F469275

General Info

Members Datasets Scaffolds Average Seq Length
613 431 438 309

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0005131|Ga0439465_0005131_1245_2312
Length 355
Sequence LCIFVFIAFLQLVQYIISKQQLGTRCTAKGTSMTDWMTKDIPDQTDCIAVITGATSGIGYETAKALAGAGARVIIASRNVEKGKRTLADIRAAHAGAKVSFEPVDLASLTSVANCATRLSASLPRIDLLINNAGIMAIPTRHVTEDGFEMQLGANYIGHFALNLRLLPKVLSGSAPRIVTVSSLAHRSGRINFDDLQCEQRYGYWSAYAQSKLATLMFSLELDRMARAQGWNLRSNAAHPGYAVTGLQSTGPRMGRTGPSWQERFSKLLEPLLSQSAAAGALPTLFAATSPDAKGGAMYGPDGFYELKGSPALAKIVPAAQDKAVWRRLWQVSEYLTGLSLDGVAEASAERKRQP

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
13 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
19 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
20 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
21 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
22 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
23 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
24 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
25 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
28 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
29 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
30 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
31 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355261 Rhizobium sp. J15 Isolate Nodule
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
37 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
43 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
44 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
45 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
46 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
47 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
48 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
53 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
54 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
55 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
56 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
57 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
64 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
65 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
66 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
67 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
72 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
75 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
76 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
77 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
78 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
79 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
80 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
81 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
82 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
83 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
84 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
85 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
86 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
87 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
88 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
89 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
90 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
91 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
92 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
93 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
94 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
95 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
96 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
97 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
98 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
99 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
100 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
101 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
102 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
103 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
104 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
105 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
106 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
107 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
108 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
109 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
110 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
111 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
112 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
113 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
114 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
115 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
116 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
117 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
118 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
119 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
120 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
121 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
122 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
123 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
124 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
125 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
126 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
127 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
128 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
129 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
130 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
131 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
132 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
133 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
134 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
135 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
136 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
137 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
138 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
139 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
140 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
141 2996893221 Rhizobium sp. R635 Isolate Nodule
142 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
143 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
144 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
145 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
146 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
147 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
148 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
149 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
150 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
151 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
152 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
153 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
154 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
155 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
156 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
157 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
158 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
159 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
160 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
161 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
162 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
163 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
164 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
165 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
166 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
167 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
168 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
169 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
170 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
171 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
172 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
173 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
174 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
175 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
176 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
177 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
178 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
179 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
180 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
181 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
182 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
183 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
184 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
185 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
186 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
187 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
188 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
189 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
190 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
191 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
192 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
193 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
194 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
195 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
196 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
197 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
198 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
199 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
200 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
201 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
202 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
203 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
204 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
205 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
206 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
207 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
208 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
209 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
210 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
211 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
213 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
214 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
215 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
216 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
217 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
218 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
219 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
220 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
221 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
222 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
223 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
225 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
226 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
228 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
229 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
231 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
233 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
235 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
238 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
257 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
260 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
261 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
267 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
268 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
269 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
270 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
271 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
272 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
317 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
326 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
331 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
350 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
353 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
373 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
374 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
375 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
378 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
379 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
380 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
381 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
382 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
383 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
384 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
385 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
386 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
387 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
388 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
389 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
390 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
391 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
394 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
395 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
396 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
397 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
398 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
399 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
400 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
401 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
402 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
403 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
406 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
407 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
408 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
409 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
410 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
411 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
412 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
413 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
414 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
415 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
416 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
417 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
418 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
419 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
420 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
421 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
422 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
423 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
424 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
425 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
426 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
427 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
428 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
429 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
430 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
431 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.69
Metatranscriptomes 0
Isolates 28.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.68
Nodule 19.9
Rhizoplane 4.73
Rhizosphere 34.42
Stem 0
Stem Tuber 0
Unclassified 18.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000300 3300001979 Bacteria 21094
2 JGI24739J22299_10000502 3300001989 Bacteria 13884
3 JGI24735J21928_10007019 3300002067 Bacteria 3682
4 JGI25162J39368_1000689 3300002737 Bacteria 23547
5 JGI25162J39368_1001544 3300002737 Bacteria 11849
6 JGI25158J39367_1000035 3300002739 Bacteria 30451
7 JGI25158J39367_1000131 3300002739 Bacteria 17548
8 JGI25152J39213_1001525 3300002773 Bacteria 9845
9 JGI25152J39213_1002258 3300002773 Bacteria 7443
10 JGI25150J39212_1000241 3300002774 Bacteria 29238
11 JGI25150J39212_1014960 3300002774 Bacteria 1304
12 JGI25159J45721_1001176 3300002987 Bacteria 11174
13 JGI25151J46595_10024703 3300003187 Bacteria 2456
14 JGI25165J46597_1000570 3300003214 Bacteria 33114
15 JGI25165J46597_1000585 3300003214 Bacteria 31924
16 JGI25153J46596_10000109 3300003215 Bacteria 93661
17 JGI25153J46596_10000537 3300003215 Bacteria 23734
18 JGI25153J46596_10003243 3300003215 Bacteria 9147
19 JGI25153J46596_10003292 3300003215 Bacteria 9075
20 JGI25153J46596_10004711 3300003215 Bacteria 7278
21 rootH2_10126306 3300003320 Bacteria 2029
22 rootL2_10082831 3300003322 Bacteria 7150
23 rootH1_10015310 3300003323 Bacteria 7695
24 rootH1_10132888 3300003323 Bacteria 1917
25 rootH1_10137524 3300003323 Unclassified 1936
26 rootH1_10243827 3300003323 Bacteria 2449
27 JGI25160J50197_1000012 3300003354 Bacteria 267582
28 JGI25160J50197_1000710 3300003354 Bacteria 18324
29 JGI25161J50226_1000002 3300003374 Bacteria 420324
30 JGI25161J50226_1000117 3300003374 Bacteria 59670
31 Ga0055526_1000296 3300003771 Bacteria 41724
32 Ga0055526_1008819 3300003771 Bacteria 4959
33 Ga0055536_1000156 3300003781 Bacteria 59021
34 Ga0055536_1000589 3300003781 Bacteria 24747
35 Ga0055530_10007197 3300003791 Bacteria 4750
36 Ga0055540_1004714 3300003792 Bacteria 6035
37 Ga0055531_10000121 3300003794 Bacteria 87524
38 Ga0055543_1000037 3300004625 Bacteria 125386
39 Ga0055543_1000050 3300004625 Bacteria 107366
40 Ga0055543_1008572 3300004625 Bacteria 2255
41 Ga0065165_1000031 3300005262 Bacteria 216330
42 Ga0065165_1002114 3300005262 Bacteria 18121
43 Ga0065165_1006111 3300005262 Bacteria 6448
44 Ga0065165_1008083 3300005262 Bacteria 5018
45 Ga0065165_1011141 3300005262 Bacteria 3793
46 Ga0065704_10070468 3300005289 Bacteria 23690
47 Ga0070670_100272870 3300005331 Bacteria 1476
48 Ga0070682_100071060 3300005337 Bacteria 2227
49 Ga0070668_100018562 3300005347 Bacteria 5222
50 Ga0070668_100021426 3300005347 Bacteria 4882
51 Ga0070668_100056220 3300005347 Bacteria 3038
52 Ga0070668_100058465 3300005347 Bacteria 2983
53 Ga0070669_100003350 3300005353 Bacteria 11516
54 Ga0070669_100191691 3300005353 Bacteria 1604
55 Ga0070671_100068814 3300005355 Bacteria 2952
56 Ga0070659_100102349 3300005366 Bacteria 2306
57 Ga0070667_100033469 3300005367 Bacteria 4296
58 Ga0070663_100183497 3300005455 Bacteria 1625
59 Ga0070662_100097175 3300005457 Bacteria 2223
60 Ga0068853_100008604 3300005539 Bacteria 8205
61 Ga0070665_100019197 3300005548 Bacteria 6858
62 Ga0070665_100084075 3300005548 Bacteria 3187
63 Ga0070665_100115642 3300005548 Bacteria 2685
64 Ga0070665_100241704 3300005548 Bacteria 1806
65 Ga0068857_100195220 3300005577 Bacteria 1844
66 Ga0068856_100050482 3300005614 Bacteria 4101
67 Ga0068856_100203346 3300005614 Bacteria 1995
68 Ga0068859_100262922 3300005617 Bacteria 1817
69 Ga0068864_100149604 3300005618 Bacteria 2114
70 Ga0068863_100115597 3300005841 Bacteria 2556
71 Ga0068858_100063033 3300005842 Bacteria 3429
72 Ga0068860_100052672 3300005843 Bacteria 3870
73 Ga0068862_100015997 3300005844 Bacteria 6237
74 Ga0068862_100157270 3300005844 Bacteria 2027
75 Ga0068862_100322337 3300005844 Bacteria 1426
76 Ga0081539_10011424 3300005985 Bacteria 7018
77 Ga0075365_10035412 3300006038 Bacteria 3229
78 Ga0075367_10087745 3300006178 Bacteria 1889
79 Ga0075369_10007846 3300006186 Bacteria 4085
80 Ga0075366_10030959 3300006195 Bacteria 3147
81 Ga0075370_10022209 3300006353 Bacteria 3482
82 Ga0075370_10036416 3300006353 Bacteria 2764
83 Ga0097620_100262926 3300006931 Bacteria 1817
84 Ga0079104_1000854 3300006946 Bacteria 25347
85 Ga0105251_10001532 3300009011 Bacteria 19828
86 Ga0105244_10012308 3300009036 Bacteria 5058
87 Ga0105250_10001426 3300009092 Bacteria 12907
88 Ga0105240_10117017 3300009093 Bacteria 3215
89 Ga0105240_10170754 3300009093 Bacteria 2576
90 Ga0105247_10043660 3300009101 Bacteria 2747
91 Ga0105247_10321951 3300009101 Bacteria 1079
92 Ga0105243_10347303 3300009148 Bacteria 1361
93 Ga0105248_10079853 3300009177 Bacteria 3677
94 Ga0105237_10072073 3300009545 Bacteria 3449
95 Ga0105238_10258438 3300009551 Bacteria 1721
96 Ga0105239_10106945 3300010375 Bacteria 3099
97 Ga0105239_10392291 3300010375 Bacteria 1570
98 Ga0105246_10063489 3300011119 Bacteria 2576
99 Ga0157371_10006165 3300013102 Bacteria 9950
100 Ga0157370_10000047 3300013104 Bacteria 124911
101 Ga0157369_10040020 3300013105 Bacteria 5120
102 Ga0157369_10334213 3300013105 Bacteria 1574
103 Ga0157374_10147019 3300013296 Bacteria 2289
104 Ga0163162_10012396 3300013306 Bacteria 8326
105 Ga0157375_10454514 3300013308 Bacteria 1446
106 Ga0163163_10295119 3300014325 Bacteria 1673
107 Ga0182008_10068428 3300014497 Bacteria 1747
108 Ga0157379_10355190 3300014968 Bacteria 1342
109 Ga0157376_10151933 3300014969 Bacteria 2089
110 Ga0163161_10167808 3300017792 Bacteria 1677
111 Ga0163161_10373815 3300017792 Bacteria 1138
112 Ga0214544_1000035 3300021320 Bacteria 146874
113 Ga0214542_1000181 3300021321 Bacteria 97233
114 Ga0214545_1000094 3300021324 Bacteria 98180
115 Ga0214543_1000155 3300021327 Bacteria 97353
116 Ga0209436_100054 3300025208 Bacteria 62857
117 Ga0209563_102659 3300025230 Bacteria 3957
118 Ga0209437_100050 3300025233 Bacteria 394010
119 Ga0209437_100056 3300025233 Bacteria 363071
120 Ga0207425_1000073 3300025245 Bacteria 113233
121 Ga0207425_1000259 3300025245 Bacteria 39126
122 Ga0209677_103672 3300025253 Bacteria 4826
123 Ga0209129_1000175 3300025258 Bacteria 93817
124 Ga0209129_1000352 3300025258 Bacteria 38789
125 Ga0209129_1003463 3300025258 Bacteria 6843
126 Ga0209233_1000037 3300025261 Bacteria 554620
127 Ga0209233_1000071 3300025261 Bacteria 363290
128 Ga0209233_1001584 3300025261 Bacteria 8905
129 Ga0209673_1010157 3300025273 Bacteria 3996
130 Ga0209130_1000002 3300025284 Bacteria 722648
131 Ga0209130_1000028 3300025284 Bacteria 325668
132 Ga0209676_1000031 3300025292 Bacteria 478976
133 Ga0209676_1000077 3300025292 Bacteria 298831
134 Ga0209025_1000202 3300025294 Bacteria 145750
135 Ga0209564_1000136 3300025295 Bacteria 185198
136 Ga0209564_1003132 3300025295 Bacteria 11675
137 Ga0209564_1006671 3300025295 Bacteria 6152
138 Ga0209564_1014286 3300025295 Bacteria 3313
139 Ga0209758_1000015 3300025297 Bacteria 851943
140 Ga0209758_1000204 3300025297 Bacteria 131754
141 Ga0209758_1000242 3300025297 Bacteria 113233
142 Ga0209758_1000275 3300025297 Bacteria 102404
143 Ga0209758_1000673 3300025297 Bacteria 51032
144 Ga0209758_1001399 3300025297 Bacteria 28640
145 Ga0209758_1002531 3300025297 Bacteria 18469
146 Ga0209050_1000135 3300025298 Bacteria 184020
147 Ga0209050_1003670 3300025298 Bacteria 11079
148 Ga0209256_1004503 3300025299 Bacteria 8706
149 Ga0209256_1006210 3300025299 Bacteria 6441
150 Ga0209256_1020302 3300025299 Bacteria 2079
151 Ga0207426_1000012 3300025302 Bacteria 730942
152 Ga0207426_1000013 3300025302 Bacteria 721897
153 Ga0207426_1000186 3300025302 Bacteria 154130
154 Ga0207426_1001117 3300025302 Bacteria 24608
155 Ga0207426_1021435 3300025302 Bacteria 2235
156 Ga0209257_1000050 3300025304 Bacteria 439325
157 Ga0209257_1004161 3300025304 Bacteria 11487
158 Ga0209257_1008991 3300025304 Bacteria 5484
159 Ga0209257_1012222 3300025304 Bacteria 4003
160 Ga0209257_1042618 3300025304 Bacteria 1337
161 Ga0207696_1000429 3300025711 Bacteria 38341
162 Ga0207655_1038177 3300025728 Bacteria 2103
163 Ga0207713_1000871 3300025735 Bacteria 27596
164 Ga0207695_10139490 3300025913 Bacteria 2374
165 Ga0207681_10003105 3300025923 Bacteria 10438
166 Ga0207644_10030813 3300025931 Bacteria 3733
167 Ga0207706_10063900 3300025933 Bacteria 3240
168 Ga0207709_10197497 3300025935 Bacteria 1434
169 Ga0207711_10253800 3300025941 Bacteria 1615
170 Ga0207689_10125040 3300025942 Bacteria 2116
171 Ga0207668_10040392 3300025972 Bacteria 3147
172 Ga0207668_10045134 3300025972 Bacteria 3003
173 Ga0207668_10285446 3300025972 Bacteria 1355
174 Ga0207703_10349427 3300026035 Bacteria 1361
175 Ga0207639_10005861 3300026041 Bacteria 8324
176 Ga0207678_10009555 3300026067 Bacteria 8531
177 Ga0207678_10019372 3300026067 Bacteria 5978
178 Ga0207678_10035091 3300026067 Bacteria 4367
179 Ga0207702_10131390 3300026078 Bacteria 2254
180 Ga0207676_10169291 3300026095 Bacteria 1902
181 Ga0207675_100152879 3300026118 Bacteria 2197
182 Ga0209281_1000355 3300027111 Bacteria 75566
183 Ga0209371_1004480 3300027312 Bacteria 6035
184 Ga0268265_10057404 3300028380 Bacteria 2966
185 Ga0268265_10317278 3300028380 Bacteria 1410
186 Ga0307515_10064263 3300028794 Bacteria 5133
187 Ga0307515_10269227 3300028794 Bacteria 1427
188 Ga0268256_1012930 3300030500 Bacteria 2557
189 Ga0307513_10002605 3300031456 Bacteria 24924
190 Ga0307412_10048726 3300031911 Bacteria 2788
191 Ga0307414_10022395 3300032004 Bacteria 3984
192 Ga0307414_10206532 3300032004 Bacteria 1602
193 Ga0307510_10002425 3300033180 Bacteria 21169
194 Ga0307510_10081042 3300033180 Bacteria 3150
195 Ga0307510_10231048 3300033180 Bacteria 1352
196 Ga0395905_0182004 3300037471 Bacteria 1973
197 Ga0439465_0000160 3300041413 Bacteria 16929
198 Ga0439465_0005131 3300041413 Bacteria 4203
199 Ga0439465_0012776 3300041413 Bacteria 2626
200 Ga0451791_0554500 3300041451 Bacteria 2126
201 Ga0451797_0446528 3300041453 Bacteria 1260
202 Ga0451847_0212185 3300041503 Bacteria 1056
203 Ga0451843_0875056 3300041509 Bacteria 2030
204 Ga0439431_0004808 3300041997 Bacteria 2975
205 Ga0439433_0009951 3300041999 Bacteria 2076
206 Ga0439449_0007155 3300042007 Bacteria 4246
207 Ga0450911_000015 3300042115 Bacteria 109635
208 Ga0466967_0109851 3300045976 Bacteria 2532
209 Ga0495592_0004233 3300046454 Bacteria 10483
210 Ga0495603_0060885 3300046455 Bacteria 2230
211 Ga0495590_0050752 3300046457 Bacteria 1448
212 Ga0495629_0009758 3300046459 Bacteria 7006
213 Ga0495638_0002448 3300046460 Bacteria 15154
214 Ga0495638_0012180 3300046460 Bacteria 5905
215 Ga0495638_0080389 3300046460 Bacteria 1981
216 Ga0495651_0003859 3300046462 Bacteria 11459
217 Ga0495651_0077418 3300046462 Bacteria 2518
218 Ga0495653_0012646 3300046463 Bacteria 6893
219 Ga0495653_0112876 3300046463 Bacteria 1950
220 Ga0495605_0059837 3300046474 Bacteria 1828
221 Ga0495664_0012701 3300046477 Bacteria 4770
222 Ga0495607_0034767 3300046501 Bacteria 3055
223 Ga0495607_0052280 3300046501 Bacteria 2367
224 Ga0495583_0000005 3300046506 Bacteria 636894
225 Ga0495583_0024799 3300046506 Bacteria 3007
226 Ga0495606_0038168 3300046507 Bacteria 3252
227 Ga0495606_0050128 3300046507 Bacteria 2733
228 Ga0495606_0223318 3300046507 Bacteria 1060
229 Ga0495610_0004965 3300046512 Bacteria 9634
230 Ga0495610_0006292 3300046512 Bacteria 8221
231 Ga0495610_0034356 3300046512 Bacteria 2612
232 Ga0495610_0087465 3300046512 Bacteria 1418
233 Ga0495616_0024028 3300046513 Bacteria 3274
234 Ga0495618_0075727 3300046514 Bacteria 2144
235 Ga0495628_0005397 3300046516 Bacteria 11206
236 Ga0495630_0040029 3300046517 Bacteria 3503
237 Ga0495631_0032170 3300046518 Bacteria 2366
238 Ga0495631_0059712 3300046518 Bacteria 1656
239 Ga0495632_0102922 3300046519 Bacteria 1345
240 Ga0495637_0002272 3300046520 Bacteria 10655
241 Ga0495637_0092879 3300046520 Bacteria 1188
242 Ga0495643_0042492 3300046522 Bacteria 2476
243 Ga0495643_0057919 3300046522 Bacteria 2063
244 Ga0495643_0144402 3300046522 Bacteria 1183
245 Ga0495648_0047463 3300046524 Bacteria 2653
246 Ga0495648_0103540 3300046524 Bacteria 1565
247 Ga0495652_0003519 3300046529 Bacteria 15399
248 Ga0495652_0017024 3300046529 Bacteria 6494
249 Ga0495640_0010505 3300046533 Bacteria 7147
250 Ga0495640_0012541 3300046533 Bacteria 6470
251 Ga0495587_0030956 3300046536 Bacteria 3243
252 Ga0495609_0018660 3300046538 Bacteria 3214
253 Ga0495622_0057341 3300046557 Bacteria 1805
254 Ga0495667_0013972 3300046559 Bacteria 5421
255 Ga0495634_0012519 3300046642 Bacteria 6138
256 Ga0495634_0019109 3300046642 Bacteria 4870
257 Ga0495625_0049941 3300046660 Bacteria 3004
258 Ga0495635_0008082 3300046663 Bacteria 7352
259 Ga0495635_0008097 3300046663 Bacteria 7345
260 Ga0495588_0002090 3300046674 Bacteria 8563
261 Ga0495657_0002707 3300046675 Bacteria 14796
262 Ga0495657_0016628 3300046675 Bacteria 5357
263 Ga0495599_0002636 3300046678 Bacteria 10455
264 Ga0495646_0108570 3300046680 Bacteria 1582
265 Ga0495646_0121163 3300046680 Bacteria 1480
266 Ga0495658_0140461 3300046683 Bacteria 1477
267 Ga0495613_0039833 3300046689 Bacteria 3482
268 Ga0495624_0010916 3300046690 Bacteria 6262
269 Ga0495670_0054581 3300046691 Bacteria 2002
270 Ga0495671_0063888 3300046692 Bacteria 1813
271 Ga0495649_0045703 3300046694 Bacteria 2386
272 Ga0495649_0159650 3300046694 Bacteria 1182
273 Ga0495589_0067650 3300046794 Bacteria 1748
274 Ga0495600_0008222 3300046809 Bacteria 6406
275 Ga0495600_0016359 3300046809 Bacteria 4706
276 Ga0495660_0047414 3300046810 Bacteria 2353
277 Ga0495660_0140843 3300046810 Bacteria 1200
278 Ga0495581_0100888 3300047315 Bacteria 1677
279 Ga0495604_0002138 3300047317 Bacteria 15893
280 Ga0495674_0027876 3300047319 Bacteria 5158
281 Ga0495676_0068430 3300047321 Bacteria 2743
282 Ga0495680_0002914 3300047322 Bacteria 17181
283 Ga0495675_0054491 3300047444 Bacteria 2537
284 Ga0495673_0074918 3300047469 Bacteria 1415
285 Ga0495684_0143540 3300047471 Bacteria 1789
286 Ga0495686_0000927 3300047472 Bacteria 36572
287 Ga0495686_0042163 3300047472 Bacteria 2903
288 Ga0495686_0154650 3300047472 Bacteria 1344
289 Ga0495602_0019051 3300048088 Bacteria 6827
290 Ga0495602_0056943 3300048088 Bacteria 3433
291 Ga0495614_0037946 3300048089 Bacteria 2068
292 Ga0495626_0031459 3300048091 Bacteria 2554
293 Ga0496100_0062503 3300048903 Bacteria 2457
294 Ga0496100_0483986 3300048903 Bacteria 952
295 Ga0496101_0069994 3300048904 Bacteria 2568
296 Ga0496101_0380471 3300048904 Bacteria 1110
297 Ga0496102_0003165 3300048905 Bacteria 13963
298 Ga0496102_0200467 3300048905 Bacteria 1881
299 Ga0496103_0000798 3300048906 Bacteria 23184
300 Ga0496104_0010700 3300048907 Bacteria 8203
301 Ga0496104_0032718 3300048907 Bacteria 4840
302 Ga0496104_0188312 3300048907 Bacteria 1974
303 Ga0496105_0002344 3300048908 Bacteria 13724
304 Ga0496105_0006092 3300048908 Bacteria 9231
305 Ga0496107_0033508 3300048910 Bacteria 3675
306 Ga0496107_0276736 3300048910 Bacteria 1249
307 Ga0496108_0378578 3300048911 Bacteria 1236
308 Ga0496109_0000508 3300048912 Bacteria 33129
309 Ga0496109_0147188 3300048912 Bacteria 2204
310 Ga0496110_0124336 3300048913 Bacteria 2327
311 Ga0496112_0067389 3300048915 Bacteria 3533
312 Ga0496112_0365518 3300048915 Bacteria 1384
313 Ga0496113_0008448 3300048916 Bacteria 6709
314 Ga0496113_0046463 3300048916 Bacteria 3223
315 Ga0496114_0004770 3300048917 Bacteria 10553
316 Ga0496114_0062528 3300048917 Bacteria 3115
317 Ga0496114_0504719 3300048917 Bacteria 1070
318 Ga0496115_0055747 3300048918 Bacteria 3175
319 Ga0496115_0141684 3300048918 Bacteria 1983
320 Ga0496116_0017066 3300048919 Bacteria 5655
321 Ga0496116_0154868 3300048919 Bacteria 1266
322 Ga0496117_0001106 3300048920 Bacteria 40638
323 Ga0496117_0023188 3300048920 Bacteria 4956
324 Ga0496117_0105641 3300048920 Bacteria 1769
325 Ga0496117_0144220 3300048920 Bacteria 1421
326 Ga0496118_0001882 3300048921 Bacteria 29948
327 Ga0496118_0050110 3300048921 Bacteria 3208
328 Ga0496118_0087242 3300048921 Bacteria 2165
329 Ga0496118_0112433 3300048921 Bacteria 1803
330 Ga0496118_0235929 3300048921 Bacteria 1051
331 Ga0496118_0270123 3300048921 Bacteria 953
332 Ga0496119_0000390 3300048922 Bacteria 60662
333 Ga0496119_0011008 3300048922 Bacteria 7543
334 Ga0496119_0016733 3300048922 Bacteria 5559
335 Ga0496119_0021968 3300048922 Bacteria 4587
336 Ga0496119_0073669 3300048922 Bacteria 1991
337 Ga0496119_0097637 3300048922 Bacteria 1655
338 Ga0496120_0002751 3300048923 Bacteria 17157
339 Ga0496120_0024839 3300048923 Bacteria 3729
340 Ga0496120_0036024 3300048923 Bacteria 2950
341 Ga0496120_0041288 3300048923 Bacteria 2704
342 Ga0496121_0001445 3300048924 Bacteria 40101
343 Ga0496121_0013452 3300048924 Bacteria 8786
344 Ga0496121_0021711 3300048924 Bacteria 6274
345 Ga0496121_0038169 3300048924 Bacteria 4258
346 Ga0496122_0000052 3300048925 Bacteria 260977
347 Ga0496122_0000083 3300048925 Bacteria 208744
348 Ga0496122_0011841 3300048925 Bacteria 8767
349 Ga0496122_0015763 3300048925 Bacteria 7202
350 Ga0496122_0040869 3300048925 Bacteria 3677
351 Ga0496122_0078987 3300048925 Bacteria 2302
352 Ga0496123_0000356 3300048926 Bacteria 85832
353 Ga0496123_0017328 3300048926 Bacteria 5801
354 Ga0496123_0018118 3300048926 Bacteria 5624
355 Ga0496123_0018511 3300048926 Bacteria 5536
356 Ga0496123_0066090 3300048926 Bacteria 2293
357 Ga0496124_0000103 3300048927 Bacteria 179162
358 Ga0496124_0000275 3300048927 Bacteria 98848
359 Ga0496124_0045901 3300048927 Bacteria 3744
360 Ga0496124_0051452 3300048927 Bacteria 3505
361 Ga0496124_0209368 3300048927 Unclassified 1476
362 Ga0496125_0006254 3300048928 Bacteria 12944
363 Ga0496125_0006553 3300048928 Bacteria 12544
364 Ga0496125_0006648 3300048928 Bacteria 12444
365 Ga0496125_0027149 3300048928 Bacteria 5197
366 Ga0496125_0045128 3300048928 Bacteria 3715
367 Ga0496125_0264929 3300048928 Bacteria 1074
368 Ga0496126_0000714 3300048929 Bacteria 60351
369 Ga0496126_0005025 3300048929 Bacteria 15396
370 Ga0496126_0032369 3300048929 Bacteria 4927
371 Ga0496126_0037145 3300048929 Bacteria 4548
372 Ga0496126_0080842 3300048929 Bacteria 2875
373 Ga0496126_0222376 3300048929 Bacteria 1585
374 Ga0496126_0228617 3300048929 Bacteria 1559
375 Ga0495682_0024319 3300049460 Bacteria 2259
376 Ga0501034_0016035 3300049571 Bacteria 7689
377 Ga0501036_0023053 3300049572 Bacteria 5240
378 Ga0501037_0040742 3300049573 Bacteria 3417
379 Ga0501043_0171459 3300049579 Bacteria 1693
380 Ga0501074_0112068 3300049590 Bacteria 1952
381 Ga0501080_0362611 3300049742 Bacteria 1307
382 Ga0501083_0096334 3300049744 Bacteria 1952
383 Ga0501035_0052945 3300049822 Bacteria 3631
384 Ga0501044_0112740 3300049823 Bacteria 2726
385 nmdc:mga0yw44_10624_c1 3300050492 Bacteria 4713
386 nmdc:mga0yw44_229240_c1 3300050492 Bacteria 1233
387 nmdc:mga0yw44_61263_c1 3300050492 Bacteria 2308
388 nmdc:mga0k408_42972_c1 3300050493 Bacteria 2603
389 nmdc:mga06z11_151926_c1 3300050494 Bacteria 1317
390 nmdc:mga0sz30_11997_c1 3300050516 Bacteria 3363
391 nmdc:mga0sz30_6095_c1 3300050516 Bacteria 4462
392 Ga0495619_0068128 3300053085 Bacteria 2377
393 Ga0500578_0097865 3300053086 Bacteria 1859
394 Ga0500578_0120254 3300053086 Bacteria 1651
395 Ga0500643_000210 3300053087 Bacteria 55059
396 Ga0500643_025217 3300053087 Bacteria 1878
397 Ga0500583_0035872 3300053092 Bacteria 2216
398 Ga0500651_0069067 3300053093 Bacteria 2200
399 Ga0500566_0000908 3300053094 Bacteria 16964
400 Ga0500641_0047442 3300053096 Bacteria 1756
401 Ga0500650_0059483 3300053098 Bacteria 1782
402 Ga0500556_0000003 3300053104 Bacteria 679379
403 Ga0500556_0004785 3300053104 Bacteria 3840
404 Ga0500557_000196 3300053105 Bacteria 10188
405 Ga0500569_000222 3300053109 Bacteria 8979
406 Ga0500592_008187 3300053116 Bacteria 1658
407 Ga0500592_008709 3300053116 Bacteria 1611
408 Ga0500595_017041 3300053119 Bacteria 2693
409 Ga0500607_047181 3300053121 Bacteria 2306
410 Ga0500608_063314 3300053122 Bacteria 1765
411 Ga0500618_001689 3300053125 Bacteria 9444
412 Ga0500642_0000006 3300053130 Bacteria 350064
413 Ga0500642_0000053 3300053130 Bacteria 71632
414 Ga0500652_000246 3300053131 Bacteria 20456
415 Ga0500658_0033992 3300053134 Bacteria 2009
416 Ga0500559_0000070 3300053136 Bacteria 82088
417 Ga0500559_0051750 3300053136 Bacteria 1814
418 Ga0500564_056771 3300053138 Bacteria 1782
419 Ga0500568_0015646 3300053139 Bacteria 3392
420 Ga0500568_0015709 3300053139 Bacteria 3383
421 Ga0500568_0017652 3300053139 Bacteria 3145
422 Ga0500588_0011002 3300053146 Bacteria 2203
423 Ga0500604_0004943 3300053151 Bacteria 3531
424 Ga0500616_0000033 3300053153 Bacteria 398830
425 Ga0500616_0001333 3300053153 Bacteria 24248
426 Ga0500619_027757 3300053154 Bacteria 1698
427 Ga0500622_0001247 3300053156 Bacteria 20806
428 Ga0500622_0006253 3300053156 Bacteria 6958
429 Ga0500627_0046376 3300053158 Bacteria 1883
430 Ga0500633_0011052 3300053160 Bacteria 2441
431 Ga0500633_0022743 3300053160 Bacteria 1925
432 Ga0500636_0000033 3300053177 Bacteria 72990
433 Ga0500636_0114660 3300053177 Bacteria 1518
434 Ga0500645_022574 3300053730 Bacteria 1934
435 Ga0500645_036797 3300053730 Bacteria 1455
436 Ga0500596_015515 3300053735 Bacteria 1144
437 Ga0500601_000019 3300053737 Bacteria 39361
438 Ga0501082_0195057 3300060353 Bacteria 1762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0378578 Ga0496108_0378578_167_1084 252
2 3300048929 Ga0496126_0080842 Ga0496126_0080842_47_889 259
3 3300013104 Ga0157370_10000047 Ga0157370_100000477 261
4 3300006186 Ga0075369_10007846 Ga0075369_100078465 270
5 3300053104 Ga0500556_0004785 Ga0500556_0004785_29_877 270
6 3300048903 Ga0496100_0483986 Ga0496100_0483986_30_875 271
7 3300048921 Ga0496118_0270123 Ga0496118_0270123_97_942 271
8 3300050493 nmdc:mga0k408_42972_c1 nmdc:mga0k408_42972_c1_16_861 271
9 3300041451 Ga0451791_0554500 Ga0451791_0554500_850_1767 275
10 3300003215 JGI25153J46596_10003292 JGI25153J46596_1000329213 277
11 3300025297 Ga0209758_1000204 Ga0209758_100020453 277
12 3300046507 Ga0495606_0050128 Ga0495606_0050128_1252_2226 280
13 iso_pu_bacteria 2935777560 2935779860 280
14 3300013105 Ga0157369_10334213 Ga0157369_103342132 282
15 3300003354 JGI25160J50197_1000710 JGI25160J50197_10007108 284
16 3300003781 Ga0055536_1000589 Ga0055536_100058921 284
17 3300025292 Ga0209676_1000077 Ga0209676_100007764 284
18 3300025298 Ga0209050_1003670 Ga0209050_10036708 284
19 3300025933 Ga0207706_10063900 Ga0207706_100639003 284
20 3300041503 Ga0451847_0212185 Ga0451847_0212185_28_912 284
21 3300050492 nmdc:mga0yw44_229240_c1 nmdc:mga0yw44_229240_c1_22_906 284
22 iso_pu_bacteria 8016511872 8016518952 284
23 3300002987 JGI25159J45721_1001176 JGI25159J45721_10011764 285
24 3300041453 Ga0451797_0446528 Ga0451797_0446528_212_1150 285
25 3300046507 Ga0495606_0038168 Ga0495606_0038168_1744_2676 285
26 3300048921 Ga0496118_0112433 Ga0496118_0112433_828_1760 285
27 3300048923 Ga0496120_0036024 Ga0496120_0036024_177_1109 285
28 3300048924 Ga0496121_0038169 Ga0496121_0038169_1313_2245 285
29 3300001989 JGI24739J22299_10000502 JGI24739J22299_1000050216 286
30 3300002067 JGI24735J21928_10007019 JGI24735J21928_100070192 286
31 3300013102 Ga0157371_10006165 Ga0157371_1000616511 286
32 3300032004 Ga0307414_10022395 Ga0307414_100223952 286
33 3300005985 Ga0081539_10011424 Ga0081539_100114246 287
34 3300003354 JGI25160J50197_1000012 JGI25160J50197_100001226 290
35 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002178 290
36 3300004625 Ga0055543_1000050 Ga0055543_100005072 290
37 3300005262 Ga0065165_1000031 Ga0065165_1000031191 290
38 3300025284 Ga0209130_1000028 Ga0209130_1000028271 290
39 3300025302 Ga0207426_1000012 Ga0207426_1000012311 290
40 3300046501 Ga0495607_0052280 Ga0495607_0052280_128_1030 290
41 3300046506 Ga0495583_0024799 Ga0495583_0024799_1490_2392 290
42 3300046507 Ga0495606_0223318 Ga0495606_0223318_41_943 290
43 3300046513 Ga0495616_0024028 Ga0495616_0024028_1283_2185 290
44 3300046518 Ga0495631_0032170 Ga0495631_0032170_368_1270 290
45 3300046519 Ga0495632_0102922 Ga0495632_0102922_28_930 290
46 3300046520 Ga0495637_0092879 Ga0495637_0092879_155_1057 290
47 3300046524 Ga0495648_0103540 Ga0495648_0103540_240_1142 290
48 3300046691 Ga0495670_0054581 Ga0495670_0054581_839_1741 290
49 3300046810 Ga0495660_0140843 Ga0495660_0140843_132_1034 290
50 3300048920 Ga0496117_0105641 Ga0496117_0105641_786_1688 290
51 3300048921 Ga0496118_0050110 Ga0496118_0050110_19_921 290
52 3300050492 nmdc:mga0yw44_10624_c1 nmdc:mga0yw44_10624_c1_3104_4006 290
53 3300053087 Ga0500643_025217 Ga0500643_025217_506_1426 290
54 3300053093 Ga0500651_0069067 Ga0500651_0069067_396_1298 290
55 3300053096 Ga0500641_0047442 Ga0500641_0047442_218_1120 290
56 3300053104 Ga0500556_0000003 Ga0500556_0000003_268482_269384 290
57 3300053116 Ga0500592_008709 Ga0500592_008709_537_1439 290
58 3300053130 Ga0500642_0000006 Ga0500642_0000006_228834_229736 290
59 3300053154 Ga0500619_027757 Ga0500619_027757_698_1600 290
60 3300053160 Ga0500633_0022743 Ga0500633_0022743_868_1770 290
61 3300053136 Ga0500559_0000070 Ga0500559_0000070_37737_38678 291
62 3300053146 Ga0500588_0011002 Ga0500588_0011002_574_1473 291
63 iso_pu_bacteria 2643221690 2644505849 291
64 iso_pu_bacteria 2643221694 2644524322 291
65 iso_pu_bacteria 2643221722 2644668422 291
66 3300005347 Ga0070668_100021426 Ga0070668_1000214265 294
67 3300025972 Ga0207668_10040392 Ga0207668_100403922 294
68 3300041999 Ga0439433_0009951 Ga0439433_0009951_1075_2031 294
69 3300042007 Ga0439449_0007155 Ga0439449_0007155_1058_2014 294
70 3300005337 Ga0070682_100071060 Ga0070682_1000710602 295
71 3300013308 Ga0157375_10454514 Ga0157375_104545142 295
72 3300017792 Ga0163161_10373815 Ga0163161_103738152 295
73 3300048905 Ga0496102_0200467 Ga0496102_0200467_210_1160 295
74 3300048913 Ga0496110_0124336 Ga0496110_0124336_12_962 295
75 3300048917 Ga0496114_0504719 Ga0496114_0504719_135_1052 295
76 3300048924 Ga0496121_0021711 Ga0496121_0021711_5141_6067 296
77 3300048925 Ga0496122_0078987 Ga0496122_0078987_138_1064 296
78 3300048927 Ga0496124_0000103 Ga0496124_0000103_109980_110906 296
79 iso_pu_bacteria 2516653077 2517042700 296
80 iso_pu_bacteria 2643221579 2643908415 296
81 iso_pu_bacteria 2643221581 2643913866 296
82 iso_pu_bacteria 2839993093 2839996806 296
83 iso_pu_bacteria 2839993093 2839996807 296
84 iso_pu_bacteria 2919534386 2919537298 296
85 iso_pu_bacteria 2964698721 2964702121 296
86 iso_pu_bacteria 8054844752 8054849120 296
87 iso_pu_bacteria 2857524615 2857525236 297
88 iso_pu_bacteria 2919073203 2919075102 297
89 iso_pu_bacteria 2919073203 2919075148 297
90 3300049579 Ga0501043_0171459 Ga0501043_0171459_15_959 298
91 iso_pu_bacteria 2508501009 2508545994 298
92 iso_pu_bacteria 2508501042 2508694844 298
93 iso_pu_bacteria 2511231028 2511393381 298
94 iso_pu_bacteria 2513237092 2513628426 298
95 iso_pu_bacteria 2513237094 2513638436 298
96 iso_pu_bacteria 2513237095 2513649336 298
97 iso_pu_bacteria 2513237098 2513674166 298
98 iso_pu_bacteria 2513237102 2513699363 298
99 iso_pu_bacteria 2513237104 2513714745 298
100 iso_pu_bacteria 2513237139 2513875546 298
101 iso_pu_bacteria 2513237161 2514011067 298
102 iso_pu_bacteria 2517093001 2517102943 298
103 iso_pu_bacteria 2524023205 2524438745 298
104 iso_pu_bacteria 2524023228 2524535560 298
105 iso_pu_bacteria 2528768022 2528854467 298
106 iso_pu_bacteria 2617270735 2617347610 298
107 iso_pu_bacteria 2744054633 2745080444 298
108 iso_pu_bacteria 2791355196 2793063590 298
109 iso_pu_bacteria 2802429603 2805921099 298
110 iso_pu_bacteria 2816332527 2818240726 298
111 iso_pu_bacteria 2824617872 2824619522 298
112 iso_pu_bacteria 2824626560 2824627977 298
113 iso_pu_bacteria 2824635225 2824635979 298
114 iso_pu_bacteria 2824644064 2824646269 298
115 iso_pu_bacteria 2824661429 2824669864 298
116 iso_pu_bacteria 2824671348 2824677709 298
117 iso_pu_bacteria 2824687955 2824694071 298
118 iso_pu_bacteria 2824696289 2824703318 298
119 iso_pu_bacteria 2824704595 2824713089 298
120 iso_pu_bacteria 2824714736 2824719755 298
121 iso_pu_bacteria 2824723954 2824727579 298
122 iso_pu_bacteria 2824753945 2824760892 298
123 iso_pu_bacteria 2824763712 2824767657 298
124 iso_pu_bacteria 2824773399 2824777048 298
125 iso_pu_bacteria 2838122688 2838129203 298
126 iso_pu_bacteria 2841941048 2841944158 298
127 iso_pu_bacteria 2841949485 2841954656 298
128 iso_pu_bacteria 2841957949 2841963085 298
129 iso_pu_bacteria 2841966195 2841968951 298
130 iso_pu_bacteria 2841974524 2841979679 298
131 iso_pu_bacteria 2841983080 2841989679 298
132 iso_pu_bacteria 2842038055 2842044193 298
133 iso_pu_bacteria 2842045827 2842051818 298
134 iso_pu_bacteria 2847939898 2847941445 298
135 iso_pu_bacteria 2857509624 2857514938 298
136 iso_pu_bacteria 2874612657 2874620047 298
137 iso_pu_bacteria 2874628541 2874629472 298
138 iso_pu_bacteria 2876761206 2876765864 298
139 iso_pu_bacteria 2879099564 2879103095 298
140 iso_pu_bacteria 2881364244 2881369787 298
141 iso_pu_bacteria 2888378607 2888380306 298
142 iso_pu_bacteria 2903768456 2903773517 298
143 iso_pu_bacteria 2904699407 2904707930 298
144 iso_pu_bacteria 2904711408 2904719991 298
145 iso_pu_bacteria 2922368715 2922369856 298
146 iso_pu_bacteria 2929615660 2929622803 298
147 iso_pu_bacteria 2929624759 2929632093 298
148 iso_pu_bacteria 2932784394 2932789889 298
149 iso_pu_bacteria 2932794094 2932796175 298
150 iso_pu_bacteria 2932801729 2932807750 298
151 iso_pu_bacteria 2932809354 2932815432 298
152 iso_pu_bacteria 2932818245 2932825129 298
153 iso_pu_bacteria 2932828146 2932829255 298
154 iso_pu_bacteria 2933577622 2933584565 298
155 iso_pu_bacteria 2935608549 2935614236 298
156 iso_pu_bacteria 2935616580 2935617730 298
157 iso_pu_bacteria 2935638405 2935643775 298
158 iso_pu_bacteria 2935648319 2935651398 298
159 iso_pu_bacteria 2935656913 2935659834 298
160 iso_pu_bacteria 2935665750 2935670915 298
161 iso_pu_bacteria 2935675223 2935681555 298
162 iso_pu_bacteria 2935694250 2935699233 298
163 iso_pu_bacteria 2935703347 2935710057 298
164 iso_pu_bacteria 2935760218 2935767813 298
165 iso_pu_bacteria 2935769743 2935774948 298
166 iso_pu_bacteria 2935785616 2935792134 298
167 iso_pu_bacteria 2935793552 2935798697 298
168 iso_pu_bacteria 2935801545 2935806779 298
169 iso_pu_bacteria 2935810662 2935817942 298
170 iso_pu_bacteria 2935819856 2935826487 298
171 iso_pu_bacteria 2935827899 2935834460 298
172 iso_pu_bacteria 2935837841 2935843815 298
173 iso_pu_bacteria 2935847175 2935851277 298
174 iso_pu_bacteria 2935855204 2935856771 298
175 iso_pu_bacteria 2935864058 2935868298 298
176 iso_pu_bacteria 2935873716 2935879608 298
177 iso_pu_bacteria 2935883170 2935887458 298
178 iso_pu_bacteria 2935908558 2935913266 298
179 iso_pu_bacteria 2935916978 2935922688 298
180 iso_pu_bacteria 2935926038 2935930809 298
181 iso_pu_bacteria 2935934488 2935939857 298
182 iso_pu_bacteria 2935942939 2935946806 298
183 iso_pu_bacteria 2935951376 2935955993 298
184 iso_pu_bacteria 2935959822 2935966276 298
185 iso_pu_bacteria 2935967501 2935972786 298
186 iso_pu_bacteria 2935984226 2935984472 298
187 iso_pu_bacteria 2935992306 2935997114 298
188 iso_pu_bacteria 2936002035 2936009774 298
189 iso_pu_bacteria 2936011229 2936014250 298
190 iso_pu_bacteria 2936019824 2936022841 298
191 iso_pu_bacteria 2936028420 2936030978 298
192 iso_pu_bacteria 2936037263 2936044660 298
193 iso_pu_bacteria 2936046547 2936049099 298
194 iso_pu_bacteria 2936055302 2936055545 298
195 iso_pu_bacteria 2941531003 2941534840 298
196 iso_pu_bacteria 2941538514 2941545063 298
197 iso_pu_bacteria 3005506211 3005510723 298
198 iso_pu_bacteria 3005710791 3005711711 298
199 iso_pu_bacteria 8016522445 8016525470 298
200 iso_pu_bacteria 8016530956 8016539062 298
201 iso_pu_bacteria 8016539877 8016543347 298
202 iso_pu_bacteria 8016548790 8016549948 298
203 iso_pu_bacteria 8016557553 8016558359 298
204 iso_pu_bacteria 8016566248 8016568754 298
205 iso_pu_bacteria 8016575299 8016581401 298
206 iso_pu_bacteria 8016595262 8016596353 298
207 iso_pu_bacteria 8016603502 8016607217 298
208 iso_pu_bacteria 8016613128 8016619121 298
209 iso_pu_bacteria 8016622563 8016630468 298
210 iso_pu_bacteria 8016630954 8016636613 298
211 iso_pu_bacteria 8017057580 8017057739 298
212 iso_pu_bacteria 8019530166 8019538727 298
213 iso_pu_bacteria 8019547302 8019549414 298
214 iso_pu_bacteria 8019576017 8019578043 298
215 iso_pu_bacteria 8019586578 8019596099 298
216 iso_pu_bacteria 8019608314 8019612917 298
217 iso_pu_bacteria 8019687851 8019693378 298
218 iso_pu_bacteria 8055742211 8055750687 298
219 3300005347 Ga0070668_100058465 Ga0070668_1000584652 299
220 3300025972 Ga0207668_10045134 Ga0207668_100451342 299
221 3300002773 JGI25152J39213_1002258 JGI25152J39213_10022589 300
222 3300002774 JGI25150J39212_1000241 JGI25150J39212_100024111 300
223 3300002774 JGI25150J39212_1014960 JGI25150J39212_10149602 300
224 3300003187 JGI25151J46595_10024703 JGI25151J46595_100247031 300
225 3300003215 JGI25153J46596_10000109 JGI25153J46596_1000010960 300
226 3300003215 JGI25153J46596_10000537 JGI25153J46596_1000053713 300
227 3300003323 rootH1_10015310 rootH1_100153104 300
228 3300003323 rootH1_10137524 rootH1_101375242 300
229 3300003323 rootH1_10243827 rootH1_102438272 300
230 3300003771 Ga0055526_1000296 Ga0055526_100029620 300
231 3300003781 Ga0055536_1000156 Ga0055536_100015644 300
232 3300003791 Ga0055530_10007197 Ga0055530_100071974 300
233 3300003794 Ga0055531_10000121 Ga0055531_1000012120 300
234 3300005289 Ga0065704_10070468 Ga0065704_1007046810 300
235 3300005347 Ga0070668_100018562 Ga0070668_1000185625 300
236 3300005353 Ga0070669_100003350 Ga0070669_1000033504 300
237 3300005367 Ga0070667_100033469 Ga0070667_1000334694 300
238 3300005548 Ga0070665_100115642 Ga0070665_1001156421 300
239 3300005842 Ga0068858_100063033 Ga0068858_1000630335 300
240 3300005843 Ga0068860_100052672 Ga0068860_1000526722 300
241 3300005844 Ga0068862_100015997 Ga0068862_1000159972 300
242 3300006946 Ga0079104_1000854 Ga0079104_100085427 300
243 3300009011 Ga0105251_10001532 Ga0105251_1000153222 300
244 3300009036 Ga0105244_10012308 Ga0105244_100123084 300
245 3300009092 Ga0105250_10001426 Ga0105250_100014261 300
246 3300009093 Ga0105240_10170754 Ga0105240_101707542 300
247 3300009101 Ga0105247_10043660 Ga0105247_100436602 300
248 3300009177 Ga0105248_10079853 Ga0105248_100798532 300
249 3300013306 Ga0163162_10012396 Ga0163162_100123965 300
250 3300021320 Ga0214544_1000035 Ga0214544_100003577 300
251 3300021321 Ga0214542_1000181 Ga0214542_100018181 300
252 3300021324 Ga0214545_1000094 Ga0214545_100009417 300
253 3300021327 Ga0214543_1000155 Ga0214543_100015517 300
254 3300025245 Ga0207425_1000073 Ga0207425_100007346 300
255 3300025245 Ga0207425_1000259 Ga0207425_100025921 300
256 3300025258 Ga0209129_1000175 Ga0209129_100017537 300
257 3300025258 Ga0209129_1000352 Ga0209129_100035225 300
258 3300025273 Ga0209673_1010157 Ga0209673_10101574 300
259 3300025292 Ga0209676_1000031 Ga0209676_1000031320 300
260 3300025294 Ga0209025_1000202 Ga0209025_100020251 300
261 3300025295 Ga0209564_1000136 Ga0209564_1000136129 300
262 3300025297 Ga0209758_1000242 Ga0209758_100024246 300
263 3300025297 Ga0209758_1000275 Ga0209758_100027578 300
264 3300025298 Ga0209050_1000135 Ga0209050_1000135126 300
265 3300025299 Ga0209256_1020302 Ga0209256_10203023 300
266 3300025304 Ga0209257_1000050 Ga0209257_1000050110 300
267 3300025304 Ga0209257_1042618 Ga0209257_10426182 300
268 3300025711 Ga0207696_1000429 Ga0207696_100042916 300
269 3300025728 Ga0207655_1038177 Ga0207655_10381772 300
270 3300025735 Ga0207713_1000871 Ga0207713_100087135 300
271 3300025913 Ga0207695_10139490 Ga0207695_101394902 300
272 3300025923 Ga0207681_10003105 Ga0207681_1000310514 300
273 3300025931 Ga0207644_10030813 Ga0207644_100308133 300
274 3300025941 Ga0207711_10253800 Ga0207711_102538001 300
275 3300027111 Ga0209281_1000355 Ga0209281_100035548 300
276 3300028380 Ga0268265_10057404 Ga0268265_100574042 300
277 3300032004 Ga0307414_10206532 Ga0307414_102065322 300
278 3300041997 Ga0439431_0004808 Ga0439431_0004808_1858_2811 300
279 3300042115 Ga0450911_000015 Ga0450911_000015_44319_45272 300
280 3300046460 Ga0495638_0080389 Ga0495638_0080389_1014_1928 300
281 3300048903 Ga0496100_0062503 Ga0496100_0062503_201_1115 300
282 3300048904 Ga0496101_0380471 Ga0496101_0380471_80_994 300
283 3300048905 Ga0496102_0003165 Ga0496102_0003165_10597_11511 300
284 3300048906 Ga0496103_0000798 Ga0496103_0000798_2311_3225 300
285 3300048907 Ga0496104_0188312 Ga0496104_0188312_80_994 300
286 3300048908 Ga0496105_0002344 Ga0496105_0002344_80_994 300
287 3300048910 Ga0496107_0276736 Ga0496107_0276736_184_1098 300
288 3300048912 Ga0496109_0000508 Ga0496109_0000508_13966_14922 300
289 3300048915 Ga0496112_0067389 Ga0496112_0067389_2416_3330 300
290 3300048916 Ga0496113_0008448 Ga0496113_0008448_326_1240 300
291 3300048917 Ga0496114_0004770 Ga0496114_0004770_2732_3751 300
292 3300048919 Ga0496116_0154868 Ga0496116_0154868_268_1182 300
293 3300048920 Ga0496117_0001106 Ga0496117_0001106_9894_10808 300
294 3300048921 Ga0496118_0001882 Ga0496118_0001882_19141_20055 300
295 3300048922 Ga0496119_0000390 Ga0496119_0000390_24468_25493 300
296 3300048922 Ga0496119_0021968 Ga0496119_0021968_81_995 300
297 3300048923 Ga0496120_0002751 Ga0496120_0002751_809_1723 300
298 3300048924 Ga0496121_0001445 Ga0496121_0001445_26351_27265 300
299 3300048925 Ga0496122_0000083 Ga0496122_0000083_13395_14336 300
300 3300048925 Ga0496122_0040869 Ga0496122_0040869_81_995 300
301 3300048926 Ga0496123_0000356 Ga0496123_0000356_71488_72429 300
302 3300048926 Ga0496123_0017328 Ga0496123_0017328_4807_5721 300
303 3300048926 Ga0496123_0018511 Ga0496123_0018511_4455_5495 300
304 3300048927 Ga0496124_0000275 Ga0496124_0000275_95409_96323 300
305 3300048927 Ga0496124_0209368 Ga0496124_0209368_101_1015 300
306 3300048928 Ga0496125_0006254 Ga0496125_0006254_3738_4706 300
307 3300048928 Ga0496125_0264929 Ga0496125_0264929_81_995 300
308 3300048929 Ga0496126_0005025 Ga0496126_0005025_1547_2461 300
309 3300048929 Ga0496126_0037145 Ga0496126_0037145_1049_2068 300
310 3300053730 Ga0500645_036797 Ga0500645_036797_42_1094 300
311 3300003320 rootH2_10126306 rootH2_101263063 301
312 3300005548 Ga0070665_100241704 Ga0070665_1002417041 301
313 3300013105 Ga0157369_10040020 Ga0157369_100400204 301
314 3300026067 Ga0207678_10009555 Ga0207678_1000955510 301
315 3300031911 Ga0307412_10048726 Ga0307412_100487263 301
316 3300046506 Ga0495583_0000005 Ga0495583_0000005_343689_344609 301
317 3300046512 Ga0495610_0034356 Ga0495610_0034356_1579_2514 301
318 3300046522 Ga0495643_0057919 Ga0495643_0057919_250_1185 301
319 3300046660 Ga0495625_0049941 Ga0495625_0049941_1891_2826 301
320 3300047472 Ga0495686_0000927 Ga0495686_0000927_32289_33212 301
321 3300047472 Ga0495686_0042163 Ga0495686_0042163_1228_2148 301
322 3300048922 Ga0496119_0073669 Ga0496119_0073669_943_1878 301
323 3300048923 Ga0496120_0041288 Ga0496120_0041288_604_1539 301
324 3300048924 Ga0496121_0013452 Ga0496121_0013452_1653_2588 301
325 3300048925 Ga0496122_0000052 Ga0496122_0000052_151178_152098 301
326 3300048926 Ga0496123_0018118 Ga0496123_0018118_4023_4943 301
327 3300048926 Ga0496123_0066090 Ga0496123_0066090_854_1789 301
328 3300048928 Ga0496125_0006648 Ga0496125_0006648_11395_12330 301
329 3300048929 Ga0496126_0000714 Ga0496126_0000714_47514_48434 301
330 3300053098 Ga0500650_0059483 Ga0500650_0059483_752_1687 301
331 3300053131 Ga0500652_000246 Ga0500652_000246_14386_15321 301
332 3300053139 Ga0500568_0015709 Ga0500568_0015709_2310_3245 301
333 3300053151 Ga0500604_0004943 Ga0500604_0004943_1982_2917 301
334 3300053153 Ga0500616_0000033 Ga0500616_0000033_260272_261207 301
335 3300053156 Ga0500622_0006253 Ga0500622_0006253_4956_5891 301
336 3300053158 Ga0500627_0046376 Ga0500627_0046376_802_1737 301
337 3300053730 Ga0500645_022574 Ga0500645_022574_534_1469 301
338 iso_pu_bacteria 2857542790 2857543504 301
339 iso_pu_bacteria 2971511577 2971514925 301
340 iso_pu_bacteria 2980176882 2980181031 301
341 3300003215 JGI25153J46596_10003243 JGI25153J46596_100032435 302
342 3300004625 Ga0055543_1008572 Ga0055543_10085722 302
343 3300005262 Ga0065165_1002114 Ga0065165_100211414 302
344 3300005262 Ga0065165_1008083 Ga0065165_10080832 302
345 3300005262 Ga0065165_1011141 Ga0065165_10111412 302
346 3300005331 Ga0070670_100272870 Ga0070670_1002728702 302
347 3300005347 Ga0070668_100056220 Ga0070668_1000562203 302
348 3300005353 Ga0070669_100191691 Ga0070669_1001916912 302
349 3300005355 Ga0070671_100068814 Ga0070671_1000688143 302
350 3300005366 Ga0070659_100102349 Ga0070659_1001023492 302
351 3300005455 Ga0070663_100183497 Ga0070663_1001834971 302
352 3300005457 Ga0070662_100097175 Ga0070662_1000971753 302
353 3300005539 Ga0068853_100008604 Ga0068853_1000086049 302
354 3300005548 Ga0070665_100019197 Ga0070665_1000191977 302
355 3300005548 Ga0070665_100084075 Ga0070665_1000840753 302
356 3300005577 Ga0068857_100195220 Ga0068857_1001952202 302
357 3300005614 Ga0068856_100050482 Ga0068856_1000504824 302
358 3300005617 Ga0068859_100262922 Ga0068859_1002629222 302
359 3300005618 Ga0068864_100149604 Ga0068864_1001496042 302
360 3300005841 Ga0068863_100115597 Ga0068863_1001155973 302
361 3300005844 Ga0068862_100322337 Ga0068862_1003223372 302
362 3300006038 Ga0075365_10035412 Ga0075365_100354122 302
363 3300006178 Ga0075367_10087745 Ga0075367_100877452 302
364 3300006195 Ga0075366_10030959 Ga0075366_100309594 302
365 3300006353 Ga0075370_10022209 Ga0075370_100222093 302
366 3300006931 Ga0097620_100262926 Ga0097620_1002629262 302
367 3300009093 Ga0105240_10117017 Ga0105240_101170172 302
368 3300009101 Ga0105247_10321951 Ga0105247_103219512 302
369 3300009148 Ga0105243_10347303 Ga0105243_103473032 302
370 3300009545 Ga0105237_10072073 Ga0105237_100720732 302
371 3300009551 Ga0105238_10258438 Ga0105238_102584382 302
372 3300010375 Ga0105239_10106945 Ga0105239_101069454 302
373 3300010375 Ga0105239_10392291 Ga0105239_103922912 302
374 3300011119 Ga0105246_10063489 Ga0105246_100634892 302
375 3300013296 Ga0157374_10147019 Ga0157374_101470192 302
376 3300014325 Ga0163163_10295119 Ga0163163_102951192 302
377 3300014497 Ga0182008_10068428 Ga0182008_100684281 302
378 3300014968 Ga0157379_10355190 Ga0157379_103551902 302
379 3300014969 Ga0157376_10151933 Ga0157376_101519332 302
380 3300017792 Ga0163161_10167808 Ga0163161_101678082 302
381 3300025230 Ga0209563_102659 Ga0209563_1026593 302
382 3300025253 Ga0209677_103672 Ga0209677_1036727 302
383 3300025261 Ga0209233_1001584 Ga0209233_100158413 302
384 3300025295 Ga0209564_1006671 Ga0209564_10066716 302
385 3300025295 Ga0209564_1014286 Ga0209564_10142863 302
386 3300025297 Ga0209758_1000015 Ga0209758_1000015619 302
387 3300025297 Ga0209758_1000673 Ga0209758_100067322 302
388 3300025297 Ga0209758_1002531 Ga0209758_100253111 302
389 3300025299 Ga0209256_1004503 Ga0209256_10045037 302
390 3300025302 Ga0207426_1000186 Ga0207426_1000186145 302
391 3300025302 Ga0207426_1001117 Ga0207426_10011174 302
392 3300025302 Ga0207426_1021435 Ga0207426_10214352 302
393 3300025304 Ga0209257_1004161 Ga0209257_10041618 302
394 3300025304 Ga0209257_1008991 Ga0209257_10089917 302
395 3300025304 Ga0209257_1012222 Ga0209257_10122223 302
396 3300025935 Ga0207709_10197497 Ga0207709_101974972 302
397 3300025942 Ga0207689_10125040 Ga0207689_101250402 302
398 3300025972 Ga0207668_10285446 Ga0207668_102854461 302
399 3300026035 Ga0207703_10349427 Ga0207703_103494272 302
400 3300026041 Ga0207639_10005861 Ga0207639_100058619 302
401 3300026067 Ga0207678_10019372 Ga0207678_100193723 302
402 3300026067 Ga0207678_10035091 Ga0207678_100350912 302
403 3300026095 Ga0207676_10169291 Ga0207676_101692912 302
404 3300026118 Ga0207675_100152879 Ga0207675_1001528793 302
405 3300031456 Ga0307513_10002605 Ga0307513_1000260518 302
406 3300033180 Ga0307510_10002425 Ga0307510_100024252 302
407 3300033180 Ga0307510_10081042 Ga0307510_100810423 302
408 3300033180 Ga0307510_10231048 Ga0307510_102310481 302
409 3300037471 Ga0395905_0182004 Ga0395905_0182004_530_1468 302
410 3300041413 Ga0439465_0000160 Ga0439465_0000160_952_1878 302
411 3300041509 Ga0451843_0875056 Ga0451843_0875056_682_1698 302
412 3300046454 Ga0495592_0004233 Ga0495592_0004233_251_1189 302
413 3300046455 Ga0495603_0060885 Ga0495603_0060885_473_1411 302
414 3300046459 Ga0495629_0009758 Ga0495629_0009758_5164_6102 302
415 3300046460 Ga0495638_0002448 Ga0495638_0002448_13633_14571 302
416 3300046460 Ga0495638_0012180 Ga0495638_0012180_37_1053 302
417 3300046462 Ga0495651_0003859 Ga0495651_0003859_5512_6450 302
418 3300046462 Ga0495651_0077418 Ga0495651_0077418_886_1824 302
419 3300046463 Ga0495653_0012646 Ga0495653_0012646_3762_4700 302
420 3300046463 Ga0495653_0112876 Ga0495653_0112876_189_1127 302
421 3300046474 Ga0495605_0059837 Ga0495605_0059837_495_1433 302
422 3300046477 Ga0495664_0012701 Ga0495664_0012701_3584_4522 302
423 3300046512 Ga0495610_0006292 Ga0495610_0006292_5327_6277 302
424 3300046512 Ga0495610_0087465 Ga0495610_0087465_97_1035 302
425 3300046514 Ga0495618_0075727 Ga0495618_0075727_976_1914 302
426 3300046516 Ga0495628_0005397 Ga0495628_0005397_5759_6697 302
427 3300046517 Ga0495630_0040029 Ga0495630_0040029_612_1550 302
428 3300046518 Ga0495631_0059712 Ga0495631_0059712_353_1291 302
429 3300046520 Ga0495637_0002272 Ga0495637_0002272_3178_4110 302
430 3300046522 Ga0495643_0144402 Ga0495643_0144402_75_1013 302
431 3300046524 Ga0495648_0047463 Ga0495648_0047463_891_1829 302
432 3300046529 Ga0495652_0003519 Ga0495652_0003519_4422_5360 302
433 3300046529 Ga0495652_0017024 Ga0495652_0017024_1487_2425 302
434 3300046533 Ga0495640_0010505 Ga0495640_0010505_2280_3218 302
435 3300046533 Ga0495640_0012541 Ga0495640_0012541_2512_3450 302
436 3300046536 Ga0495587_0030956 Ga0495587_0030956_1260_2198 302
437 3300046538 Ga0495609_0018660 Ga0495609_0018660_20_958 302
438 3300046557 Ga0495622_0057341 Ga0495622_0057341_691_1629 302
439 3300046559 Ga0495667_0013972 Ga0495667_0013972_1175_2113 302
440 3300046642 Ga0495634_0012519 Ga0495634_0012519_3132_4070 302
441 3300046642 Ga0495634_0019109 Ga0495634_0019109_1439_2377 302
442 3300046663 Ga0495635_0008082 Ga0495635_0008082_3512_4450 302
443 3300046663 Ga0495635_0008097 Ga0495635_0008097_3124_4062 302
444 3300046674 Ga0495588_0002090 Ga0495588_0002090_1142_2080 302
445 3300046675 Ga0495657_0002707 Ga0495657_0002707_9556_10494 302
446 3300046675 Ga0495657_0016628 Ga0495657_0016628_3133_4071 302
447 3300046678 Ga0495599_0002636 Ga0495599_0002636_1225_2163 302
448 3300046680 Ga0495646_0108570 Ga0495646_0108570_16_954 302
449 3300046680 Ga0495646_0121163 Ga0495646_0121163_443_1381 302
450 3300046683 Ga0495658_0140461 Ga0495658_0140461_473_1411 302
451 3300046689 Ga0495613_0039833 Ga0495613_0039833_1771_2709 302
452 3300046690 Ga0495624_0010916 Ga0495624_0010916_2284_3222 302
453 3300046692 Ga0495671_0063888 Ga0495671_0063888_722_1660 302
454 3300046694 Ga0495649_0045703 Ga0495649_0045703_291_1229 302
455 3300046694 Ga0495649_0159650 Ga0495649_0159650_140_1078 302
456 3300046794 Ga0495589_0067650 Ga0495589_0067650_352_1284 302
457 3300046809 Ga0495600_0008222 Ga0495600_0008222_411_1349 302
458 3300046809 Ga0495600_0016359 Ga0495600_0016359_2969_3907 302
459 3300046810 Ga0495660_0047414 Ga0495660_0047414_1317_2255 302
460 3300047315 Ga0495581_0100888 Ga0495581_0100888_279_1217 302
461 3300047317 Ga0495604_0002138 Ga0495604_0002138_5401_6339 302
462 3300047319 Ga0495674_0027876 Ga0495674_0027876_2077_3015 302
463 3300047321 Ga0495676_0068430 Ga0495676_0068430_944_1882 302
464 3300047322 Ga0495680_0002914 Ga0495680_0002914_14029_14967 302
465 3300047444 Ga0495675_0054491 Ga0495675_0054491_327_1265 302
466 3300047469 Ga0495673_0074918 Ga0495673_0074918_282_1220 302
467 3300047471 Ga0495684_0143540 Ga0495684_0143540_724_1662 302
468 3300048088 Ga0495602_0019051 Ga0495602_0019051_753_1691 302
469 3300048088 Ga0495602_0056943 Ga0495602_0056943_2457_3395 302
470 3300048089 Ga0495614_0037946 Ga0495614_0037946_1016_1954 302
471 3300048091 Ga0495626_0031459 Ga0495626_0031459_64_1002 302
472 3300048904 Ga0496101_0069994 Ga0496101_0069994_820_1758 302
473 3300048907 Ga0496104_0010700 Ga0496104_0010700_3772_4710 302
474 3300048907 Ga0496104_0032718 Ga0496104_0032718_804_1742 302
475 3300048908 Ga0496105_0006092 Ga0496105_0006092_5731_6669 302
476 3300048910 Ga0496107_0033508 Ga0496107_0033508_2607_3545 302
477 3300048912 Ga0496109_0147188 Ga0496109_0147188_1146_2084 302
478 3300048915 Ga0496112_0365518 Ga0496112_0365518_292_1230 302
479 3300048916 Ga0496113_0046463 Ga0496113_0046463_773_1711 302
480 3300048917 Ga0496114_0062528 Ga0496114_0062528_1196_2134 302
481 3300048918 Ga0496115_0055747 Ga0496115_0055747_701_1639 302
482 3300048918 Ga0496115_0141684 Ga0496115_0141684_352_1290 302
483 3300048920 Ga0496117_0144220 Ga0496117_0144220_285_1223 302
484 3300048921 Ga0496118_0087242 Ga0496118_0087242_23_961 302
485 3300048921 Ga0496118_0235929 Ga0496118_0235929_53_991 302
486 3300048922 Ga0496119_0016733 Ga0496119_0016733_3339_4277 302
487 3300048922 Ga0496119_0097637 Ga0496119_0097637_454_1392 302
488 3300048923 Ga0496120_0024839 Ga0496120_0024839_1902_2840 302
489 3300048927 Ga0496124_0045901 Ga0496124_0045901_2143_3069 302
490 3300048928 Ga0496125_0027149 Ga0496125_0027149_847_1785 302
491 3300048928 Ga0496125_0045128 Ga0496125_0045128_1326_2264 302
492 3300048929 Ga0496126_0032369 Ga0496126_0032369_3138_4076 302
493 3300048929 Ga0496126_0222376 Ga0496126_0222376_266_1204 302
494 3300048929 Ga0496126_0228617 Ga0496126_0228617_438_1376 302
495 3300049460 Ga0495682_0024319 Ga0495682_0024319_98_1036 302
496 3300050492 nmdc:mga0yw44_61263_c1 nmdc:mga0yw44_61263_c1_1068_2006 302
497 3300050494 nmdc:mga06z11_151926_c1 nmdc:mga06z11_151926_c1_32_970 302
498 3300050516 nmdc:mga0sz30_11997_c1 nmdc:mga0sz30_11997_c1_15_953 302
499 3300053085 Ga0495619_0068128 Ga0495619_0068128_859_1797 302
500 3300053086 Ga0500578_0097865 Ga0500578_0097865_697_1635 302
501 3300053086 Ga0500578_0120254 Ga0500578_0120254_295_1233 302
502 3300053087 Ga0500643_000210 Ga0500643_000210_34876_35814 302
503 3300053092 Ga0500583_0035872 Ga0500583_0035872_521_1459 302
504 3300053094 Ga0500566_0000908 Ga0500566_0000908_13911_14849 302
505 3300053105 Ga0500557_000196 Ga0500557_000196_9143_10081 302
506 3300053109 Ga0500569_000222 Ga0500569_000222_7815_8753 302
507 3300053116 Ga0500592_008187 Ga0500592_008187_649_1587 302
508 3300053119 Ga0500595_017041 Ga0500595_017041_1523_2461 302
509 3300053121 Ga0500607_047181 Ga0500607_047181_95_1033 302
510 3300053122 Ga0500608_063314 Ga0500608_063314_117_1055 302
511 3300053130 Ga0500642_0000053 Ga0500642_0000053_1269_2207 302
512 3300053134 Ga0500658_0033992 Ga0500658_0033992_589_1515 302
513 3300053136 Ga0500559_0051750 Ga0500559_0051750_844_1782 302
514 3300053138 Ga0500564_056771 Ga0500564_056771_341_1279 302
515 3300053139 Ga0500568_0015646 Ga0500568_0015646_578_1516 302
516 3300053139 Ga0500568_0017652 Ga0500568_0017652_861_1799 302
517 3300053160 Ga0500633_0011052 Ga0500633_0011052_700_1638 302
518 3300053177 Ga0500636_0000033 Ga0500636_0000033_49925_50863 302
519 3300053735 Ga0500596_015515 Ga0500596_015515_107_1045 302
520 3300053737 Ga0500601_000019 Ga0500601_000019_32_970 302
521 iso_pu_bacteria 2510917022 2511134673 302
522 iso_pu_bacteria 2582581307 2585273754 302
523 iso_pu_bacteria 2582581315 2585326174 302
524 iso_pu_bacteria 2582581316 2585330339 302
525 iso_pu_bacteria 2585427531 2585559928 302
526 iso_pu_bacteria 2585427608 2585900606 302
527 iso_pu_bacteria 2585427609 2585905893 302
528 iso_pu_bacteria 2585428125 2587978992 302
529 iso_pu_bacteria 2615840698 2616556415 302
530 iso_pu_bacteria 2818991448 2819608599 302
531 iso_pu_bacteria 2838029111 2838029483 302
532 iso_pu_bacteria 2841911363 2841915697 302
533 iso_pu_bacteria 2841917233 2841920899 302
534 iso_pu_bacteria 2842475841 2842476087 302
535 iso_pu_bacteria 2842502639 2842503011 302
536 iso_pu_bacteria 2842509118 2842512869 302
537 iso_pu_bacteria 2852387548 2852388244 302
538 iso_pu_bacteria 2888388044 2888391298 302
539 iso_pu_bacteria 2919100787 2919101605 302
540 iso_pu_bacteria 2919408235 2919408605 302
541 iso_pu_bacteria 2996893221 2996897851 302
542 iso_pu_bacteria 3005416602 3005423005 302
543 iso_pu_bacteria 8005314921 8005315332 302
544 iso_pu_bacteria 8005484373 8005484753 302
545 iso_pu_bacteria 8005645114 8005649446 302
546 iso_pu_bacteria 8005682033 8005685311 302
547 iso_pu_bacteria 8057575449 8057580489 302
548 3300053153 Ga0500616_0001333 Ga0500616_0001333_19913_20893 303
549 3300001979 JGI24740J21852_10000300 JGI24740J21852_100003008 306
550 3300002737 JGI25162J39368_1000689 JGI25162J39368_100068921 306
551 3300002737 JGI25162J39368_1001544 JGI25162J39368_10015449 306
552 3300002739 JGI25158J39367_1000035 JGI25158J39367_10000356 306
553 3300002739 JGI25158J39367_1000131 JGI25158J39367_10001312 306
554 3300002773 JGI25152J39213_1001525 JGI25152J39213_10015259 306
555 3300003214 JGI25165J46597_1000570 JGI25165J46597_100057027 306
556 3300003214 JGI25165J46597_1000585 JGI25165J46597_100058528 306
557 3300003215 JGI25153J46596_10004711 JGI25153J46596_100047117 306
558 3300003322 rootL2_10082831 rootL2_100828314 306
559 3300003323 rootH1_10132888 rootH1_101328882 306
560 3300003374 JGI25161J50226_1000117 JGI25161J50226_100011725 306
561 3300003771 Ga0055526_1008819 Ga0055526_10088194 306
562 3300003792 Ga0055540_1004714 Ga0055540_10047146 306
563 3300004625 Ga0055543_1000037 Ga0055543_100003770 306
564 3300005262 Ga0065165_1006111 Ga0065165_10061117 306
565 3300005614 Ga0068856_100203346 Ga0068856_1002033463 306
566 3300005844 Ga0068862_100157270 Ga0068862_1001572702 306
567 3300006353 Ga0075370_10036416 Ga0075370_100364164 306
568 3300025208 Ga0209436_100054 Ga0209436_10005425 306
569 3300025233 Ga0209437_100050 Ga0209437_100050352 306
570 3300025233 Ga0209437_100056 Ga0209437_100056165 306
571 3300025258 Ga0209129_1003463 Ga0209129_10034637 306
572 3300025261 Ga0209233_1000037 Ga0209233_1000037394 306
573 3300025261 Ga0209233_1000071 Ga0209233_1000071165 306
574 3300025284 Ga0209130_1000002 Ga0209130_1000002335 306
575 3300025295 Ga0209564_1003132 Ga0209564_10031326 306
576 3300025297 Ga0209758_1001399 Ga0209758_100139930 306
577 3300025299 Ga0209256_1006210 Ga0209256_10062101 306
578 3300025302 Ga0207426_1000013 Ga0207426_1000013335 306
579 3300026078 Ga0207702_10131390 Ga0207702_101313902 306
580 3300027312 Ga0209371_1004480 Ga0209371_10044803 306
581 3300028380 Ga0268265_10317278 Ga0268265_103172781 306
582 3300028794 Ga0307515_10064263 Ga0307515_100642631 306
583 3300028794 Ga0307515_10269227 Ga0307515_102692272 306
584 3300030500 Ga0268256_1012930 Ga0268256_10129302 306
585 3300041413 Ga0439465_0005131 Ga0439465_0005131_1245_2312 306
586 3300041413 Ga0439465_0012776 Ga0439465_0012776_634_1605 306
587 3300045976 Ga0466967_0109851 Ga0466967_0109851_340_1260 306
588 3300046457 Ga0495590_0050752 Ga0495590_0050752_349_1320 306
589 3300046501 Ga0495607_0034767 Ga0495607_0034767_204_1151 306
590 3300046512 Ga0495610_0004965 Ga0495610_0004965_5050_6021 306
591 3300046522 Ga0495643_0042492 Ga0495643_0042492_235_1206 306
592 3300047472 Ga0495686_0154650 Ga0495686_0154650_115_1062 306
593 3300048919 Ga0496116_0017066 Ga0496116_0017066_1172_2143 306
594 3300048920 Ga0496117_0023188 Ga0496117_0023188_1566_2537 306
595 3300048922 Ga0496119_0011008 Ga0496119_0011008_5095_6015 306
596 3300048925 Ga0496122_0011841 Ga0496122_0011841_3014_3985 306
597 3300048925 Ga0496122_0015763 Ga0496122_0015763_4907_5827 306
598 3300048927 Ga0496124_0051452 Ga0496124_0051452_841_1761 306
599 3300048928 Ga0496125_0006553 Ga0496125_0006553_1966_2937 306
600 3300049571 Ga0501034_0016035 Ga0501034_0016035_5466_6434 306
601 3300049572 Ga0501036_0023053 Ga0501036_0023053_3217_4185 306
602 3300049573 Ga0501037_0040742 Ga0501037_0040742_2376_3344 306
603 3300049590 Ga0501074_0112068 Ga0501074_0112068_960_1928 306
604 3300049742 Ga0501080_0362611 Ga0501080_0362611_85_1053 306
605 3300049744 Ga0501083_0096334 Ga0501083_0096334_470_1438 306
606 3300049822 Ga0501035_0052945 Ga0501035_0052945_303_1271 306
607 3300049823 Ga0501044_0112740 Ga0501044_0112740_1560_2528 306
608 3300050516 nmdc:mga0sz30_6095_c1 nmdc:mga0sz30_6095_c1_1396_2367 306
609 3300053125 Ga0500618_001689 Ga0500618_001689_3853_4800 306
610 3300053156 Ga0500622_0001247 Ga0500622_0001247_7988_8959 306
611 3300053177 Ga0500636_0114660 Ga0500636_0114660_340_1287 306
612 3300060353 Ga0501082_0195057 Ga0501082_0195057_150_1118 306
613 iso_pu_bacteria 2791355261 2793329938 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

47

254

0.91

PF08659

KR

KR domain

47

192

0.78

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

53

267

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.9196 3 305
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8928 3 305
3rkr-assembly1.cif.gz_A-2 crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with nadp 0.8662 11 209
7jk9-assembly1.cif.gz_A helical filaments of plant light-dependent protochlorophyllide oxidoreductase (lpor) bound to nadph, pchlide, and membrane 0.8633 13 306
3gem-assembly1.cif.gz_B crystal structure of short-chain dehydrogenase from pseudomonas syringae 0.8609 12 207
ID Description Score Start End Superfamily
af_O53537_4_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9756 3 306 3.40.50.720
af_O53726_7_311_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.973 1 306 3.40.50.720
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9693 6 87 3.40.50.720
af_O53537_4_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9662 3 306 3.40.50.720
af_A8WG01_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 44 304 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2C9KDD6-F1-model_v4 Uncharacterized protein 0.9904 10 104 GO:0016020
GO:0016491
AF-A0A2R6LQX0-F1-model_v4 Short-chain dehydrogenase 0.9896 1 192 GO:0016491
AF-A0A7T1BY76-F1-model_v4 Retinol dehydrogenase 13-like (EC 1.1.1.300) 0.9864 10 135 GO:0052650
AF-A0A817GME3-F1-model_v4 Uncharacterized protein 0.9847 10 102 GO:0016020
GO:0016491
AF-A0A2R6LQX0-F1-model_v4 Short-chain dehydrogenase 0.9845 1 192 GO:0016491

Feature Viewer

pLDDT pTM Quality
92.81 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map