ga0070671_100051833 | Ga0070671_1000518332 | 323 |
| 547 | 3300005356 | Ga0070674_100102328 | Ga0070674_1001023282 | 323 |
| 548 | 3300005364 | Ga0070673_100036888 | Ga0070673_1000368883 | 323 |
| 549 | 3300005364 | Ga0070673_100182610 | Ga0070673_1001826102 | 323 |
| 550 | 3300005367 | Ga0070667_100037677 | Ga0070667_1000376774 | 323 |
| 551 | 3300005458 | Ga0070681_10086470 | Ga0070681_100864702 | 323 |
| 552 | 3300005459 | Ga0068867_100011207 | Ga0068867_1000112074 | 323 |
| 553 | 3300005468 | Ga0070707_100017332 | Ga0070707_1000173323 | 323 |
| 554 | 3300005543 | Ga0070672_100042837 | Ga0070672_1000428372 | 323 |
| 555 | 3300005543 | Ga0070672_100062363 | Ga0070672_1000623633 | 323 |
| 556 | 3300005548 | Ga0070665_100220673 | Ga0070665_1002206732 | 323 |
| 557 | 3300005618 | Ga0068864_100115580 | Ga0068864_1001155802 | 323 |
| 558 | 3300005718 | Ga0068866_10028281 | Ga0068866_100282812 | 323 |
| 559 | 3300005841 | Ga0068863_100026715 | Ga0068863_1000267152 | 323 |
| 560 | 3300005843 | Ga0068860_100215735 | Ga0068860_1002157352 | 323 |
| 561 | 3300006237 | Ga0097621_100000283 | Ga0097621_10000028328 | 323 |
| 562 | 3300006237 | Ga0097621_100037722 | Ga0097621_1000377223 | 323 |
| 563 | 3300006358 | Ga0068871_100074990 | Ga0068871_1000749902 | 323 |
| 564 | 3300006846 | Ga0075430_100008305 | Ga0075430_1000083054 | 323 |
| 565 | 3300006847 | Ga0075431_100003044 | Ga0075431_1000030444 | 323 |
| 566 | 3300006880 | Ga0075429_100011263 | Ga0075429_1000112636 | 323 |
| 567 | 3300009176 | Ga0105242_10338682 | Ga0105242_103386822 | 323 |
| 568 | 3300013297 | Ga0157378_10087176 | Ga0157378_100871763 | 323 |
| 569 | 3300013306 | Ga0163162_10042429 | Ga0163162_100424293 | 323 |
| 570 | 3300013306 | Ga0163162_10062607 | Ga0163162_100626073 | 323 |
| 571 | 3300013308 | Ga0157375_10091090 | Ga0157375_100910903 | 323 |
| 572 | 3300013308 | Ga0157375_10102627 | Ga0157375_101026272 | 323 |
| 573 | 3300014969 | Ga0157376_10179628 | Ga0157376_101796282 | 323 |
| 574 | 3300017792 | Ga0163161_10006520 | Ga0163161_100065206 | 323 |
| 575 | 3300025893 | Ga0207682_10010493 | Ga0207682_100104932 | 323 |
| 576 | 3300025907 | Ga0207645_10145847 | Ga0207645_101458472 | 323 |
| 577 | 3300025920 | Ga0207649_10245104 | Ga0207649_102451042 | 323 |
| 578 | 3300025923 | Ga0207681_10051742 | Ga0207681_100517422 | 323 |
| 579 | 3300025926 | Ga0207659_10085294 | Ga0207659_100852942 | 323 |
| 580 | 3300025933 | Ga0207706_10021395 | Ga0207706_100213955 | 323 |
| 581 | 3300025935 | Ga0207709_10178215 | Ga0207709_101782152 | 323 |
| 582 | 3300025940 | Ga0207691_10002261 | Ga0207691_1000226111 | 323 |
| 583 | 3300025940 | Ga0207691_10012533 | Ga0207691_100125332 | 323 |
| 584 | 3300025941 | Ga0207711_10019453 | Ga0207711_100194535 | 323 |
| 585 | 3300025944 | Ga0207661_10053144 | Ga0207661_100531442 | 323 |
| 586 | 3300025960 | Ga0207651_10114530 | Ga0207651_101145302 | 323 |
| 587 | 3300025960 | Ga0207651_10144412 | Ga0207651_101444122 | 323 |
| 588 | 3300025986 | Ga0207658_10026531 | Ga0207658_100265312 | 323 |
| 589 | 3300026023 | Ga0207677_10011562 | Ga0207677_100115621 | 323 |
| 590 | 3300026088 | Ga0207641_10089468 | Ga0207641_100894682 | 323 |
| 591 | 3300026089 | Ga0207648_10017646 | Ga0207648_100176464 | 323 |
| 592 | 3300026121 | Ga0207683_10003538 | Ga0207683_100035385 | 323 |
| 593 | 3300028381 | Ga0268264_10133825 | Ga0268264_101338252 | 323 |
| 594 | 3300028573 | Ga0265334_10014823 | Ga0265334_100148233 | 323 |
| 595 | 3300035111 | Ga0373923_0047129 | Ga0373923_0047129_441_1418 | 323 |
| 596 | 3300048913 | Ga0496110_0057664 | Ga0496110_0057664_2283_3266 | 323 |
| 597 | 3300048916 | Ga0496113_0245800 | Ga0496113_0245800_332_1315 | 323 |
| 598 | 3300053151 | Ga0500604_0001141 | Ga0500604_0001141_4351_5352 | 323 |
| 599 | iso_pu_bacteria | 2855730933 | 2855731676 | 323 |
| 600 | iso_pu_bacteria | 2855767633 | 2855768382 | 323 |
| 601 | 3300031456 | Ga0307513_10158733 | Ga0307513_101587332 | 324 |
| 602 | 3300005338 | Ga0068868_100104231 | Ga0068868_1001042312 | 326 |
| 603 | 3300005616 | Ga0068852_100444419 | Ga0068852_1004444191 | 326 |
| 604 | 3300025907 | Ga0207645_10061196 | Ga0207645_100611964 | 326 |
| 605 | 3300026121 | Ga0207683_10010606 | Ga0207683_100106065 | 326 |
| 606 | 3300032005 | Ga0307411_10171098 | Ga0307411_101710982 | 326 |
| 607 | 3300005843 | Ga0068860_100152987 | Ga0068860_1001529873 | 327 |
| 608 | 3300028381 | Ga0268264_10023675 | Ga0268264_100236755 | 327 |
| 609 | 3300031251 | Ga0265327_10016633 | Ga0265327_100166334 | 327 |
| 610 | 3300050509 | nmdc:mga0qj67_39957_c1 | nmdc:mga0qj67_39957_c1_506_1492 | 327 |
| 611 | 3300050510 | nmdc:mga06r32_12503_c1 | nmdc:mga06r32_12503_c1_4103_5089 | 327 |
| 612 | 3300003187 | JGI25151J46595_10000075 | JGI25151J46595_1000007523 | 333 |
| 613 | 3300025294 | Ga0209025_1000027 | Ga0209025_1000027263 | 333 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9411 | 38 | 329 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.936 | 36 | 331 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9277 | 37 | 329 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9259 | 38 | 329 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.924 | 36 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9502 | 135 | 257 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9464 | 37 | 328 | 3.40.190.150 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9427 | 135 | 257 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9399 | 135 | 254 | 3.40.190.10 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9288 | 37 | 329 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A439F197-F1-model_v4 | deleted | 0.9749 | 91 | 327 |
|
| AF-A0A3A3FMR4-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9707 | 55 | 327 |
|
| AF-A0A1Q4BAC4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9697 | 35 | 326 |
|
| AF-A0A6N1XB07-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9695 | 37 | 328 |
|
| AF-A0A2R4XH22-F1-model_v4 | LacI family transcriptional regulator | 0.968 | 28 | 328 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar