F469316

General Info

Members Datasets Scaffolds Average Seq Length
613 292 605 315

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2855730933|2855731676
Length 354
Sequence VRATLASRVACVTPIAGIARCIANCIAHYARHARAALITAGTLGLTLTATAATAAGYPNNPIRIIVPFAAGGTSDLVTRILAQAMGTELKVAVIVDNRPGAGGNIGSELVARAAPDGYTLLMGTVATHGINASLYKSMPFDPVKDFAPVSLVASTPSVLEVNPALPVKSVAELIAYAKAHPGKLYFGSAGNGSSHHLAGELFDSMAGVKMTHVPYRGTAAAVTDTMGGQVQVIFDTLPSAMPFVKSGQLRALAVTSAQRDPALPDLPTLAEAGLPGYEVGSWYGLLAPAGTPPEIVDKVSKLVAELVRRPDIKQKLQAQGATAVGSTPAEFATHIAGEIKKWRPVVQESGARVD

Samples

Sample ID Description Type Environment
1 2842747753 Variovorax sp. R-72060 Isolate Unclassified
2 2855730933 Achromobacter sp. HZ28 Isolate Nodule
3 2855767633 Achromobacter sp. HZ34 Isolate Nodule
4 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
5 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
6 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
283 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0.33
Rhizoplane 3.26
Rhizosphere 90.54
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000075 3300003187 Bacteria 135181
2 Ga0065712_10150630 3300005290 Bacteria 1373
3 Ga0065707_10088917 3300005295 Bacteria 4513
4 Ga0070658_10076319 3300005327 Unclassified 2749
5 Ga0070658_10203236 3300005327 Bacteria 1672
6 Ga0070676_10019688 3300005328 Bacteria 3759
7 Ga0070676_10091785 3300005328 Unclassified 1862
8 Ga0070683_100008196 3300005329 Bacteria 8875
9 Ga0070683_100049514 3300005329 Unclassified 3886
10 Ga0070683_100220487 3300005329 Unclassified 1803
11 Ga0070690_100003566 3300005330 Bacteria 8541
12 Ga0070690_100019776 3300005330 Bacteria 4095
13 Ga0070690_100067937 3300005330 Bacteria 2311
14 Ga0070670_100003427 3300005331 Bacteria 13164
15 Ga0070670_100008142 3300005331 Bacteria 8923
16 Ga0070670_100078639 3300005331 Unclassified 2833
17 Ga0070670_100181329 3300005331 Unclassified 1828
18 Ga0070670_100192338 3300005331 Bacteria 1772
19 Ga0070670_100259926 3300005331 Unclassified 1513
20 Ga0070677_10018484 3300005333 Bacteria 2510
21 Ga0070677_10023294 3300005333 Bacteria 2292
22 Ga0070677_10075123 3300005333 Bacteria 1431
23 Ga0068869_100000262 3300005334 Bacteria 27673
24 Ga0068869_100004150 3300005334 Bacteria 8986
25 Ga0068869_100245364 3300005334 Bacteria 1428
26 Ga0070666_10013740 3300005335 Bacteria 5141
27 Ga0070666_10042430 3300005335 Bacteria 3044
28 Ga0070680_100152001 3300005336 Bacteria 1943
29 Ga0070682_100001657 3300005337 Bacteria 12385
30 Ga0068868_100025100 3300005338 Bacteria 4527
31 Ga0068868_100104231 3300005338 Bacteria 2298
32 Ga0068868_100226871 3300005338 Unclassified 1566
33 Ga0068868_100244961 3300005338 Bacteria 1507
34 Ga0070689_100007621 3300005340 Bacteria 7580
35 Ga0070689_100041882 3300005340 Bacteria 3515
36 Ga0070689_100137134 3300005340 Bacteria 1965
37 Ga0070691_10002481 3300005341 Bacteria 8203
38 Ga0070687_100000189 3300005343 Bacteria 21407
39 Ga0070687_100035873 3300005343 Bacteria 2467
40 Ga0070661_100001413 3300005344 Bacteria 16755
41 Ga0070661_100010643 3300005344 Bacteria 6401
42 Ga0070661_100100592 3300005344 Bacteria 2149
43 Ga0070661_100148343 3300005344 Unclassified 1772
44 Ga0070661_100173043 3300005344 Bacteria 1640
45 Ga0070661_100255867 3300005344 Unclassified 1352
46 Ga0070692_10014109 3300005345 Bacteria 3742
47 Ga0070668_100032129 3300005347 Bacteria 3995
48 Ga0070668_100088437 3300005347 Bacteria 2439
49 Ga0070669_100020709 3300005353 Bacteria 4698
50 Ga0070669_100105300 3300005353 Bacteria 2134
51 Ga0070675_100001164 3300005354 Bacteria 19023
52 Ga0070675_100007866 3300005354 Bacteria 8261
53 Ga0070675_100011711 3300005354 Bacteria 6873
54 Ga0070675_100015675 3300005354 Bacteria 5998
55 Ga0070675_100029983 3300005354 Bacteria 4389
56 Ga0070675_100055090 3300005354 Unclassified 3273
57 Ga0070675_100089147 3300005354 Bacteria 2582
58 Ga0070671_100003945 3300005355 Bacteria 11675
59 Ga0070671_100051833 3300005355 Unclassified 3413
60 Ga0070671_100116052 3300005355 Unclassified 2251
61 Ga0070674_100102328 3300005356 Bacteria 2089
62 Ga0070674_100107416 3300005356 Bacteria 2043
63 Ga0070674_100184445 3300005356 Bacteria 1601
64 Ga0070673_100001390 3300005364 Bacteria 14156
65 Ga0070673_100003829 3300005364 Bacteria 9436
66 Ga0070673_100029732 3300005364 Bacteria 4077
67 Ga0070673_100036888 3300005364 Bacteria 3721
68 Ga0070673_100130877 3300005364 Bacteria 2105
69 Ga0070673_100148629 3300005364 Bacteria 1982
70 Ga0070673_100182610 3300005364 Unclassified 1797
71 Ga0070688_100031599 3300005365 Bacteria 3186
72 Ga0070688_100097047 3300005365 Bacteria 1937
73 Ga0070688_100154518 3300005365 Bacteria 1571
74 Ga0070659_100230114 3300005366 Bacteria 1532
75 Ga0070667_100037677 3300005367 Unclassified 4054
76 Ga0070667_100117532 3300005367 Bacteria 2310
77 Ga0070667_100151652 3300005367 Bacteria 2036
78 Ga0070667_100184171 3300005367 Bacteria 1848
79 Ga0070667_100244664 3300005367 Bacteria 1602
80 Ga0070709_10191406 3300005434 Bacteria 1443
81 Ga0070714_100013143 3300005435 Bacteria 6629
82 Ga0070701_10106445 3300005438 Bacteria 1561
83 Ga0070705_100000307 3300005440 Bacteria 28982
84 Ga0070705_100003253 3300005440 Bacteria 7985
85 Ga0070705_100164985 3300005440 Bacteria 1485
86 Ga0070700_100000145 3300005441 Bacteria 42177
87 Ga0070700_100035152 3300005441 Bacteria 3031
88 Ga0070694_100011291 3300005444 Bacteria 5530
89 Ga0070708_100000371 3300005445 Bacteria 33951
90 Ga0070678_100002266 3300005456 Bacteria 10472
91 Ga0070678_100011313 3300005456 Bacteria 5498
92 Ga0070678_100018760 3300005456 Bacteria 4491
93 Ga0070678_100070057 3300005456 Bacteria 2620
94 Ga0070678_100074615 3300005456 Bacteria 2550
95 Ga0070678_100173458 3300005456 Bacteria 1758
96 Ga0070678_100269644 3300005456 Bacteria 1435
97 Ga0070662_100016778 3300005457 Bacteria 4922
98 Ga0070662_100121081 3300005457 Unclassified 2006
99 Ga0070681_10000916 3300005458 Bacteria 24937
100 Ga0070681_10016128 3300005458 Bacteria 7448
101 Ga0070681_10086470 3300005458 Unclassified 3088
102 Ga0070681_10091688 3300005458 Bacteria 2988
103 Ga0068867_100011207 3300005459 Bacteria 6324
104 Ga0068867_100012147 3300005459 Bacteria 6084
105 Ga0068867_100160325 3300005459 Bacteria 1773
106 Ga0068867_100296037 3300005459 Unclassified 1332
107 Ga0070706_100102790 3300005467 Unclassified 2657
108 Ga0070706_100216055 3300005467 Bacteria 1790
109 Ga0070707_100017332 3300005468 Bacteria 6771
110 Ga0070679_100290388 3300005530 Bacteria 1587
111 Ga0070679_100320991 3300005530 Bacteria 1498
112 Ga0070684_100022030 3300005535 Bacteria 5309
113 Ga0070684_100400446 3300005535 Bacteria 1265
114 Ga0070684_100431559 3300005535 Bacteria 1217
115 Ga0070697_100043526 3300005536 Bacteria 3636
116 Ga0068853_100054906 3300005539 Bacteria 3433
117 Ga0068853_100096395 3300005539 Bacteria 2610
118 Ga0068853_100320915 3300005539 Unclassified 1436
119 Ga0070672_100002353 3300005543 Bacteria 11956
120 Ga0070672_100002997 3300005543 Bacteria 10881
121 Ga0070672_100014473 3300005543 Bacteria 5592
122 Ga0070672_100042837 3300005543 Unclassified 3487
123 Ga0070672_100062363 3300005543 Unclassified 2942
124 Ga0070672_100078982 3300005543 Bacteria 2633
125 Ga0070672_100117325 3300005543 Bacteria 2176
126 Ga0070672_100122065 3300005543 Bacteria 2134
127 Ga0070686_100002139 3300005544 Bacteria 10886
128 Ga0070695_100000178 3300005545 Bacteria 30212
129 Ga0070696_100000248 3300005546 Bacteria 32432
130 Ga0070696_100007039 3300005546 Bacteria 7509
131 Ga0070693_100011756 3300005547 Bacteria 4414
132 Ga0070693_100097190 3300005547 Bacteria 1787
133 Ga0070665_100010470 3300005548 Bacteria 9386
134 Ga0070665_100013602 3300005548 Bacteria 8184
135 Ga0070665_100101673 3300005548 Bacteria 2878
136 Ga0070665_100220673 3300005548 Unclassified 1896
137 Ga0070665_100326416 3300005548 Unclassified 1539
138 Ga0070704_100002435 3300005549 Bacteria 10440
139 Ga0068855_100034194 3300005563 Bacteria 6063
140 Ga0070664_100005343 3300005564 Bacteria 10305
141 Ga0070664_100015050 3300005564 Bacteria 6315
142 Ga0070664_100035236 3300005564 Bacteria 4201
143 Ga0070664_100117619 3300005564 Unclassified 2325
144 Ga0070664_100212699 3300005564 Bacteria 1728
145 Ga0068857_100000810 3300005577 Bacteria 23378
146 Ga0068854_100002668 3300005578 Bacteria 11066
147 Ga0068854_100005409 3300005578 Bacteria 8063
148 Ga0068854_100012218 3300005578 Bacteria 5618
149 Ga0068856_100014288 3300005614 Bacteria 7678
150 Ga0068856_100084522 3300005614 Bacteria 3152
151 Ga0070702_100000014 3300005615 Bacteria 51486
152 Ga0070702_100048117 3300005615 Bacteria 2426
153 Ga0070702_100175751 3300005615 Bacteria 1397
154 Ga0068852_100001129 3300005616 Bacteria 17663
155 Ga0068852_100004563 3300005616 Bacteria 9804
156 Ga0068852_100006161 3300005616 Bacteria 8652
157 Ga0068852_100444419 3300005616 Bacteria 1282
158 Ga0068859_100003654 3300005617 Bacteria 15676
159 Ga0068859_100309978 3300005617 Bacteria 1672
160 Ga0068864_100006436 3300005618 Bacteria 9625
161 Ga0068864_100024434 3300005618 Bacteria 5083
162 Ga0068864_100058463 3300005618 Bacteria 3332
163 Ga0068864_100059590 3300005618 Bacteria 3303
164 Ga0068864_100098739 3300005618 Bacteria 2586
165 Ga0068864_100115580 3300005618 Bacteria 2393
166 Ga0068864_100366317 3300005618 Bacteria 1363
167 Ga0068866_10000777 3300005718 Bacteria 14329
168 Ga0068866_10027411 3300005718 Bacteria 2701
169 Ga0068866_10028281 3300005718 Bacteria 2670
170 Ga0068861_100000581 3300005719 Bacteria 21649
171 Ga0068861_100072525 3300005719 Bacteria 2672
172 Ga0068861_100085480 3300005719 Bacteria 2477
173 Ga0068851_10027476 3300005834 Bacteria 2805
174 Ga0068851_10129008 3300005834 Unclassified 1366
175 Ga0068870_10001592 3300005840 Bacteria 9236
176 Ga0068863_100001012 3300005841 Bacteria 28130
177 Ga0068863_100010386 3300005841 Bacteria 9046
178 Ga0068863_100026715 3300005841 Bacteria 5505
179 Ga0068863_100051165 3300005841 Bacteria 3916
180 Ga0068863_100063854 3300005841 Bacteria 3482
181 Ga0068863_100069212 3300005841 Bacteria 3337
182 Ga0068863_100091751 3300005841 Bacteria 2881
183 Ga0068863_100121625 3300005841 Unclassified 2490
184 Ga0068863_100159625 3300005841 Bacteria 2160
185 Ga0068863_100355842 3300005841 Bacteria 1426
186 Ga0068858_100004586 3300005842 Bacteria 13531
187 Ga0068858_100020243 3300005842 Bacteria 6222
188 Ga0068858_100264368 3300005842 Bacteria 1636
189 Ga0068860_100028614 3300005843 Bacteria 5364
190 Ga0068860_100049738 3300005843 Bacteria 3991
191 Ga0068860_100152987 3300005843 Bacteria 2222
192 Ga0068860_100207226 3300005843 Bacteria 1902
193 Ga0068860_100215735 3300005843 Bacteria 1862
194 Ga0068862_100006705 3300005844 Bacteria 9555
195 Ga0068862_100057883 3300005844 Bacteria 3325
196 Ga0068862_100093479 3300005844 Bacteria 2622
197 Ga0068862_100104913 3300005844 Bacteria 2477
198 Ga0075365_10045523 3300006038 Bacteria 2878
199 Ga0075364_10044609 3300006051 Bacteria 2884
200 Ga0075362_10077345 3300006177 Bacteria 1529
201 Ga0075369_10009342 3300006186 Bacteria 3807
202 Ga0075366_10013151 3300006195 Bacteria 4706
203 Ga0075366_10142074 3300006195 Bacteria 1452
204 Ga0097621_100000283 3300006237 Bacteria 34080
205 Ga0097621_100000525 3300006237 Bacteria 26865
206 Ga0097621_100004947 3300006237 Bacteria 9343
207 Ga0097621_100037722 3300006237 Unclassified 3875
208 Ga0097621_100211021 3300006237 Bacteria 1689
209 Ga0075370_10064194 3300006353 Bacteria 2094
210 Ga0068871_100000889 3300006358 Bacteria 19922
211 Ga0068871_100003413 3300006358 Bacteria 10918
212 Ga0068871_100074990 3300006358 Bacteria 2792
213 Ga0068871_100132068 3300006358 Unclassified 2118
214 Ga0068871_100271326 3300006358 Bacteria 1482
215 Ga0075428_100092295 3300006844 Bacteria 3301
216 Ga0075430_100008305 3300006846 Bacteria 8770
217 Ga0075431_100003044 3300006847 Bacteria 16219
218 Ga0075431_100257581 3300006847 Bacteria 1771
219 Ga0075433_10089533 3300006852 Bacteria 2720
220 Ga0075433_10237043 3300006852 Bacteria 1620
221 Ga0075434_100034198 3300006871 Bacteria 5018
222 Ga0075429_100011263 3300006880 Bacteria 7741
223 Ga0068865_100012523 3300006881 Bacteria 5340
224 Ga0068865_100095237 3300006881 Bacteria 2169
225 Ga0097620_100003654 3300006931 Bacteria 15676
226 Ga0097620_100309968 3300006931 Bacteria 1672
227 Ga0075435_100023975 3300007076 Bacteria 4728
228 Ga0099794_10041717 3300007265 Bacteria 2185
229 Ga0105240_10001807 3300009093 Bacteria 36004
230 Ga0111539_10264637 3300009094 Bacteria 2002
231 Ga0105245_10001140 3300009098 Bacteria 24024
232 Ga0114129_10236899 3300009147 Bacteria 2455
233 Ga0105243_10011356 3300009148 Bacteria 6742
234 Ga0105243_10018014 3300009148 Bacteria 5343
235 Ga0105243_10049412 3300009148 Bacteria 3318
236 Ga0105241_10018045 3300009174 Bacteria 5187
237 Ga0105242_10000610 3300009176 Bacteria 27965
238 Ga0105242_10119875 3300009176 Bacteria 2256
239 Ga0105242_10181902 3300009176 Bacteria 1855
240 Ga0105242_10338682 3300009176 Unclassified 1385
241 Ga0105248_10046548 3300009177 Bacteria 4862
242 Ga0105248_10133814 3300009177 Unclassified 2797
243 Ga0105248_10452116 3300009177 Bacteria 1447
244 Ga0105237_10274330 3300009545 Bacteria 1689
245 Ga0105238_10001317 3300009551 Bacteria 24891
246 Ga0105249_10023298 3300009553 Bacteria 5555
247 Ga0105239_10071817 3300010375 Bacteria 3803
248 Ga0105246_10035336 3300011119 Bacteria 3340
249 Ga0157371_10161204 3300013102 Bacteria 1602
250 Ga0157370_10025696 3300013104 Bacteria 5827
251 Ga0157374_10003535 3300013296 Bacteria 13146
252 Ga0157374_10061974 3300013296 Bacteria 3504
253 Ga0157374_10100744 3300013296 Bacteria 2769
254 Ga0157374_10253304 3300013296 Bacteria 1733
255 Ga0157378_10001659 3300013297 Bacteria 20115
256 Ga0157378_10005177 3300013297 Bacteria 11451
257 Ga0157378_10025324 3300013297 Bacteria 5225
258 Ga0157378_10087176 3300013297 Unclassified 2831
259 Ga0157378_10245304 3300013297 Bacteria 1713
260 Ga0163162_10014588 3300013306 Bacteria 7677
261 Ga0163162_10042429 3300013306 Bacteria 4553
262 Ga0163162_10062607 3300013306 Bacteria 3761
263 Ga0163162_10559061 3300013306 Bacteria 1272
264 Ga0163162_10773903 3300013306 Bacteria 1078
265 Ga0157375_10004326 3300013308 Bacteria 12329
266 Ga0157375_10006008 3300013308 Bacteria 10585
267 Ga0157375_10091090 3300013308 Bacteria 3110
268 Ga0157375_10100213 3300013308 Bacteria 2977
269 Ga0157375_10102627 3300013308 Unclassified 2946
270 Ga0157375_10175165 3300013308 Bacteria 2294
271 Ga0157375_10656799 3300013308 Bacteria 1204
272 Ga0163163_10005091 3300014325 Bacteria 11327
273 Ga0157380_10113295 3300014326 Bacteria 2283
274 Ga0157377_10032877 3300014745 Bacteria 2828
275 Ga0157377_10151750 3300014745 Bacteria 1433
276 Ga0157379_10026196 3300014968 Bacteria 5189
277 Ga0157379_10058641 3300014968 Bacteria 3443
278 Ga0157376_10004059 3300014969 Bacteria 10129
279 Ga0157376_10008580 3300014969 Bacteria 7383
280 Ga0157376_10014370 3300014969 Bacteria 5941
281 Ga0157376_10132948 3300014969 Bacteria 2223
282 Ga0157376_10179628 3300014969 Unclassified 1933
283 Ga0163161_10006520 3300017792 Bacteria 8082
284 Ga0163161_10114587 3300017792 Bacteria 2019
285 Ga0163161_10169871 3300017792 Bacteria 1667
286 Ga0213876_10127407 3300021384 Bacteria 1352
287 Ga0209025_1000027 3300025294 Bacteria 505882
288 Ga0209758_1004073 3300025297 Bacteria 12567
289 Ga0207426_1005137 3300025302 Bacteria 6100
290 Ga0207426_1026574 3300025302 Bacteria 1937
291 Ga0207697_10014647 3300025315 Bacteria 3251
292 Ga0207697_10074865 3300025315 Bacteria 1422
293 Ga0207656_10053728 3300025321 Unclassified 1749
294 Ga0207653_10025498 3300025885 Bacteria 1891
295 Ga0207682_10006116 3300025893 Bacteria 4863
296 Ga0207682_10010493 3300025893 Bacteria 3631
297 Ga0207682_10116211 3300025893 Bacteria 1182
298 Ga0207642_10000667 3300025899 Bacteria 10555
299 Ga0207688_10071130 3300025901 Bacteria 1974
300 Ga0207645_10019277 3300025907 Bacteria 4473
301 Ga0207645_10020048 3300025907 Bacteria 4379
302 Ga0207645_10061196 3300025907 Bacteria 2405
303 Ga0207645_10070940 3300025907 Unclassified 2229
304 Ga0207645_10145847 3300025907 Bacteria 1543
305 Ga0207643_10030155 3300025908 Bacteria 3018
306 Ga0207643_10077376 3300025908 Bacteria 1923
307 Ga0207707_10001576 3300025912 Bacteria 21009
308 Ga0207707_10005380 3300025912 Bacteria 11196
309 Ga0207707_10019952 3300025912 Bacteria 5850
310 Ga0207707_10086051 3300025912 Bacteria 2747
311 Ga0207671_10250582 3300025914 Bacteria 1392
312 Ga0207660_10006068 3300025917 Bacteria 7841
313 Ga0207660_10323856 3300025917 Bacteria 1231
314 Ga0207662_10000021 3300025918 Bacteria 72688
315 Ga0207662_10017902 3300025918 Bacteria 4012
316 Ga0207657_10012171 3300025919 Bacteria 8501
317 Ga0207649_10004308 3300025920 Bacteria 7736
318 Ga0207649_10027243 3300025920 Bacteria 3352
319 Ga0207649_10053986 3300025920 Bacteria 2500
320 Ga0207649_10117399 3300025920 Unclassified 1788
321 Ga0207649_10245104 3300025920 Unclassified 1288
322 Ga0207652_10274502 3300025921 Bacteria 1521
323 Ga0207646_10139994 3300025922 Bacteria 2179
324 Ga0207681_10051742 3300025923 Bacteria 2783
325 Ga0207681_10125986 3300025923 Bacteria 1886
326 Ga0207681_10318787 3300025923 Bacteria 1235
327 Ga0207694_10003964 3300025924 Bacteria 11677
328 Ga0207650_10004028 3300025925 Bacteria 10048
329 Ga0207650_10004272 3300025925 Bacteria 9751
330 Ga0207650_10005988 3300025925 Bacteria 8297
331 Ga0207650_10006311 3300025925 Bacteria 8080
332 Ga0207650_10180802 3300025925 Bacteria 1680
333 Ga0207650_10378416 3300025925 Bacteria 1169
334 Ga0207659_10002215 3300025926 Bacteria 11568
335 Ga0207659_10048261 3300025926 Bacteria 3015
336 Ga0207659_10070130 3300025926 Bacteria 2555
337 Ga0207659_10085294 3300025926 Unclassified 2346
338 Ga0207687_10000833 3300025927 Bacteria 20808
339 Ga0207644_10000418 3300025931 Bacteria 27576
340 Ga0207644_10046132 3300025931 Unclassified 3103
341 Ga0207706_10021394 3300025933 Bacteria 5809
342 Ga0207706_10021395 3300025933 Bacteria 5809
343 Ga0207686_10000804 3300025934 Bacteria 19247
344 Ga0207686_10006730 3300025934 Bacteria 6191
345 Ga0207709_10178215 3300025935 Bacteria 1498
346 Ga0207670_10003028 3300025936 Bacteria 8861
347 Ga0207670_10133756 3300025936 Bacteria 1821
348 Ga0207669_10023510 3300025937 Bacteria 3294
349 Ga0207669_10042744 3300025937 Bacteria 2648
350 Ga0207704_10000327 3300025938 Bacteria 22154
351 Ga0207691_10000110 3300025940 Bacteria 73418
352 Ga0207691_10002261 3300025940 Bacteria 18855
353 Ga0207691_10002783 3300025940 Bacteria 17058
354 Ga0207691_10006961 3300025940 Bacteria 10908
355 Ga0207691_10007330 3300025940 Bacteria 10639
356 Ga0207691_10012533 3300025940 Bacteria 8127
357 Ga0207691_10013997 3300025940 Bacteria 7652
358 Ga0207691_10187378 3300025940 Bacteria 1806
359 Ga0207691_10253876 3300025940 Bacteria 1517
360 Ga0207711_10019453 3300025941 Bacteria 5652
361 Ga0207689_10000426 3300025942 Bacteria 39509
362 Ga0207689_10005712 3300025942 Bacteria 11064
363 Ga0207689_10021896 3300025942 Bacteria 5375
364 Ga0207661_10005122 3300025944 Bacteria 9203
365 Ga0207661_10053144 3300025944 Unclassified 3240
366 Ga0207661_10070397 3300025944 Bacteria 2856
367 Ga0207661_10158312 3300025944 Unclassified 1963
368 Ga0207661_10208585 3300025944 Bacteria 1721
369 Ga0207679_10004251 3300025945 Bacteria 8901
370 Ga0207679_10041185 3300025945 Bacteria 3310
371 Ga0207679_10064662 3300025945 Bacteria 2735
372 Ga0207679_10153338 3300025945 Unclassified 1878
373 Ga0207667_10010866 3300025949 Bacteria 10616
374 Ga0207667_10016330 3300025949 Bacteria 8390
375 Ga0207651_10011098 3300025960 Bacteria 5026
376 Ga0207651_10011420 3300025960 Bacteria 4974
377 Ga0207651_10013977 3300025960 Bacteria 4619
378 Ga0207651_10015843 3300025960 Bacteria 4395
379 Ga0207651_10096744 3300025960 Bacteria 2178
380 Ga0207651_10114530 3300025960 Bacteria 2031
381 Ga0207651_10144412 3300025960 Unclassified 1843
382 Ga0207712_10180410 3300025961 Bacteria 1658
383 Ga0207668_10026327 3300025972 Bacteria 3775
384 Ga0207668_10032629 3300025972 Bacteria 3443
385 Ga0207640_10020311 3300025981 Bacteria 3942
386 Ga0207640_10150603 3300025981 Bacteria 1709
387 Ga0207658_10026531 3300025986 Unclassified 4062
388 Ga0207658_10049526 3300025986 Bacteria 3088
389 Ga0207658_10084382 3300025986 Bacteria 2444
390 Ga0207658_10306745 3300025986 Bacteria 1370
391 Ga0207658_10327854 3300025986 Bacteria 1327
392 Ga0207677_10011562 3300026023 Bacteria 5039
393 Ga0207677_10014356 3300026023 Bacteria 4624
394 Ga0207703_10012010 3300026035 Bacteria 6745
395 Ga0207703_10016185 3300026035 Bacteria 5813
396 Ga0207703_10562953 3300026035 Bacteria 1076
397 Ga0207639_10041571 3300026041 Bacteria 3441
398 Ga0207639_10224277 3300026041 Bacteria 1625
399 Ga0207708_10000231 3300026075 Bacteria 44046
400 Ga0207708_10057661 3300026075 Bacteria 2963
401 Ga0207708_10061180 3300026075 Bacteria 2875
402 Ga0207702_10003982 3300026078 Bacteria 13259
403 Ga0207641_10001097 3300026088 Bacteria 27224
404 Ga0207641_10013145 3300026088 Bacteria 6787
405 Ga0207641_10089468 3300026088 Unclassified 2691
406 Ga0207641_10122835 3300026088 Bacteria 2320
407 Ga0207648_10007171 3300026089 Bacteria 10989
408 Ga0207648_10017646 3300026089 Bacteria 6483
409 Ga0207648_10025041 3300026089 Bacteria 5319
410 Ga0207648_10033234 3300026089 Unclassified 4550
411 Ga0207648_10034169 3300026089 Unclassified 4483
412 Ga0207648_10040042 3300026089 Bacteria 4118
413 Ga0207648_10078985 3300026089 Bacteria 2871
414 Ga0207648_10093737 3300026089 Bacteria 2626
415 Ga0207648_10151836 3300026089 Bacteria 2044
416 Ga0207676_10001836 3300026095 Bacteria 15555
417 Ga0207676_10007102 3300026095 Bacteria 7936
418 Ga0207676_10021023 3300026095 Unclassified 4783
419 Ga0207676_10067883 3300026095 Bacteria 2850
420 Ga0207676_10254630 3300026095 Bacteria 1582
421 Ga0207674_10000418 3300026116 Bacteria 55342
422 Ga0207675_100000086 3300026118 Bacteria 72707
423 Ga0207675_100089172 3300026118 Bacteria 2897
424 Ga0207675_100092116 3300026118 Bacteria 2851
425 Ga0207683_10002093 3300026121 Bacteria 17577
426 Ga0207683_10003538 3300026121 Bacteria 13623
427 Ga0207683_10007943 3300026121 Bacteria 9079
428 Ga0207683_10009224 3300026121 Bacteria 8408
429 Ga0207683_10010606 3300026121 Bacteria 7859
430 Ga0207683_10018176 3300026121 Bacteria 5996
431 Ga0207683_10019117 3300026121 Bacteria 5847
432 Ga0207683_10083523 3300026121 Bacteria 2838
433 Ga0207683_10197483 3300026121 Bacteria 1828
434 Ga0207698_10002351 3300026142 Bacteria 11203
435 Ga0207698_10020906 3300026142 Bacteria 4516
436 Ga0207698_10106297 3300026142 Bacteria 2340
437 Ga0207428_10133780 3300027907 Bacteria 1896
438 Ga0207428_10303870 3300027907 Unclassified 1180
439 Ga0268266_10020803 3300028379 Bacteria 5595
440 Ga0268266_10058090 3300028379 Bacteria 3330
441 Ga0268266_10213896 3300028379 Bacteria 1769
442 Ga0268265_10022052 3300028380 Bacteria 4470
443 Ga0268265_10038684 3300028380 Bacteria 3510
444 Ga0268265_10040634 3300028380 Bacteria 3437
445 Ga0268264_10001620 3300028381 Bacteria 20799
446 Ga0268264_10013339 3300028381 Bacteria 6763
447 Ga0268264_10023675 3300028381 Bacteria 5007
448 Ga0268264_10133825 3300028381 Bacteria 2202
449 Ga0268264_10164105 3300028381 Bacteria 2004
450 Ga0265334_10014823 3300028573 Bacteria 3245
451 Ga0265334_10045098 3300028573 Bacteria 1709
452 Ga0265318_10004630 3300028577 Bacteria 6622
453 Ga0307517_10075043 3300028786 Bacteria 2972
454 Ga0265338_10107800 3300028800 Bacteria 2252
455 Ga0307511_10000019 3300030521 Bacteria 117947
456 Ga0265330_10024986 3300031235 Bacteria 2709
457 Ga0265332_10004725 3300031238 Bacteria 6353
458 Ga0265328_10002094 3300031239 Bacteria 9005
459 Ga0265320_10045903 3300031240 Bacteria 2144
460 Ga0265329_10005279 3300031242 Bacteria 5244
461 Ga0265331_10001778 3300031250 Bacteria 15399
462 Ga0265327_10010421 3300031251 Bacteria 6545
463 Ga0265327_10016633 3300031251 Bacteria 4660
464 Ga0265327_10050784 3300031251 Bacteria 2168
465 Ga0307513_10158733 3300031456 Bacteria 2157
466 Ga0307408_100172257 3300031548 Bacteria 1729
467 Ga0265314_10002233 3300031711 Bacteria 20138
468 Ga0265342_10016999 3300031712 Bacteria 4740
469 Ga0307413_10007784 3300031824 Bacteria 5006
470 Ga0307407_10069634 3300031903 Bacteria 2089
471 Ga0307412_10076632 3300031911 Bacteria 2298
472 Ga0307409_100040847 3300031995 Bacteria 3458
473 Ga0307409_100483537 3300031995 Unclassified 1202
474 Ga0307414_10047027 3300032004 Bacteria 2967
475 Ga0307414_10136529 3300032004 Bacteria 1913
476 Ga0307411_10171098 3300032005 Bacteria 1638
477 Ga0307415_100171527 3300032126 Bacteria 1692
478 Ga0373949_0006402 3300035090 Bacteria 2590
479 Ga0373952_0003060 3300035092 Bacteria 3016
480 Ga0373952_0020009 3300035092 Bacteria 1399
481 Ga0373923_0047129 3300035111 Bacteria 1795
482 Ga0373932_0001975 3300035112 Bacteria 5413
483 Ga0373939_0000701 3300035114 Bacteria 8291
484 Ga0373941_0017773 3300035115 Bacteria 1954
485 Ga0373960_0046934 3300035121 Bacteria 1269
486 Ga0373955_0058411 3300035172 Bacteria 2123
487 Ga0373931_0001220 3300035691 Bacteria 10999
488 Ga0373931_0036760 3300035691 Bacteria 2554
489 Ga0373931_0192453 3300035691 Bacteria 1214
490 Ga0373935_0276388 3300035692 Bacteria 1182
491 Ga0373933_0180357 3300035724 Bacteria 1347
492 Ga0373947_0057448 3300035725 Bacteria 2355
493 Ga0373937_0105102 3300036401 Bacteria 2624
494 Ga0373937_0107231 3300036401 Bacteria 2597
495 Ga0373937_0497660 3300036401 Bacteria 1158
496 Ga0373925_0290173 3300037068 Bacteria 1319
497 Ga0395899_0005693 3300037312 Bacteria 9673
498 Ga0395899_0008434 3300037312 Bacteria 7938
499 Ga0395900_0034401 3300037418 Bacteria 5217
500 Ga0395900_0044109 3300037418 Bacteria 4596
501 Ga0395898_0006517 3300037466 Bacteria 12473
502 Ga0395898_0031484 3300037466 Bacteria 5299
503 Ga0395905_0004405 3300037471 Bacteria 14646
504 Ga0395905_0006862 3300037471 Bacteria 11385
505 Ga0395901_0007572 3300038443 Bacteria 10966
506 Ga0395901_0012635 3300038443 Bacteria 8568
507 Ga0436365_1111801 3300039437 Bacteria 1588
508 Ga0439447_020607 3300041407 Bacteria 1746
509 Ga0451577_0011129 3300042876 Bacteria 8536
510 Ga0453684_0169670 3300044712 Bacteria 2573
511 Ga0466960_0063179 3300044901 Bacteria 1822
512 Ga0451576_0008768 3300045051 Bacteria 11831
513 Ga0466958_0117392 3300045836 Bacteria 1664
514 Ga0495592_0122363 3300046454 Bacteria 1829
515 Ga0495632_0002900 3300046519 Bacteria 12607
516 Ga0495598_0073683 3300046537 Bacteria 1081
517 Ga0495621_0029949 3300046539 Bacteria 1858
518 Ga0495621_0049146 3300046539 Bacteria 1504
519 Ga0495633_0004166 3300046558 Bacteria 9293
520 Ga0495656_0049377 3300046615 Bacteria 1792
521 Ga0495669_0051905 3300046684 Bacteria 1841
522 Ga0495649_0003265 3300046694 Bacteria 11048
523 Ga0495676_0157214 3300047321 Bacteria 1612
524 Ga0495687_001187 3300047443 Bacteria 25022
525 Ga0496100_0073425 3300048903 Unclassified 2289
526 Ga0496101_0119938 3300048904 Bacteria 1987
527 Ga0496102_0079592 3300048905 Unclassified 3018
528 Ga0496102_0431719 3300048905 Unclassified 1237
529 Ga0496102_0511775 3300048905 Bacteria 1123
530 Ga0496104_0353608 3300048907 Bacteria 1382
531 Ga0496105_0265990 3300048908 Bacteria 1386
532 Ga0496106_0279115 3300048909 Bacteria 1338
533 Ga0496108_0008518 3300048911 Bacteria 8317
534 Ga0496109_0165277 3300048912 Unclassified 2074
535 Ga0496109_0216930 3300048912 Bacteria 1799
536 Ga0496110_0013289 3300048913 Bacteria 6801
537 Ga0496110_0028831 3300048913 Unclassified 4771
538 Ga0496110_0057664 3300048913 Bacteria 3419
539 Ga0496112_0174022 3300048915 Unclassified 2118
540 Ga0496112_0445867 3300048915 Bacteria 1232
541 Ga0496113_0245800 3300048916 Unclassified 1428
542 Ga0496113_0383944 3300048916 Bacteria 1127
543 Ga0496114_0120627 3300048917 Bacteria 2255
544 Ga0496114_0169237 3300048917 Unclassified 1903
545 Ga0501033_0000891 3300049570 Bacteria 27301
546 Ga0501033_0038018 3300049570 Bacteria 3601
547 Ga0501037_0078480 3300049573 Bacteria 2396
548 Ga0501039_0021818 3300049575 Bacteria 4913
549 Ga0501040_0003627 3300049576 Bacteria 9997
550 Ga0501040_0037972 3300049576 Bacteria 3274
551 Ga0501040_0145115 3300049576 Bacteria 1673
552 Ga0501041_0011051 3300049577 Bacteria 5332
553 Ga0501041_0224494 3300049577 Bacteria 1179
554 Ga0501042_0021693 3300049578 Bacteria 4478
555 Ga0501042_0079039 3300049578 Bacteria 2356
556 Ga0501046_0062584 3300049580 Bacteria 2907
557 Ga0501047_0103739 3300049581 Bacteria 2724
558 Ga0501048_0003839 3300049582 Bacteria 11458
559 Ga0501071_0011203 3300049587 Bacteria 6032
560 Ga0501072_0002755 3300049588 Bacteria 13207
561 Ga0501072_0135022 3300049588 Bacteria 1967
562 Ga0501073_0104758 3300049589 Bacteria 1963
563 Ga0501075_0001234 3300049591 Bacteria 16573
564 Ga0501075_0248412 3300049591 Bacteria 1356
565 Ga0501079_0012875 3300049741 Bacteria 6385
566 Ga0501079_0369702 3300049741 Bacteria 1124
567 Ga0501080_0018189 3300049742 Bacteria 6505
568 Ga0501081_0001544 3300049743 Bacteria 14163
569 Ga0501081_0174279 3300049743 Bacteria 1554
570 Ga0501083_0098685 3300049744 Bacteria 1927
571 Ga0501035_0177637 3300049822 Bacteria 1836
572 Ga0501044_0333629 3300049823 Bacteria 1439
573 Ga0501045_0000154 3300049824 Bacteria 36954
574 nmdc:mga00v17_21077_c1 3300050491 Bacteria 3743
575 nmdc:mga0yw44_132864_c1 3300050492 Bacteria 1613
576 nmdc:mga0yw44_77214_c1 3300050492 Bacteria 2080
577 nmdc:mga0k408_2808_c1 3300050493 Bacteria 9249
578 nmdc:mga0k408_30058_c1 3300050493 Bacteria 3096
579 nmdc:mga06z11_203820_c1 3300050494 Bacteria 1150
580 nmdc:mga07m45_16546_c1 3300050496 Bacteria 3948
581 nmdc:mga05p37_278921_c1 3300050507 Bacteria 1994
582 nmdc:mga0qj67_39957_c1 3300050509 Bacteria 3686
583 nmdc:mga06r32_12503_c1 3300050510 Bacteria 7661
584 nmdc:mga06r32_224243_c1 3300050510 Bacteria 1868
585 nmdc:mga06r32_330750_c1 3300050510 Bacteria 1509
586 nmdc:mga08y16_103389_c1 3300050511 Bacteria 2966
587 nmdc:mga08y16_190416_c1 3300050511 Bacteria 2128
588 nmdc:mga08y16_218739_c1 3300050511 Bacteria 1972
589 nmdc:mga0n895_133549_c1 3300050512 Bacteria 2508
590 nmdc:mga0n895_258723_c1 3300050512 Bacteria 1766
591 nmdc:mga0rr50_12742_c1 3300050513 Bacteria 5448
592 nmdc:mga0a205_11698_c1 3300050515 Bacteria 4927
593 Ga0500643_003287 3300053087 Bacteria 7859
594 Ga0500566_0000231 3300053094 Bacteria 29903
595 Ga0500593_060314 3300053117 Bacteria 1667
596 Ga0500559_0007488 3300053136 Bacteria 4831
597 Ga0500573_0047637 3300053140 Bacteria 2468
598 Ga0500604_0001141 3300053151 Bacteria 7378
599 Ga0500616_0003403 3300053153 Bacteria 12207
600 Ga0500634_0030352 3300053161 Bacteria 2946
601 Ga0500634_0053920 3300053161 Bacteria 2155
602 Ga0501084_0006792 3300054114 Bacteria 9410
603 Ga0501084_0127922 3300054114 Bacteria 2138
604 Ga0501082_0006485 3300060353 Bacteria 10142
605 Ga0530510_0001503 3300061734 Bacteria 15668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035121 Ga0373960_0046934 Ga0373960_0046934_432_1244 239
2 3300005841 Ga0068863_100121625 Ga0068863_1001216253 251
3 3300005546 Ga0070696_100007039 Ga0070696_1000070393 258
4 3300044901 Ga0466960_0063179 Ga0466960_0063179_270_1223 259
5 3300035092 Ga0373952_0020009 Ga0373952_0020009_498_1373 261
6 3300005440 Ga0070705_100003253 Ga0070705_1000032534 270
7 3300005536 Ga0070697_100043526 Ga0070697_1000435262 270
8 3300014325 Ga0163163_10005091 Ga0163163_100050914 278
9 3300048912 Ga0496109_0216930 Ga0496109_0216930_549_1514 278
10 3300048915 Ga0496112_0445867 Ga0496112_0445867_245_1210 278
11 3300035115 Ga0373941_0017773 Ga0373941_0017773_60_1013 279
12 3300049573 Ga0501037_0078480 Ga0501037_0078480_82_1020 282
13 3300048908 Ga0496105_0265990 Ga0496105_0265990_188_1162 283
14 3300009177 Ga0105248_10452116 Ga0105248_104521162 284
15 3300005458 Ga0070681_10000916 Ga0070681_1000091621 285
16 3300005530 Ga0070679_100320991 Ga0070679_1003209912 285
17 3300005539 Ga0068853_100320915 Ga0068853_1003209152 285
18 3300005834 Ga0068851_10129008 Ga0068851_101290082 285
19 3300006358 Ga0068871_100132068 Ga0068871_1001320681 285
20 3300009177 Ga0105248_10133814 Ga0105248_101338143 285
21 3300025321 Ga0207656_10053728 Ga0207656_100537282 285
22 3300025912 Ga0207707_10001576 Ga0207707_1000157622 285
23 3300025931 Ga0207644_10046132 Ga0207644_100461322 285
24 3300026095 Ga0207676_10067883 Ga0207676_100678833 285
25 3300046684 Ga0495669_0051905 Ga0495669_0051905_606_1589 285
26 3300005331 Ga0070670_100003427 Ga0070670_1000034278 286
27 3300005618 Ga0068864_100006436 Ga0068864_1000064368 286
28 3300005841 Ga0068863_100001012 Ga0068863_1000010124 286
29 3300025925 Ga0207650_10004272 Ga0207650_100042728 286
30 3300026088 Ga0207641_10001097 Ga0207641_1000109712 286
31 3300026095 Ga0207676_10007102 Ga0207676_100071024 286
32 3300054114 Ga0501084_0127922 Ga0501084_0127922_881_1837 286
33 3300005327 Ga0070658_10076319 Ga0070658_100763193 287
34 3300005328 Ga0070676_10091785 Ga0070676_100917852 287
35 3300005329 Ga0070683_100049514 Ga0070683_1000495142 287
36 3300005331 Ga0070670_100078639 Ga0070670_1000786393 287
37 3300005334 Ga0068869_100245364 Ga0068869_1002453642 287
38 3300005335 Ga0070666_10013740 Ga0070666_100137403 287
39 3300005344 Ga0070661_100010643 Ga0070661_1000106437 287
40 3300005354 Ga0070675_100001164 Ga0070675_10000116412 287
41 3300005355 Ga0070671_100003945 Ga0070671_1000039456 287
42 3300005364 Ga0070673_100001390 Ga0070673_10000139013 287
43 3300005456 Ga0070678_100002266 Ga0070678_1000022662 287
44 3300005543 Ga0070672_100002997 Ga0070672_1000029973 287
45 3300005564 Ga0070664_100005343 Ga0070664_1000053432 287
46 3300005578 Ga0068854_100002668 Ga0068854_10000266810 287
47 3300005616 Ga0068852_100006161 Ga0068852_1000061613 287
48 3300005618 Ga0068864_100024434 Ga0068864_1000244344 287
49 3300006237 Ga0097621_100004947 Ga0097621_10000494711 287
50 3300006358 Ga0068871_100000889 Ga0068871_10000088913 287
51 3300013296 Ga0157374_10003535 Ga0157374_100035354 287
52 3300013297 Ga0157378_10005177 Ga0157378_100051773 287
53 3300013306 Ga0163162_10014588 Ga0163162_1001458811 287
54 3300013308 Ga0157375_10006008 Ga0157375_1000600814 287
55 3300014745 Ga0157377_10151750 Ga0157377_101517501 287
56 3300014969 Ga0157376_10004059 Ga0157376_1000405913 287
57 3300025907 Ga0207645_10070940 Ga0207645_100709402 287
58 3300025920 Ga0207649_10004308 Ga0207649_100043089 287
59 3300025920 Ga0207649_10027243 Ga0207649_100272435 287
60 3300025925 Ga0207650_10004028 Ga0207650_1000402812 287
61 3300025926 Ga0207659_10002215 Ga0207659_100022153 287
62 3300025931 Ga0207644_10000418 Ga0207644_1000041826 287
63 3300025940 Ga0207691_10000110 Ga0207691_1000011012 287
64 3300025944 Ga0207661_10158312 Ga0207661_101583122 287
65 3300025945 Ga0207679_10004251 Ga0207679_1000425111 287
66 3300025960 Ga0207651_10011098 Ga0207651_100110983 287
67 3300026089 Ga0207648_10034169 Ga0207648_100341696 287
68 3300026095 Ga0207676_10021023 Ga0207676_100210236 287
69 3300026121 Ga0207683_10002093 Ga0207683_100020934 287
70 3300026142 Ga0207698_10002351 Ga0207698_100023513 287
71 3300048903 Ga0496100_0073425 Ga0496100_0073425_1143_2114 287
72 3300048904 Ga0496101_0119938 Ga0496101_0119938_700_1671 287
73 3300048905 Ga0496102_0079592 Ga0496102_0079592_1950_2921 287
74 3300048909 Ga0496106_0279115 Ga0496106_0279115_60_1031 287
75 3300048911 Ga0496108_0008518 Ga0496108_0008518_954_1925 287
76 3300048912 Ga0496109_0165277 Ga0496109_0165277_132_1103 287
77 3300048913 Ga0496110_0013289 Ga0496110_0013289_284_1255 287
78 3300048915 Ga0496112_0174022 Ga0496112_0174022_188_1159 287
79 3300048917 Ga0496114_0120627 Ga0496114_0120627_617_1588 287
80 3300049576 Ga0501040_0037972 Ga0501040_0037972_203_1159 287
81 3300049577 Ga0501041_0011051 Ga0501041_0011051_3633_4589 287
82 3300049578 Ga0501042_0079039 Ga0501042_0079039_130_1086 287
83 3300049580 Ga0501046_0062584 Ga0501046_0062584_18_974 287
84 3300049588 Ga0501072_0135022 Ga0501072_0135022_38_994 287
85 3300049743 Ga0501081_0174279 Ga0501081_0174279_565_1521 287
86 3300009176 Ga0105242_10119875 Ga0105242_101198752 288
87 3300005564 Ga0070664_100117619 Ga0070664_1001176192 289
88 3300005616 Ga0068852_100004563 Ga0068852_1000045637 289
89 3300005618 Ga0068864_100058463 Ga0068864_1000584632 289
90 3300025945 Ga0207679_10041185 Ga0207679_100411852 289
91 3300025960 Ga0207651_10096744 Ga0207651_100967442 289
92 3300026121 Ga0207683_10019117 Ga0207683_100191174 289
93 3300005329 Ga0070683_100008196 Ga0070683_1000081966 290
94 3300005344 Ga0070661_100001413 Ga0070661_1000014137 290
95 3300005435 Ga0070714_100013143 Ga0070714_1000131434 290
96 3300005458 Ga0070681_10016128 Ga0070681_100161283 290
97 3300005535 Ga0070684_100022030 Ga0070684_1000220306 290
98 3300005539 Ga0068853_100054906 Ga0068853_1000549063 290
99 3300005564 Ga0070664_100035236 Ga0070664_1000352365 290
100 3300005577 Ga0068857_100000810 Ga0068857_10000081015 290
101 3300005578 Ga0068854_100012218 Ga0068854_1000122186 290
102 3300005614 Ga0068856_100014288 Ga0068856_1000142886 290
103 3300005616 Ga0068852_100001129 Ga0068852_1000011296 290
104 3300009093 Ga0105240_10001807 Ga0105240_1000180728 290
105 3300009545 Ga0105237_10274330 Ga0105237_102743302 290
106 3300009551 Ga0105238_10001317 Ga0105238_1000131715 290
107 3300013102 Ga0157371_10161204 Ga0157371_101612042 290
108 3300013104 Ga0157370_10025696 Ga0157370_100256965 290
109 3300013296 Ga0157374_10061974 Ga0157374_100619743 290
110 3300025912 Ga0207707_10086051 Ga0207707_100860511 290
111 3300025914 Ga0207671_10250582 Ga0207671_102505822 290
112 3300025919 Ga0207657_10012171 Ga0207657_100121712 290
113 3300025924 Ga0207694_10003964 Ga0207694_100039644 290
114 3300025944 Ga0207661_10005122 Ga0207661_100051225 290
115 3300025981 Ga0207640_10150603 Ga0207640_101506032 290
116 3300026041 Ga0207639_10041571 Ga0207639_100415713 290
117 3300026078 Ga0207702_10003982 Ga0207702_100039827 290
118 3300026116 Ga0207674_10000418 Ga0207674_1000041829 290
119 3300026142 Ga0207698_10020906 Ga0207698_100209062 290
120 3300048905 Ga0496102_0431719 Ga0496102_0431719_10_891 290
121 3300005364 Ga0070673_100148629 Ga0070673_1001486292 291
122 3300025893 Ga0207682_10116211 Ga0207682_101162111 291
123 3300005564 Ga0070664_100212699 Ga0070664_1002126992 292
124 3300005844 Ga0068862_100057883 Ga0068862_1000578832 292
125 3300035172 Ga0373955_0058411 Ga0373955_0058411_203_1177 293
126 3300036401 Ga0373937_0105102 Ga0373937_0105102_1270_2244 293
127 3300045836 Ga0466958_0117392 Ga0466958_0117392_66_1079 293
128 3300046539 Ga0495621_0029949 Ga0495621_0029949_137_1105 293
129 3300005366 Ga0070659_100230114 Ga0070659_1002301142 295
130 3300025945 Ga0207679_10064662 Ga0207679_100646622 295
131 3300031824 Ga0307413_10007784 Ga0307413_100077845 296
132 3300031995 Ga0307409_100040847 Ga0307409_1000408473 296
133 3300032004 Ga0307414_10047027 Ga0307414_100470271 296
134 3300049587 Ga0501071_0011203 Ga0501071_0011203_3174_4133 296
135 3300005330 Ga0070690_100067937 Ga0070690_1000679372 298
136 3300005456 Ga0070678_100074615 Ga0070678_1000746152 298
137 3300005543 Ga0070672_100122065 Ga0070672_1001220652 298
138 3300005615 Ga0070702_100048117 Ga0070702_1000481172 298
139 3300026121 Ga0207683_10083523 Ga0207683_100835232 298
140 3300035692 Ga0373935_0276388 Ga0373935_0276388_169_1131 298
141 3300005330 Ga0070690_100019776 Ga0070690_1000197764 299
142 3300005333 Ga0070677_10075123 Ga0070677_100751232 299
143 3300005334 Ga0068869_100004150 Ga0068869_1000041504 299
144 3300005340 Ga0070689_100041882 Ga0070689_1000418822 299
145 3300005354 Ga0070675_100007866 Ga0070675_1000078668 299
146 3300005356 Ga0070674_100107416 Ga0070674_1001074163 299
147 3300005364 Ga0070673_100003829 Ga0070673_1000038299 299
148 3300005365 Ga0070688_100097047 Ga0070688_1000970472 299
149 3300005367 Ga0070667_100184171 Ga0070667_1001841713 299
150 3300005440 Ga0070705_100164985 Ga0070705_1001649851 299
151 3300005445 Ga0070708_100000371 Ga0070708_10000037112 299
152 3300005459 Ga0068867_100160325 Ga0068867_1001603252 299
153 3300005618 Ga0068864_100059590 Ga0068864_1000595902 299
154 3300005841 Ga0068863_100063854 Ga0068863_1000638543 299
155 3300005844 Ga0068862_100093479 Ga0068862_1000934792 299
156 3300013297 Ga0157378_10025324 Ga0157378_100253245 299
157 3300013308 Ga0157375_10004326 Ga0157375_1000432610 299
158 3300013308 Ga0157375_10175165 Ga0157375_101751652 299
159 3300014969 Ga0157376_10014370 Ga0157376_100143704 299
160 3300017792 Ga0163161_10169871 Ga0163161_101698712 299
161 3300025926 Ga0207659_10048261 Ga0207659_100482613 299
162 3300025942 Ga0207689_10005712 Ga0207689_100057125 299
163 3300025960 Ga0207651_10011420 Ga0207651_100114202 299
164 3300025986 Ga0207658_10084382 Ga0207658_100843823 299
165 3300025986 Ga0207658_10327854 Ga0207658_103278542 299
166 3300026089 Ga0207648_10007171 Ga0207648_1000717111 299
167 3300026089 Ga0207648_10151836 Ga0207648_101518363 299
168 3300028381 Ga0268264_10164105 Ga0268264_101641052 299
169 3300005354 Ga0070675_100011711 Ga0070675_1000117117 300
170 3300005434 Ga0070709_10191406 Ga0070709_101914061 300
171 3300005438 Ga0070701_10106445 Ga0070701_101064452 300
172 3300005441 Ga0070700_100035152 Ga0070700_1000351523 300
173 3300005456 Ga0070678_100070057 Ga0070678_1000700572 300
174 3300005543 Ga0070672_100014473 Ga0070672_1000144734 300
175 3300005843 Ga0068860_100207226 Ga0068860_1002072262 300
176 3300006881 Ga0068865_100095237 Ga0068865_1000952372 300
177 3300009148 Ga0105243_10011356 Ga0105243_100113567 300
178 3300025923 Ga0207681_10318787 Ga0207681_103187872 300
179 3300025926 Ga0207659_10070130 Ga0207659_100701302 300
180 3300025940 Ga0207691_10007330 Ga0207691_100073309 300
181 3300025986 Ga0207658_10306745 Ga0207658_103067451 300
182 3300026075 Ga0207708_10061180 Ga0207708_100611802 300
183 3300026121 Ga0207683_10009224 Ga0207683_100092248 300
184 3300028380 Ga0268265_10038684 Ga0268265_100386843 300
185 3300005335 Ga0070666_10042430 Ga0070666_100424302 301
186 3300005456 Ga0070678_100018760 Ga0070678_1000187602 301
187 3300005543 Ga0070672_100117325 Ga0070672_1001173254 301
188 3300005548 Ga0070665_100013602 Ga0070665_1000136025 301
189 3300006358 Ga0068871_100271326 Ga0068871_1002713261 301
190 3300006852 Ga0075433_10237043 Ga0075433_102370432 301
191 3300013297 Ga0157378_10245304 Ga0157378_102453042 301
192 3300013308 Ga0157375_10100213 Ga0157375_101002132 301
193 3300014969 Ga0157376_10008580 Ga0157376_100085804 301
194 3300025940 Ga0207691_10013997 Ga0207691_100139974 301
195 3300026089 Ga0207648_10093737 Ga0207648_100937371 301
196 3300026121 Ga0207683_10007943 Ga0207683_100079434 301
197 3300028379 Ga0268266_10058090 Ga0268266_100580902 301
198 3300050511 nmdc:mga08y16_190416_c1 nmdc:mga08y16_190416_c1_98_1054 301
199 3300005347 Ga0070668_100032129 Ga0070668_1000321292 302
200 3300005353 Ga0070669_100020709 Ga0070669_1000207094 302
201 3300005354 Ga0070675_100029983 Ga0070675_1000299833 302
202 3300005364 Ga0070673_100029732 Ga0070673_1000297323 302
203 3300005367 Ga0070667_100117532 Ga0070667_1001175323 302
204 3300005457 Ga0070662_100016778 Ga0070662_1000167784 302
205 3300005543 Ga0070672_100002353 Ga0070672_1000023534 302
206 3300005617 Ga0068859_100309978 Ga0068859_1003099781 302
207 3300005719 Ga0068861_100072525 Ga0068861_1000725253 302
208 3300005841 Ga0068863_100069212 Ga0068863_1000692123 302
209 3300005842 Ga0068858_100020243 Ga0068858_1000202434 302
210 3300006931 Ga0097620_100309968 Ga0097620_1003099683 302
211 3300014326 Ga0157380_10113295 Ga0157380_101132954 302
212 3300014968 Ga0157379_10026196 Ga0157379_100261964 302
213 3300017792 Ga0163161_10114587 Ga0163161_101145872 302
214 3300025933 Ga0207706_10021394 Ga0207706_100213944 302
215 3300025937 Ga0207669_10042744 Ga0207669_100427443 302
216 3300025940 Ga0207691_10002783 Ga0207691_100027838 302
217 3300025960 Ga0207651_10013977 Ga0207651_100139772 302
218 3300025986 Ga0207658_10049526 Ga0207658_100495262 302
219 3300026035 Ga0207703_10016185 Ga0207703_100161855 302
220 3300026118 Ga0207675_100089172 Ga0207675_1000891722 302
221 3300026121 Ga0207683_10197483 Ga0207683_101974832 302
222 3300028381 Ga0268264_10013339 Ga0268264_100133392 302
223 3300028577 Ga0265318_10004630 Ga0265318_100046301 302
224 3300031235 Ga0265330_10024986 Ga0265330_100249863 302
225 3300031238 Ga0265332_10004725 Ga0265332_100047255 302
226 3300031239 Ga0265328_10002094 Ga0265328_100020941 302
227 3300031240 Ga0265320_10045903 Ga0265320_100459033 302
228 3300031242 Ga0265329_10005279 Ga0265329_100052794 302
229 3300031250 Ga0265331_10001778 Ga0265331_100017788 302
230 3300031251 Ga0265327_10050784 Ga0265327_100507841 302
231 3300031711 Ga0265314_10002233 Ga0265314_100022334 302
232 3300031712 Ga0265342_10016999 Ga0265342_100169994 302
233 3300025302 Ga0207426_1026574 Ga0207426_10265742 304
234 3300049576 Ga0501040_0003627 Ga0501040_0003627_6192_7121 307
235 3300006186 Ga0075369_10009342 Ga0075369_100093423 309
236 3300050494 nmdc:mga06z11_203820_c1 nmdc:mga06z11_203820_c1_158_1099 311
237 3300005290 Ga0065712_10150630 Ga0065712_101506302 312
238 3300005331 Ga0070670_100192338 Ga0070670_1001923382 312
239 3300005333 Ga0070677_10023294 Ga0070677_100232943 312
240 3300005354 Ga0070675_100089147 Ga0070675_1000891472 312
241 3300005367 Ga0070667_100244664 Ga0070667_1002446642 312
242 3300005456 Ga0070678_100173458 Ga0070678_1001734582 312
243 3300005618 Ga0068864_100098739 Ga0068864_1000987392 312
244 3300005618 Ga0068864_100366317 Ga0068864_1003663171 312
245 3300005841 Ga0068863_100355842 Ga0068863_1003558422 312
246 3300013296 Ga0157374_10253304 Ga0157374_102533042 312
247 3300025893 Ga0207682_10006116 Ga0207682_100061162 312
248 3300025907 Ga0207645_10019277 Ga0207645_100192773 312
249 3300025908 Ga0207643_10077376 Ga0207643_100773762 312
250 3300025925 Ga0207650_10005988 Ga0207650_100059887 312
251 3300025925 Ga0207650_10180802 Ga0207650_101808022 312
252 3300025940 Ga0207691_10253876 Ga0207691_102538762 312
253 3300025942 Ga0207689_10021896 Ga0207689_100218963 312
254 3300025960 Ga0207651_10015843 Ga0207651_100158432 312
255 3300026088 Ga0207641_10013145 Ga0207641_100131455 312
256 3300026095 Ga0207676_10001836 Ga0207676_1000183612 312
257 3300026095 Ga0207676_10254630 Ga0207676_102546302 312
258 3300046539 Ga0495621_0049146 Ga0495621_0049146_502_1485 312
259 3300053161 Ga0500634_0030352 Ga0500634_0030352_1849_2838 312
260 3300005327 Ga0070658_10203236 Ga0070658_102032362 313
261 3300005338 Ga0068868_100025100 Ga0068868_1000251002 313
262 3300005340 Ga0070689_100137134 Ga0070689_1001371342 313
263 3300005343 Ga0070687_100035873 Ga0070687_1000358732 313
264 3300005344 Ga0070661_100148343 Ga0070661_1001483431 313
265 3300005347 Ga0070668_100088437 Ga0070668_1000884371 313
266 3300005355 Ga0070671_100116052 Ga0070671_1001160522 313
267 3300005356 Ga0070674_100184445 Ga0070674_1001844451 313
268 3300005456 Ga0070678_100011313 Ga0070678_1000113133 313
269 3300005457 Ga0070662_100121081 Ga0070662_1001210812 313
270 3300005459 Ga0068867_100296037 Ga0068867_1002960372 313
271 3300005530 Ga0070679_100290388 Ga0070679_1002903881 313
272 3300005548 Ga0070665_100326416 Ga0070665_1003264162 313
273 3300005718 Ga0068866_10027411 Ga0068866_100274112 313
274 3300005834 Ga0068851_10027476 Ga0068851_100274764 313
275 3300005841 Ga0068863_100051165 Ga0068863_1000511654 313
276 3300006237 Ga0097621_100211021 Ga0097621_1002110212 313
277 3300009148 Ga0105243_10049412 Ga0105243_100494123 313
278 3300009176 Ga0105242_10181902 Ga0105242_101819022 313
279 3300009177 Ga0105248_10046548 Ga0105248_100465485 313
280 3300013296 Ga0157374_10100744 Ga0157374_101007442 313
281 3300013306 Ga0163162_10559061 Ga0163162_105590612 313
282 3300014968 Ga0157379_10058641 Ga0157379_100586413 313
283 3300025912 Ga0207707_10005380 Ga0207707_100053802 313
284 3300025917 Ga0207660_10323856 Ga0207660_103238562 313
285 3300025918 Ga0207662_10017902 Ga0207662_100179023 313
286 3300025920 Ga0207649_10117399 Ga0207649_101173991 313
287 3300025921 Ga0207652_10274502 Ga0207652_102745022 313
288 3300025925 Ga0207650_10006311 Ga0207650_100063111 313
289 3300025937 Ga0207669_10023510 Ga0207669_100235103 313
290 3300025940 Ga0207691_10006961 Ga0207691_1000696111 313
291 3300025945 Ga0207679_10153338 Ga0207679_101533381 313
292 3300025961 Ga0207712_10180410 Ga0207712_101804102 313
293 3300026075 Ga0207708_10057661 Ga0207708_100576614 313
294 3300026089 Ga0207648_10033234 Ga0207648_100332347 313
295 3300026089 Ga0207648_10078985 Ga0207648_100789853 313
296 3300026121 Ga0207683_10018176 Ga0207683_100181765 313
297 3300035691 Ga0373931_0036760 Ga0373931_0036760_1290_2240 313
298 3300048907 Ga0496104_0353608 Ga0496104_0353608_209_1174 313
299 3300048913 Ga0496110_0028831 Ga0496110_0028831_3181_4146 313
300 3300048917 Ga0496114_0169237 Ga0496114_0169237_233_1198 313
301 3300050510 nmdc:mga06r32_330750_c1 nmdc:mga06r32_330750_c1_540_1493 313
302 3300053117 Ga0500593_060314 Ga0500593_060314_581_1549 314
303 iso_pu_bacteria 2887375801 2887376779 314
304 3300005329 Ga0070683_100220487 Ga0070683_1002204871 315
305 3300005354 Ga0070675_100015675 Ga0070675_1000156751 315
306 3300005841 Ga0068863_100010386 Ga0068863_1000103862 315
307 3300005843 Ga0068860_100049738 Ga0068860_1000497381 315
308 3300005844 Ga0068862_100104913 Ga0068862_1001049132 315
309 3300006847 Ga0075431_100257581 Ga0075431_1002575812 315
310 3300025297 Ga0209758_1004073 Ga0209758_10040739 315
311 3300025315 Ga0207697_10014647 Ga0207697_100146474 315
312 3300025934 Ga0207686_10006730 Ga0207686_100067304 315
313 3300026142 Ga0207698_10106297 Ga0207698_101062972 315
314 3300028380 Ga0268265_10040634 Ga0268265_100406343 315
315 3300036401 Ga0373937_0497660 Ga0373937_0497660_55_1008 315
316 3300050510 nmdc:mga06r32_224243_c1 nmdc:mga06r32_224243_c1_148_1098 315
317 3300005458 Ga0070681_10091688 Ga0070681_100916882 316
318 3300005467 Ga0070706_100102790 Ga0070706_1001027902 316
319 3300005467 Ga0070706_100216055 Ga0070706_1002160552 316
320 3300005841 Ga0068863_100091751 Ga0068863_1000917513 316
321 3300025922 Ga0207646_10139994 Ga0207646_101399942 316
322 3300025940 Ga0207691_10187378 Ga0207691_101873782 316
323 3300028786 Ga0307517_10075043 Ga0307517_100750432 316
324 3300046454 Ga0495592_0122363 Ga0495592_0122363_69_1052 316
325 3300046519 Ga0495632_0002900 Ga0495632_0002900_3855_4817 316
326 3300046694 Ga0495649_0003265 Ga0495649_0003265_7806_8768 316
327 3300047321 Ga0495676_0157214 Ga0495676_0157214_522_1505 316
328 3300047443 Ga0495687_001187 Ga0495687_001187_8794_9756 316
329 3300050512 nmdc:mga0n895_258723_c1 nmdc:mga0n895_258723_c1_692_1660 316
330 iso_pu_bacteria 2842747753 2842750356 316
331 3300005295 Ga0065707_10088917 Ga0065707_100889173 317
332 3300005328 Ga0070676_10019688 Ga0070676_100196884 317
333 3300005330 Ga0070690_100003566 Ga0070690_1000035668 317
334 3300005334 Ga0068869_100000262 Ga0068869_1000002624 317
335 3300005336 Ga0070680_100152001 Ga0070680_1001520012 317
336 3300005337 Ga0070682_100001657 Ga0070682_1000016575 317
337 3300005340 Ga0070689_100007621 Ga0070689_1000076217 317
338 3300005341 Ga0070691_10002481 Ga0070691_100024817 317
339 3300005343 Ga0070687_100000189 Ga0070687_10000018919 317
340 3300005344 Ga0070661_100173043 Ga0070661_1001730432 317
341 3300005345 Ga0070692_10014109 Ga0070692_100141093 317
342 3300005364 Ga0070673_100130877 Ga0070673_1001308772 317
343 3300005365 Ga0070688_100154518 Ga0070688_1001545182 317
344 3300005440 Ga0070705_100000307 Ga0070705_1000003072 317
345 3300005441 Ga0070700_100000145 Ga0070700_10000014516 317
346 3300005444 Ga0070694_100011291 Ga0070694_1000112912 317
347 3300005456 Ga0070678_100269644 Ga0070678_1002696442 317
348 3300005459 Ga0068867_100012147 Ga0068867_1000121474 317
349 3300005535 Ga0070684_100431559 Ga0070684_1004315591 317
350 3300005539 Ga0068853_100096395 Ga0068853_1000963952 317
351 3300005543 Ga0070672_100078982 Ga0070672_1000789822 317
352 3300005544 Ga0070686_100002139 Ga0070686_1000021399 317
353 3300005545 Ga0070695_100000178 Ga0070695_10000017810 317
354 3300005546 Ga0070696_100000248 Ga0070696_10000024819 317
355 3300005547 Ga0070693_100011756 Ga0070693_1000117564 317
356 3300005547 Ga0070693_100097190 Ga0070693_1000971902 317
357 3300005548 Ga0070665_100101673 Ga0070665_1001016731 317
358 3300005549 Ga0070704_100002435 Ga0070704_1000024356 317
359 3300005563 Ga0068855_100034194 Ga0068855_1000341944 317
360 3300005564 Ga0070664_100015050 Ga0070664_1000150504 317
361 3300005578 Ga0068854_100005409 Ga0068854_1000054092 317
362 3300005614 Ga0068856_100084522 Ga0068856_1000845222 317
363 3300005615 Ga0070702_100000014 Ga0070702_10000001419 317
364 3300005617 Ga0068859_100003654 Ga0068859_1000036548 317
365 3300005718 Ga0068866_10000777 Ga0068866_100007778 317
366 3300005719 Ga0068861_100000581 Ga0068861_10000058119 317
367 3300005840 Ga0068870_10001592 Ga0068870_100015924 317
368 3300005842 Ga0068858_100004586 Ga0068858_1000045869 317
369 3300005843 Ga0068860_100028614 Ga0068860_1000286142 317
370 3300005844 Ga0068862_100006705 Ga0068862_1000067057 317
371 3300006051 Ga0075364_10044609 Ga0075364_100446091 317
372 3300006195 Ga0075366_10013151 Ga0075366_100131512 317
373 3300006237 Ga0097621_100000525 Ga0097621_10000052521 317
374 3300006353 Ga0075370_10064194 Ga0075370_100641942 317
375 3300006358 Ga0068871_100003413 Ga0068871_1000034137 317
376 3300006881 Ga0068865_100012523 Ga0068865_1000125232 317
377 3300006931 Ga0097620_100003654 Ga0097620_1000036548 317
378 3300007076 Ga0075435_100023975 Ga0075435_1000239755 317
379 3300007265 Ga0099794_10041717 Ga0099794_100417172 317
380 3300009098 Ga0105245_10001140 Ga0105245_1000114018 317
381 3300009148 Ga0105243_10018014 Ga0105243_100180142 317
382 3300009174 Ga0105241_10018045 Ga0105241_100180457 317
383 3300009176 Ga0105242_10000610 Ga0105242_1000061023 317
384 3300009553 Ga0105249_10023298 Ga0105249_100232988 317
385 3300010375 Ga0105239_10071817 Ga0105239_100718174 317
386 3300011119 Ga0105246_10035336 Ga0105246_100353362 317
387 3300013297 Ga0157378_10001659 Ga0157378_100016592 317
388 3300013306 Ga0163162_10773903 Ga0163162_107739031 317
389 3300013308 Ga0157375_10656799 Ga0157375_106567991 317
390 3300014745 Ga0157377_10032877 Ga0157377_100328772 317
391 3300025315 Ga0207697_10074865 Ga0207697_100748652 317
392 3300025885 Ga0207653_10025498 Ga0207653_100254982 317
393 3300025899 Ga0207642_10000667 Ga0207642_100006676 317
394 3300025901 Ga0207688_10071130 Ga0207688_100711302 317
395 3300025907 Ga0207645_10020048 Ga0207645_100200483 317
396 3300025908 Ga0207643_10030155 Ga0207643_100301554 317
397 3300025917 Ga0207660_10006068 Ga0207660_100060684 317
398 3300025918 Ga0207662_10000021 Ga0207662_1000002166 317
399 3300025927 Ga0207687_10000833 Ga0207687_1000083318 317
400 3300025934 Ga0207686_10000804 Ga0207686_1000080412 317
401 3300025936 Ga0207670_10003028 Ga0207670_100030282 317
402 3300025938 Ga0207704_10000327 Ga0207704_100003278 317
403 3300025942 Ga0207689_10000426 Ga0207689_100004269 317
404 3300025944 Ga0207661_10208585 Ga0207661_102085852 317
405 3300025949 Ga0207667_10016330 Ga0207667_100163307 317
406 3300025972 Ga0207668_10032629 Ga0207668_100326294 317
407 3300025981 Ga0207640_10020311 Ga0207640_100203115 317
408 3300026023 Ga0207677_10014356 Ga0207677_100143562 317
409 3300026035 Ga0207703_10012010 Ga0207703_100120109 317
410 3300026035 Ga0207703_10562953 Ga0207703_105629531 317
411 3300026041 Ga0207639_10224277 Ga0207639_102242772 317
412 3300026075 Ga0207708_10000231 Ga0207708_1000023118 317
413 3300026089 Ga0207648_10025041 Ga0207648_100250412 317
414 3300026089 Ga0207648_10040042 Ga0207648_100400424 317
415 3300026118 Ga0207675_100000086 Ga0207675_1000000867 317
416 3300027907 Ga0207428_10303870 Ga0207428_103038702 317
417 3300028379 Ga0268266_10213896 Ga0268266_102138963 317
418 3300028380 Ga0268265_10022052 Ga0268265_100220524 317
419 3300028381 Ga0268264_10001620 Ga0268264_100016202 317
420 3300035090 Ga0373949_0006402 Ga0373949_0006402_136_1122 317
421 3300035092 Ga0373952_0003060 Ga0373952_0003060_544_1530 317
422 3300035112 Ga0373932_0001975 Ga0373932_0001975_1455_2441 317
423 3300035114 Ga0373939_0000701 Ga0373939_0000701_4802_5788 317
424 3300035691 Ga0373931_0001220 Ga0373931_0001220_6540_7526 317
425 3300035725 Ga0373947_0057448 Ga0373947_0057448_1039_2025 317
426 3300037068 Ga0373925_0290173 Ga0373925_0290173_45_1031 317
427 3300045051 Ga0451576_0008768 Ga0451576_0008768_3384_4370 317
428 3300049570 Ga0501033_0000891 Ga0501033_0000891_1226_2185 317
429 3300050491 nmdc:mga00v17_21077_c1 nmdc:mga00v17_21077_c1_2058_3038 317
430 3300050492 nmdc:mga0yw44_132864_c1 nmdc:mga0yw44_132864_c1_227_1207 317
431 3300050493 nmdc:mga0k408_2808_c1 nmdc:mga0k408_2808_c1_5244_6218 317
432 3300050493 nmdc:mga0k408_30058_c1 nmdc:mga0k408_30058_c1_1890_2870 317
433 3300050496 nmdc:mga07m45_16546_c1 nmdc:mga07m45_16546_c1_1682_2656 317
434 3300050511 nmdc:mga08y16_218739_c1 nmdc:mga08y16_218739_c1_630_1616 317
435 3300050513 nmdc:mga0rr50_12742_c1 nmdc:mga0rr50_12742_c1_3978_4934 317
436 3300053087 Ga0500643_003287 Ga0500643_003287_5729_6712 317
437 iso_pu_bacteria 2881412998 2881413428 317
438 3300005615 Ga0070702_100175751 Ga0070702_1001757511 318
439 3300005719 Ga0068861_100085480 Ga0068861_1000854804 318
440 3300005841 Ga0068863_100159625 Ga0068863_1001596252 318
441 3300006852 Ga0075433_10089533 Ga0075433_100895332 318
442 3300006871 Ga0075434_100034198 Ga0075434_1000341984 318
443 3300014969 Ga0157376_10132948 Ga0157376_101329482 318
444 3300025923 Ga0207681_10125986 Ga0207681_101259862 318
445 3300025972 Ga0207668_10026327 Ga0207668_100263272 318
446 3300026088 Ga0207641_10122835 Ga0207641_101228352 318
447 3300026118 Ga0207675_100092116 Ga0207675_1000921164 318
448 3300027907 Ga0207428_10133780 Ga0207428_101337803 318
449 3300028573 Ga0265334_10045098 Ga0265334_100450982 318
450 3300028800 Ga0265338_10107800 Ga0265338_101078003 318
451 3300035691 Ga0373931_0192453 Ga0373931_0192453_116_1087 318
452 3300046537 Ga0495598_0073683 Ga0495598_0073683_55_1026 318
453 3300046615 Ga0495656_0049377 Ga0495656_0049377_657_1628 318
454 3300048905 Ga0496102_0511775 Ga0496102_0511775_29_994 318
455 3300053094 Ga0500566_0000231 Ga0500566_0000231_24783_25772 318
456 3300053153 Ga0500616_0003403 Ga0500616_0003403_10948_11922 318
457 3300053161 Ga0500634_0053920 Ga0500634_0053920_408_1397 318
458 3300006844 Ga0075428_100092295 Ga0075428_1000922953 319
459 3300009147 Ga0114129_10236899 Ga0114129_102368993 319
460 3300025936 Ga0207670_10133756 Ga0207670_101337561 319
461 3300035724 Ga0373933_0180357 Ga0373933_0180357_305_1270 319
462 3300036401 Ga0373937_0107231 Ga0373937_0107231_587_1552 319
463 3300037312 Ga0395899_0005693 Ga0395899_0005693_6876_7853 319
464 3300037312 Ga0395899_0008434 Ga0395899_0008434_1423_2400 319
465 3300037418 Ga0395900_0034401 Ga0395900_0034401_4075_5052 319
466 3300037418 Ga0395900_0044109 Ga0395900_0044109_1228_2205 319
467 3300037466 Ga0395898_0006517 Ga0395898_0006517_5135_6112 319
468 3300037466 Ga0395898_0031484 Ga0395898_0031484_2760_3737 319
469 3300037471 Ga0395905_0004405 Ga0395905_0004405_7015_7992 319
470 3300037471 Ga0395905_0006862 Ga0395905_0006862_10055_11032 319
471 3300038443 Ga0395901_0007572 Ga0395901_0007572_6413_7390 319
472 3300038443 Ga0395901_0012635 Ga0395901_0012635_4242_5219 319
473 3300041407 Ga0439447_020607 Ga0439447_020607_556_1536 319
474 3300048916 Ga0496113_0383944 Ga0496113_0383944_37_1068 319
475 3300049744 Ga0501083_0098685 Ga0501083_0098685_250_1221 319
476 3300050507 nmdc:mga05p37_278921_c1 nmdc:mga05p37_278921_c1_331_1296 319
477 3300005548 Ga0070665_100010470 Ga0070665_1000104703 320
478 3300005842 Ga0068858_100264368 Ga0068858_1002643682 320
479 3300006195 Ga0075366_10142074 Ga0075366_101420742 320
480 3300025302 Ga0207426_1005137 Ga0207426_10051376 320
481 3300025912 Ga0207707_10019952 Ga0207707_100199523 320
482 3300025925 Ga0207650_10378416 Ga0207650_103784161 320
483 3300025949 Ga0207667_10010866 Ga0207667_100108666 320
484 3300028379 Ga0268266_10020803 Ga0268266_100208033 320
485 3300031548 Ga0307408_100172257 Ga0307408_1001722571 320
486 3300031903 Ga0307407_10069634 Ga0307407_100696342 320
487 3300031911 Ga0307412_10076632 Ga0307412_100766322 320
488 3300031995 Ga0307409_100483537 Ga0307409_1004835372 320
489 3300032004 Ga0307414_10136529 Ga0307414_101365292 320
490 3300032126 Ga0307415_100171527 Ga0307415_1001715272 320
491 3300046558 Ga0495633_0004166 Ga0495633_0004166_1409_2425 320
492 3300053136 Ga0500559_0007488 Ga0500559_0007488_828_1799 320
493 3300053140 Ga0500573_0047637 Ga0500573_0047637_48_1019 320
494 3300005331 Ga0070670_100181329 Ga0070670_1001813292 321
495 3300005365 Ga0070688_100031599 Ga0070688_1000315992 321
496 3300005367 Ga0070667_100151652 Ga0070667_1001516522 321
497 3300006038 Ga0075365_10045523 Ga0075365_100455233 321
498 3300006177 Ga0075362_10077345 Ga0075362_100773452 321
499 3300009094 Ga0111539_10264637 Ga0111539_102646372 321
500 3300025920 Ga0207649_10053986 Ga0207649_100539863 321
501 3300025944 Ga0207661_10070397 Ga0207661_100703974 321
502 3300030521 Ga0307511_10000019 Ga0307511_1000001940 321
503 3300031251 Ga0265327_10010421 Ga0265327_100104214 321
504 3300042876 Ga0451577_0011129 Ga0451577_0011129_5355_6362 321
505 3300044712 Ga0453684_0169670 Ga0453684_0169670_852_1859 321
506 3300049570 Ga0501033_0038018 Ga0501033_0038018_691_1668 321
507 3300049575 Ga0501039_0021818 Ga0501039_0021818_1749_2726 321
508 3300049578 Ga0501042_0021693 Ga0501042_0021693_2402_3379 321
509 3300049582 Ga0501048_0003839 Ga0501048_0003839_5860_6837 321
510 3300049588 Ga0501072_0002755 Ga0501072_0002755_2522_3499 321
511 3300049589 Ga0501073_0104758 Ga0501073_0104758_498_1475 321
512 3300049591 Ga0501075_0001234 Ga0501075_0001234_9743_10720 321
513 3300049741 Ga0501079_0012875 Ga0501079_0012875_1480_2457 321
514 3300049742 Ga0501080_0018189 Ga0501080_0018189_3490_4467 321
515 3300049743 Ga0501081_0001544 Ga0501081_0001544_805_1782 321
516 3300049822 Ga0501035_0177637 Ga0501035_0177637_578_1555 321
517 3300049824 Ga0501045_0000154 Ga0501045_0000154_11217_12194 321
518 3300050492 nmdc:mga0yw44_77214_c1 nmdc:mga0yw44_77214_c1_97_1098 321
519 3300050511 nmdc:mga08y16_103389_c1 nmdc:mga08y16_103389_c1_610_1596 321
520 3300050512 nmdc:mga0n895_133549_c1 nmdc:mga0n895_133549_c1_1062_2048 321
521 3300050515 nmdc:mga0a205_11698_c1 nmdc:mga0a205_11698_c1_408_1394 321
522 3300054114 Ga0501084_0006792 Ga0501084_0006792_4356_5333 321
523 3300060353 Ga0501082_0006485 Ga0501082_0006485_6152_7129 321
524 3300061734 Ga0530510_0001503 Ga0530510_0001503_13854_14831 321
525 3300005535 Ga0070684_100400446 Ga0070684_1004004461 322
526 3300021384 Ga0213876_10127407 Ga0213876_101274071 322
527 3300039437 Ga0436365_1111801 Ga0436365_1111801_400_1380 322
528 3300049576 Ga0501040_0145115 Ga0501040_0145115_50_1036 322
529 3300049577 Ga0501041_0224494 Ga0501041_0224494_166_1152 322
530 3300049581 Ga0501047_0103739 Ga0501047_0103739_1681_2700 322
531 3300049591 Ga0501075_0248412 Ga0501075_0248412_295_1281 322
532 3300049741 Ga0501079_0369702 Ga0501079_0369702_26_1012 322
533 3300049823 Ga0501044_0333629 Ga0501044_0333629_238_1257 322
534 iso_pu_bacteria 2881412998 2881416261 322
535 iso_pu_bacteria 2881927736 2881930615 322
536 iso_pu_bacteria 8055225921 8055227400 322
537 3300005331 Ga0070670_100008142 Ga0070670_1000081422 323
538 3300005331 Ga0070670_100259926 Ga0070670_1002599262 323
539 3300005333 Ga0070677_10018484 Ga0070677_100184842 323
540 3300005338 Ga0068868_100226871 Ga0068868_1002268712 323
541 3300005338 Ga0068868_100244961 Ga0068868_1002449612 323
542 3300005344 Ga0070661_100100592 Ga0070661_1001005922 323
543 3300005344 Ga0070661_100255867 Ga0070661_1002558671 323
544 3300005353 Ga0070669_100105300 Ga0070669_1001053002 323
545 3300005354 Ga0070675_100055090 Ga0070675_1000550902 323
546 3300005355 Ga0070671_100051833 Ga0070671_1000518332 323
547 3300005356 Ga0070674_100102328 Ga0070674_1001023282 323
548 3300005364 Ga0070673_100036888 Ga0070673_1000368883 323
549 3300005364 Ga0070673_100182610 Ga0070673_1001826102 323
550 3300005367 Ga0070667_100037677 Ga0070667_1000376774 323
551 3300005458 Ga0070681_10086470 Ga0070681_100864702 323
552 3300005459 Ga0068867_100011207 Ga0068867_1000112074 323
553 3300005468 Ga0070707_100017332 Ga0070707_1000173323 323
554 3300005543 Ga0070672_100042837 Ga0070672_1000428372 323
555 3300005543 Ga0070672_100062363 Ga0070672_1000623633 323
556 3300005548 Ga0070665_100220673 Ga0070665_1002206732 323
557 3300005618 Ga0068864_100115580 Ga0068864_1001155802 323
558 3300005718 Ga0068866_10028281 Ga0068866_100282812 323
559 3300005841 Ga0068863_100026715 Ga0068863_1000267152 323
560 3300005843 Ga0068860_100215735 Ga0068860_1002157352 323
561 3300006237 Ga0097621_100000283 Ga0097621_10000028328 323
562 3300006237 Ga0097621_100037722 Ga0097621_1000377223 323
563 3300006358 Ga0068871_100074990 Ga0068871_1000749902 323
564 3300006846 Ga0075430_100008305 Ga0075430_1000083054 323
565 3300006847 Ga0075431_100003044 Ga0075431_1000030444 323
566 3300006880 Ga0075429_100011263 Ga0075429_1000112636 323
567 3300009176 Ga0105242_10338682 Ga0105242_103386822 323
568 3300013297 Ga0157378_10087176 Ga0157378_100871763 323
569 3300013306 Ga0163162_10042429 Ga0163162_100424293 323
570 3300013306 Ga0163162_10062607 Ga0163162_100626073 323
571 3300013308 Ga0157375_10091090 Ga0157375_100910903 323
572 3300013308 Ga0157375_10102627 Ga0157375_101026272 323
573 3300014969 Ga0157376_10179628 Ga0157376_101796282 323
574 3300017792 Ga0163161_10006520 Ga0163161_100065206 323
575 3300025893 Ga0207682_10010493 Ga0207682_100104932 323
576 3300025907 Ga0207645_10145847 Ga0207645_101458472 323
577 3300025920 Ga0207649_10245104 Ga0207649_102451042 323
578 3300025923 Ga0207681_10051742 Ga0207681_100517422 323
579 3300025926 Ga0207659_10085294 Ga0207659_100852942 323
580 3300025933 Ga0207706_10021395 Ga0207706_100213955 323
581 3300025935 Ga0207709_10178215 Ga0207709_101782152 323
582 3300025940 Ga0207691_10002261 Ga0207691_1000226111 323
583 3300025940 Ga0207691_10012533 Ga0207691_100125332 323
584 3300025941 Ga0207711_10019453 Ga0207711_100194535 323
585 3300025944 Ga0207661_10053144 Ga0207661_100531442 323
586 3300025960 Ga0207651_10114530 Ga0207651_101145302 323
587 3300025960 Ga0207651_10144412 Ga0207651_101444122 323
588 3300025986 Ga0207658_10026531 Ga0207658_100265312 323
589 3300026023 Ga0207677_10011562 Ga0207677_100115621 323
590 3300026088 Ga0207641_10089468 Ga0207641_100894682 323
591 3300026089 Ga0207648_10017646 Ga0207648_100176464 323
592 3300026121 Ga0207683_10003538 Ga0207683_100035385 323
593 3300028381 Ga0268264_10133825 Ga0268264_101338252 323
594 3300028573 Ga0265334_10014823 Ga0265334_100148233 323
595 3300035111 Ga0373923_0047129 Ga0373923_0047129_441_1418 323
596 3300048913 Ga0496110_0057664 Ga0496110_0057664_2283_3266 323
597 3300048916 Ga0496113_0245800 Ga0496113_0245800_332_1315 323
598 3300053151 Ga0500604_0001141 Ga0500604_0001141_4351_5352 323
599 iso_pu_bacteria 2855730933 2855731676 323
600 iso_pu_bacteria 2855767633 2855768382 323
601 3300031456 Ga0307513_10158733 Ga0307513_101587332 324
602 3300005338 Ga0068868_100104231 Ga0068868_1001042312 326
603 3300005616 Ga0068852_100444419 Ga0068852_1004444191 326
604 3300025907 Ga0207645_10061196 Ga0207645_100611964 326
605 3300026121 Ga0207683_10010606 Ga0207683_100106065 326
606 3300032005 Ga0307411_10171098 Ga0307411_101710982 326
607 3300005843 Ga0068860_100152987 Ga0068860_1001529873 327
608 3300028381 Ga0268264_10023675 Ga0268264_100236755 327
609 3300031251 Ga0265327_10016633 Ga0265327_100166334 327
610 3300050509 nmdc:mga0qj67_39957_c1 nmdc:mga0qj67_39957_c1_506_1492 327
611 3300050510 nmdc:mga06r32_12503_c1 nmdc:mga06r32_12503_c1_4103_5089 327
612 3300003187 JGI25151J46595_10000075 JGI25151J46595_1000007523 333
613 3300025294 Ga0209025_1000027 Ga0209025_1000027263 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

77

351

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9411 38 329
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.936 36 331
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9277 37 329
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9259 38 329
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.924 36 331
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9502 135 257 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9464 37 328 3.40.190.150
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9427 135 257 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9399 135 254 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9288 37 329 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A439F197-F1-model_v4 deleted 0.9749 91 327
AF-A0A3A3FMR4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9707 55 327
AF-A0A1Q4BAC4-F1-model_v4 ABC transporter substrate-binding protein 0.9697 35 326
AF-A0A6N1XB07-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9695 37 328
AF-A0A2R4XH22-F1-model_v4 LacI family transcriptional regulator 0.968 28 328

Feature Viewer

pLDDT pTM Quality
89.38 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map