F469246
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 613 | 306 | 586 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10296890|Ga0105240_102968902 |
| Length | 250 |
| Sequence | LGILKKFIVHGGFAHLKLKANKLSAKSLPAMNHELLTMNSISISLQNIGRRFNRDWIFRGVDYTFTGSNSYAILGPNGSGKSTLLQVLNGSLAPSVGQLKYTFNDAEVEVGEVYQHLSLAAPYLELIEEFTLNEVIDFHFKFKGYKAGMDKNGVIELLGMQSSKNKMIRYFSSGMKQRLKLALAFCSNTPMLMLDEPTSNLDTQGVDWYLSLVQKFAADRLTLVCSNQQHEYGFCNERLNISDYKKEGKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 7 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 8 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 9 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 10 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 11 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 12 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 13 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 14 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 15 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 16 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 17 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 18 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 19 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 20 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 21 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 22 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 23 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 24 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 25 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 26 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 27 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 28 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 29 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 30 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 31 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 32 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 33 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 34 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 35 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 36 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 37 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 38 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 39 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 40 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 41 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 42 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 43 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 44 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 50 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 51 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 57 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 61 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 186 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 187 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 188 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 206 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 207 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 209 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 210 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 211 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 212 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 213 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 214 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 271 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 280 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 288 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 290 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 291 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 292 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 293 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 296 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 297 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 298 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 299 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 300 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 301 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 302 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 303 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 304 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 306 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.11 |
| Metatranscriptomes | 0.16 |
| Isolates | 4.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.97 |
| Nodule | 0 |
| Rhizoplane | 1.79 |
| Rhizosphere | 81.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1677431 | 2162886007 | Bacteria | 3055 |
| 2 | JGI24740J21852_10007285 | 3300001979 | Bacteria | 4506 |
| 3 | JGI24739J22299_10028909 | 3300001989 | Bacteria | 1931 |
| 4 | JGI24737J22298_10003208 | 3300001990 | Bacteria | 5802 |
| 5 | JGI24737J22298_10035536 | 3300001990 | Bacteria | 1541 |
| 6 | JGI24735J21928_10000093 | 3300002067 | Bacteria | 33623 |
| 7 | JGI24744J21845_10012713 | 3300002077 | Bacteria | 1703 |
| 8 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 9 | JGI25162J39368_1000097 | 3300002737 | Bacteria | 96520 |
| 10 | JGI25162J39368_1001750 | 3300002737 | Bacteria | 10388 |
| 11 | JGI25154J39366_1000021 | 3300002738 | Bacteria | 221559 |
| 12 | JGI25157J39369_1013421 | 3300002741 | Bacteria | 1031 |
| 13 | JGI25164J39214_1002319 | 3300002772 | Bacteria | 3036 |
| 14 | JGI25165J46597_1001806 | 3300003214 | Bacteria | 9076 |
| 15 | rootH1_10051127 | 3300003316 | Bacteria | 5024 |
| 16 | rootH1_10051127 | 3300003323 | Bacteria | 4055 |
| 17 | rootH2_10001273 | 3300003320 | Bacteria | 179792 |
| 18 | rootH2_10015677 | 3300003320 | Bacteria | 11191 |
| 19 | rootH2_10207088 | 3300003320 | Bacteria | 1608 |
| 20 | rootH2_10241535 | 3300003320 | Bacteria | 1131 |
| 21 | rootH2_10323976 | 3300003320 | Bacteria | 1489 |
| 22 | rootL2_10071036 | 3300003322 | Bacteria | 4256 |
| 23 | rootL2_10128366 | 3300003322 | Unclassified | 2084 |
| 24 | rootL2_10211313 | 3300003322 | Bacteria | 1481 |
| 25 | rootH1_10000975 | 3300003316 | Bacteria | 12698 |
| 26 | rootH1_10000975 | 3300003323 | Bacteria | 22074 |
| 27 | rootH1_10009825 | 3300003323 | Bacteria | 13487 |
| 28 | rootH1_10035177 | 3300003323 | Bacteria | 4291 |
| 29 | rootH1_10035178 | 3300003323 | Bacteria | 2286 |
| 30 | rootH1_10136596 | 3300003323 | Bacteria | 2329 |
| 31 | JGI25160J50197_1023819 | 3300003354 | Bacteria | 1754 |
| 32 | Ga0055535_1004402 | 3300003761 | Bacteria | 3432 |
| 33 | Ga0055542_1007561 | 3300003762 | Bacteria | 2196 |
| 34 | Ga0055536_1016448 | 3300003781 | Unclassified | 2472 |
| 35 | Ga0055531_10000092 | 3300003794 | Bacteria | 99176 |
| 36 | Ga0055543_1021073 | 3300004625 | Bacteria | 1191 |
| 37 | Ga0058863_11443821 | 3300004799 | Bacteria | 4283 |
| 38 | Ga0065165_1000060 | 3300005262 | Bacteria | 180226 |
| 39 | Ga0065714_10026122 | 3300005288 | Bacteria | 1554 |
| 40 | Ga0065714_10067802 | 3300005288 | Bacteria | 5187 |
| 41 | Ga0065714_10213702 | 3300005288 | Unclassified | 859 |
| 42 | Ga0065704_10079379 | 3300005289 | Bacteria | 4180 |
| 43 | Ga0070658_10000675 | 3300005327 | Bacteria | 29517 |
| 44 | Ga0070658_10059384 | 3300005327 | Bacteria | 3114 |
| 45 | Ga0070676_10000573 | 3300005328 | Bacteria | 17839 |
| 46 | Ga0070676_10012058 | 3300005328 | Bacteria | 4712 |
| 47 | Ga0070670_100499261 | 3300005331 | Bacteria | 1082 |
| 48 | Ga0068869_100121472 | 3300005334 | Bacteria | 1998 |
| 49 | Ga0070666_10010165 | 3300005335 | Bacteria | 5878 |
| 50 | Ga0070680_100023459 | 3300005336 | Bacteria | 4920 |
| 51 | Ga0070680_100040616 | 3300005336 | Bacteria | 3768 |
| 52 | Ga0070680_100553862 | 3300005336 | Unclassified | 986 |
| 53 | Ga0070682_100033894 | 3300005337 | Bacteria | 3105 |
| 54 | Ga0068868_100007993 | 3300005338 | Bacteria | 7559 |
| 55 | Ga0070660_100545149 | 3300005339 | Bacteria | 967 |
| 56 | Ga0070660_100602064 | 3300005339 | Bacteria | 919 |
| 57 | Ga0070691_10099457 | 3300005341 | Bacteria | 1443 |
| 58 | Ga0070661_100629605 | 3300005344 | Bacteria | 869 |
| 59 | Ga0070675_100019801 | 3300005354 | Bacteria | 5367 |
| 60 | Ga0070671_100017095 | 3300005355 | Bacteria | 5869 |
| 61 | Ga0070671_100105996 | 3300005355 | Bacteria | 2359 |
| 62 | Ga0070671_100140233 | 3300005355 | Bacteria | 2040 |
| 63 | Ga0070671_100294613 | 3300005355 | Bacteria | 1381 |
| 64 | Ga0070671_100727141 | 3300005355 | Bacteria | 862 |
| 65 | Ga0070671_100799075 | 3300005355 | Bacteria | 821 |
| 66 | Ga0070673_100014307 | 3300005364 | Bacteria | 5519 |
| 67 | Ga0070673_100066919 | 3300005364 | Bacteria | 2872 |
| 68 | Ga0070673_100398659 | 3300005364 | Bacteria | 1230 |
| 69 | Ga0070659_100003641 | 3300005366 | Bacteria | 10976 |
| 70 | Ga0070659_100167730 | 3300005366 | Bacteria | 1797 |
| 71 | Ga0070667_100000031 | 3300005367 | Bacteria | 177447 |
| 72 | Ga0070663_100240630 | 3300005455 | Bacteria | 1428 |
| 73 | Ga0070662_100002625 | 3300005457 | Bacteria | 11085 |
| 74 | Ga0070681_10015787 | 3300005458 | Bacteria | 7528 |
| 75 | Ga0070681_10115268 | 3300005458 | Bacteria | 2625 |
| 76 | Ga0070681_10376082 | 3300005458 | Bacteria | 1331 |
| 77 | Ga0068867_100001804 | 3300005459 | Bacteria | 14902 |
| 78 | Ga0068867_100012634 | 3300005459 | Bacteria | 5972 |
| 79 | Ga0068867_100042981 | 3300005459 | Bacteria | 3307 |
| 80 | Ga0070679_100081468 | 3300005530 | Bacteria | 3226 |
| 81 | Ga0070679_100165325 | 3300005530 | Bacteria | 2186 |
| 82 | Ga0070684_100447855 | 3300005535 | Bacteria | 1193 |
| 83 | Ga0068853_100010363 | 3300005539 | Bacteria | 7540 |
| 84 | Ga0068853_100019053 | 3300005539 | Bacteria | 5686 |
| 85 | Ga0068853_100046477 | 3300005539 | Bacteria | 3722 |
| 86 | Ga0068853_100105460 | 3300005539 | Bacteria | 2497 |
| 87 | Ga0068853_100256849 | 3300005539 | Bacteria | 1605 |
| 88 | Ga0068853_100830848 | 3300005539 | Bacteria | 885 |
| 89 | Ga0070672_100005602 | 3300005543 | Bacteria | 8350 |
| 90 | Ga0070672_100835063 | 3300005543 | Bacteria | 812 |
| 91 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 92 | Ga0070665_100002650 | 3300005548 | Bacteria | 19467 |
| 93 | Ga0068855_100000021 | 3300005563 | Bacteria | 195708 |
| 94 | Ga0068855_100001368 | 3300005563 | Bacteria | 30198 |
| 95 | Ga0068855_100144084 | 3300005563 | Bacteria | 2714 |
| 96 | Ga0068855_100163887 | 3300005563 | Bacteria | 2521 |
| 97 | Ga0068855_100306528 | 3300005563 | Bacteria | 1758 |
| 98 | Ga0068855_100438346 | 3300005563 | Unclassified | 1427 |
| 99 | Ga0068855_100574291 | 3300005563 | Bacteria | 1218 |
| 100 | Ga0068855_100922152 | 3300005563 | Bacteria | 922 |
| 101 | Ga0068855_101055044 | 3300005563 | Unclassified | 851 |
| 102 | Ga0068857_100056246 | 3300005577 | Bacteria | 3491 |
| 103 | Ga0068857_100076675 | 3300005577 | Bacteria | 2982 |
| 104 | Ga0068857_100128053 | 3300005577 | Bacteria | 2288 |
| 105 | Ga0068854_100113235 | 3300005578 | Bacteria | 2049 |
| 106 | Ga0068856_100000006 | 3300005614 | Bacteria | 223827 |
| 107 | Ga0068856_100004027 | 3300005614 | Bacteria | 14713 |
| 108 | Ga0068856_100036749 | 3300005614 | Bacteria | 4803 |
| 109 | Ga0068856_100050093 | 3300005614 | Bacteria | 4117 |
| 110 | Ga0068856_100339350 | 3300005614 | Bacteria | 1521 |
| 111 | Ga0068856_100604468 | 3300005614 | Bacteria | 1118 |
| 112 | Ga0068856_100966031 | 3300005614 | Bacteria | 870 |
| 113 | Ga0068856_100972375 | 3300005614 | Bacteria | 867 |
| 114 | Ga0068852_100005157 | 3300005616 | Bacteria | 9313 |
| 115 | Ga0068852_100141912 | 3300005616 | Bacteria | 2224 |
| 116 | Ga0068852_100215680 | 3300005616 | Unclassified | 1823 |
| 117 | Ga0068859_100000451 | 3300005617 | Bacteria | 40880 |
| 118 | Ga0068864_100006018 | 3300005618 | Bacteria | 9961 |
| 119 | Ga0068864_100514509 | 3300005618 | Bacteria | 1153 |
| 120 | Ga0068866_10183668 | 3300005718 | Bacteria | 1237 |
| 121 | Ga0068851_10001096 | 3300005834 | Bacteria | 11756 |
| 122 | Ga0068863_100018879 | 3300005841 | Bacteria | 6598 |
| 123 | Ga0068863_100039830 | 3300005841 | Bacteria | 4469 |
| 124 | Ga0068863_100499893 | 3300005841 | Bacteria | 1197 |
| 125 | Ga0068858_100021942 | 3300005842 | Bacteria | 5963 |
| 126 | Ga0068858_100389251 | 3300005842 | Bacteria | 1338 |
| 127 | Ga0068860_100016192 | 3300005843 | Bacteria | 7272 |
| 128 | Ga0068860_100243294 | 3300005843 | Bacteria | 1750 |
| 129 | Ga0070716_100430837 | 3300006173 | Unclassified | 956 |
| 130 | Ga0075366_10000019 | 3300006195 | Bacteria | 59333 |
| 131 | Ga0075366_10000496 | 3300006195 | Bacteria | 18213 |
| 132 | Ga0075366_10000779 | 3300006195 | Bacteria | 15223 |
| 133 | Ga0097621_100003766 | 3300006237 | Bacteria | 10512 |
| 134 | Ga0097621_100006550 | 3300006237 | Bacteria | 8272 |
| 135 | Ga0097621_100006952 | 3300006237 | Bacteria | 8056 |
| 136 | Ga0097621_100010393 | 3300006237 | Bacteria | 6809 |
| 137 | Ga0075370_10089453 | 3300006353 | Bacteria | 1775 |
| 138 | Ga0075370_10205516 | 3300006353 | Bacteria | 1162 |
| 139 | Ga0068871_100000491 | 3300006358 | Bacteria | 27057 |
| 140 | Ga0068871_100001976 | 3300006358 | Bacteria | 13888 |
| 141 | Ga0068871_100007909 | 3300006358 | Bacteria | 7623 |
| 142 | Ga0068871_100012713 | 3300006358 | Bacteria | 6222 |
| 143 | Ga0068865_100000070 | 3300006881 | Bacteria | 53670 |
| 144 | Ga0068865_100004346 | 3300006881 | Bacteria | 8550 |
| 145 | Ga0097620_100000451 | 3300006931 | Bacteria | 40880 |
| 146 | Ga0105240_10000083 | 3300009093 | Bacteria | 192934 |
| 147 | Ga0105240_10008396 | 3300009093 | Bacteria | 14776 |
| 148 | Ga0105240_10025938 | 3300009093 | Bacteria | 7697 |
| 149 | Ga0105240_10027963 | 3300009093 | Bacteria | 7376 |
| 150 | Ga0105240_10039588 | 3300009093 | Bacteria | 6035 |
| 151 | Ga0105240_10083621 | 3300009093 | Bacteria | 3916 |
| 152 | Ga0105240_10176466 | 3300009093 | Bacteria | 2526 |
| 153 | Ga0105240_10225835 | 3300009093 | Bacteria | 2179 |
| 154 | Ga0105240_10269418 | 3300009093 | Bacteria | 1961 |
| 155 | Ga0105240_10296890 | 3300009093 | Bacteria | 1850 |
| 156 | Ga0105240_10361767 | 3300009093 | Bacteria | 1643 |
| 157 | Ga0105240_10385162 | 3300009093 | Bacteria | 1582 |
| 158 | Ga0105240_10495934 | 3300009093 | Unclassified | 1359 |
| 159 | Ga0105240_10511430 | 3300009093 | Bacteria | 1334 |
| 160 | Ga0105240_10857896 | 3300009093 | Unclassified | 980 |
| 161 | Ga0105240_11244867 | 3300009093 | Bacteria | 787 |
| 162 | Ga0105240_11247030 | 3300009093 | Unclassified | 786 |
| 163 | Ga0105245_10473657 | 3300009098 | Bacteria | 1264 |
| 164 | Ga0105245_10958546 | 3300009098 | Bacteria | 899 |
| 165 | Ga0105247_10027343 | 3300009101 | Unclassified | 3450 |
| 166 | Ga0105243_10091725 | 3300009148 | Bacteria | 2502 |
| 167 | Ga0105241_10005957 | 3300009174 | Bacteria | 8989 |
| 168 | Ga0105241_10015143 | 3300009174 | Bacteria | 5649 |
| 169 | Ga0105241_10722340 | 3300009174 | Bacteria | 911 |
| 170 | Ga0105242_10023716 | 3300009176 | Bacteria | 4838 |
| 171 | Ga0105242_10035688 | 3300009176 | Bacteria | 3987 |
| 172 | Ga0105242_11291975 | 3300009176 | Bacteria | 753 |
| 173 | Ga0105248_10046424 | 3300009177 | Bacteria | 4868 |
| 174 | Ga0105237_10000138 | 3300009545 | Bacteria | 102411 |
| 175 | Ga0105237_10002154 | 3300009545 | Bacteria | 24772 |
| 176 | Ga0105237_10007680 | 3300009545 | Bacteria | 11784 |
| 177 | Ga0105237_10008458 | 3300009545 | Bacteria | 11136 |
| 178 | Ga0105237_10053901 | 3300009545 | Bacteria | 4031 |
| 179 | Ga0105237_10141157 | 3300009545 | Bacteria | 2403 |
| 180 | Ga0105237_10240923 | 3300009545 | Bacteria | 1810 |
| 181 | Ga0105237_10272179 | 3300009545 | Bacteria | 1696 |
| 182 | Ga0105237_10689663 | 3300009545 | Bacteria | 1028 |
| 183 | Ga0105237_10730910 | 3300009545 | Bacteria | 996 |
| 184 | Ga0105238_10005277 | 3300009551 | Bacteria | 12781 |
| 185 | Ga0105238_10105278 | 3300009551 | Bacteria | 2803 |
| 186 | Ga0105238_10230185 | 3300009551 | Bacteria | 1830 |
| 187 | Ga0105238_10735217 | 3300009551 | Bacteria | 1000 |
| 188 | Ga0105238_10969985 | 3300009551 | Bacteria | 870 |
| 189 | Ga0105249_10345667 | 3300009553 | Bacteria | 1505 |
| 190 | Ga0105249_10472583 | 3300009553 | Bacteria | 1295 |
| 191 | Ga0105239_10000026 | 3300010375 | Bacteria | 248302 |
| 192 | Ga0105239_10000130 | 3300010375 | Bacteria | 105894 |
| 193 | Ga0105239_10002143 | 3300010375 | Bacteria | 25398 |
| 194 | Ga0105239_10012139 | 3300010375 | Bacteria | 9606 |
| 195 | Ga0105239_10025142 | 3300010375 | Bacteria | 6558 |
| 196 | Ga0105239_10100768 | 3300010375 | Bacteria | 3195 |
| 197 | Ga0105239_10137613 | 3300010375 | Bacteria | 2719 |
| 198 | Ga0105239_10152826 | 3300010375 | Bacteria | 2576 |
| 199 | Ga0105239_10188861 | 3300010375 | Unclassified | 2306 |
| 200 | Ga0105239_10354620 | 3300010375 | Bacteria | 1656 |
| 201 | Ga0105239_10424527 | 3300010375 | Bacteria | 1506 |
| 202 | Ga0105239_10666606 | 3300010375 | Bacteria | 1188 |
| 203 | Ga0105239_10688901 | 3300010375 | Bacteria | 1168 |
| 204 | Ga0105239_11200131 | 3300010375 | Bacteria | 874 |
| 205 | Ga0105246_10253392 | 3300011119 | Bacteria | 1398 |
| 206 | Ga0105246_10395036 | 3300011119 | Bacteria | 1147 |
| 207 | Ga0105246_10586072 | 3300011119 | Bacteria | 961 |
| 208 | Ga0157373_10000057 | 3300013100 | Bacteria | 99697 |
| 209 | Ga0157373_10487969 | 3300013100 | Bacteria | 889 |
| 210 | Ga0157371_10000480 | 3300013102 | Bacteria | 48687 |
| 211 | Ga0157371_10015232 | 3300013102 | Bacteria | 5775 |
| 212 | Ga0157371_10044041 | 3300013102 | Bacteria | 3179 |
| 213 | Ga0157371_10362593 | 3300013102 | Bacteria | 1056 |
| 214 | Ga0157371_10375272 | 3300013102 | Bacteria | 1038 |
| 215 | Ga0157370_10015989 | 3300013104 | Bacteria | 7612 |
| 216 | Ga0157370_10018014 | 3300013104 | Bacteria | 7108 |
| 217 | Ga0157370_10021907 | 3300013104 | Bacteria | 6364 |
| 218 | Ga0157370_10085253 | 3300013104 | Bacteria | 2967 |
| 219 | Ga0157370_10162454 | 3300013104 | Bacteria | 2078 |
| 220 | Ga0157370_10260024 | 3300013104 | Bacteria | 1604 |
| 221 | Ga0157369_10000301 | 3300013105 | Bacteria | 66010 |
| 222 | Ga0157369_10271904 | 3300013105 | Bacteria | 1765 |
| 223 | Ga0157369_10391029 | 3300013105 | Unclassified | 1443 |
| 224 | Ga0157369_10718673 | 3300013105 | Bacteria | 1028 |
| 225 | Ga0157374_10002863 | 3300013296 | Bacteria | 14485 |
| 226 | Ga0157374_10003120 | 3300013296 | Bacteria | 13919 |
| 227 | Ga0157374_10008123 | 3300013296 | Bacteria | 8969 |
| 228 | Ga0157374_10015781 | 3300013296 | Bacteria | 6634 |
| 229 | Ga0157374_10020461 | 3300013296 | Bacteria | 5870 |
| 230 | Ga0157374_10201079 | 3300013296 | Bacteria | 1951 |
| 231 | Ga0157374_10321735 | 3300013296 | Bacteria | 1533 |
| 232 | Ga0157374_11069221 | 3300013296 | Bacteria | 827 |
| 233 | Ga0157378_10007469 | 3300013297 | Bacteria | 9550 |
| 234 | Ga0157378_10014751 | 3300013297 | Bacteria | 6847 |
| 235 | Ga0157378_10343634 | 3300013297 | Bacteria | 1456 |
| 236 | Ga0157378_11352396 | 3300013297 | Bacteria | 754 |
| 237 | Ga0163162_10000026 | 3300013306 | Bacteria | 178701 |
| 238 | Ga0163162_10011373 | 3300013306 | Bacteria | 8677 |
| 239 | Ga0163162_10018688 | 3300013306 | Bacteria | 6791 |
| 240 | Ga0163162_10024812 | 3300013306 | Bacteria | 5922 |
| 241 | Ga0163162_10873141 | 3300013306 | Bacteria | 1014 |
| 242 | Ga0163162_11575775 | 3300013306 | Bacteria | 749 |
| 243 | Ga0157372_10000037 | 3300013307 | Bacteria | 172444 |
| 244 | Ga0157372_10000158 | 3300013307 | Bacteria | 73709 |
| 245 | Ga0157372_10006525 | 3300013307 | Bacteria | 12417 |
| 246 | Ga0157372_10188347 | 3300013307 | Bacteria | 2389 |
| 247 | Ga0157372_10290738 | 3300013307 | Bacteria | 1900 |
| 248 | Ga0157372_10310872 | 3300013307 | Bacteria | 1834 |
| 249 | Ga0157372_10356668 | 3300013307 | Bacteria | 1704 |
| 250 | Ga0157372_10391523 | 3300013307 | Bacteria | 1619 |
| 251 | Ga0157375_10023788 | 3300013308 | Bacteria | 5660 |
| 252 | Ga0157375_10111239 | 3300013308 | Bacteria | 2838 |
| 253 | Ga0157375_10137594 | 3300013308 | Bacteria | 2567 |
| 254 | Ga0157375_10164228 | 3300013308 | Bacteria | 2364 |
| 255 | Ga0157375_10296764 | 3300013308 | Bacteria | 1779 |
| 256 | Ga0157375_10533170 | 3300013308 | Unclassified | 1337 |
| 257 | Ga0157375_10721740 | 3300013308 | Bacteria | 1149 |
| 258 | Ga0157375_10779700 | 3300013308 | Bacteria | 1106 |
| 259 | Ga0163163_10000174 | 3300014325 | Bacteria | 67568 |
| 260 | Ga0163163_10102441 | 3300014325 | Bacteria | 2886 |
| 261 | Ga0163163_10474446 | 3300014325 | Bacteria | 1312 |
| 262 | Ga0157380_10000011 | 3300014326 | Bacteria | 132153 |
| 263 | Ga0157377_10288539 | 3300014745 | Bacteria | 1078 |
| 264 | Ga0157379_10007490 | 3300014968 | Bacteria | 9449 |
| 265 | Ga0157379_10015024 | 3300014968 | Bacteria | 6792 |
| 266 | Ga0157379_10375806 | 3300014968 | Bacteria | 1303 |
| 267 | Ga0157376_10029662 | 3300014969 | Bacteria | 4359 |
| 268 | Ga0157376_10144501 | 3300014969 | Bacteria | 2138 |
| 269 | Ga0182005_1000042 | 3300015265 | Bacteria | 146854 |
| 270 | Ga0163161_10009734 | 3300017792 | Bacteria | 6659 |
| 271 | Ga0163161_10277896 | 3300017792 | Bacteria | 1313 |
| 272 | Ga0209436_104712 | 3300025208 | Bacteria | 3305 |
| 273 | Ga0207427_100083 | 3300025231 | Bacteria | 142745 |
| 274 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 275 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 276 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 277 | Ga0209646_1000050 | 3300025246 | Bacteria | 296599 |
| 278 | Ga0209026_1000195 | 3300025250 | Bacteria | 84589 |
| 279 | Ga0209026_1001818 | 3300025250 | Bacteria | 8781 |
| 280 | Ga0209026_1007931 | 3300025250 | Bacteria | 2294 |
| 281 | Ga0209148_1000167 | 3300025254 | Bacteria | 135407 |
| 282 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 283 | Ga0209233_1002780 | 3300025261 | Bacteria | 6290 |
| 284 | Ga0209455_1004639 | 3300025272 | Bacteria | 4433 |
| 285 | Ga0209130_1006047 | 3300025284 | Bacteria | 4023 |
| 286 | Ga0209676_1000351 | 3300025292 | Bacteria | 87135 |
| 287 | Ga0207426_1000250 | 3300025302 | Bacteria | 117492 |
| 288 | Ga0207426_1005879 | 3300025302 | Bacteria | 5463 |
| 289 | Ga0209257_1000128 | 3300025304 | Bacteria | 214268 |
| 290 | Ga0207697_10037886 | 3300025315 | Bacteria | 1977 |
| 291 | Ga0207656_10045330 | 3300025321 | Bacteria | 1881 |
| 292 | Ga0207642_10354547 | 3300025899 | Bacteria | 866 |
| 293 | Ga0207680_10005574 | 3300025903 | Bacteria | 6019 |
| 294 | Ga0207647_10002483 | 3300025904 | Bacteria | 13965 |
| 295 | Ga0207647_10014044 | 3300025904 | Bacteria | 5537 |
| 296 | Ga0207645_10002024 | 3300025907 | Bacteria | 16278 |
| 297 | Ga0207645_10011365 | 3300025907 | Bacteria | 6083 |
| 298 | Ga0207705_10000035 | 3300025909 | Bacteria | 201649 |
| 299 | Ga0207705_10342794 | 3300025909 | Unclassified | 1150 |
| 300 | Ga0207654_10021925 | 3300025911 | Bacteria | 3402 |
| 301 | Ga0207654_10041602 | 3300025911 | Bacteria | 2596 |
| 302 | Ga0207707_10009099 | 3300025912 | Bacteria | 8629 |
| 303 | Ga0207707_10016419 | 3300025912 | Bacteria | 6458 |
| 304 | Ga0207695_10000127 | 3300025913 | Bacteria | 227338 |
| 305 | Ga0207695_10006085 | 3300025913 | Bacteria | 15745 |
| 306 | Ga0207695_10012308 | 3300025913 | Bacteria | 10277 |
| 307 | Ga0207695_10030928 | 3300025913 | Bacteria | 5886 |
| 308 | Ga0207695_10042968 | 3300025913 | Bacteria | 4821 |
| 309 | Ga0207695_10111298 | 3300025913 | Unclassified | 2717 |
| 310 | Ga0207695_10120103 | 3300025913 | Bacteria | 2597 |
| 311 | Ga0207695_10144936 | 3300025913 | Bacteria | 2320 |
| 312 | Ga0207695_10218518 | 3300025913 | Bacteria | 1814 |
| 313 | Ga0207695_10221844 | 3300025913 | Bacteria | 1797 |
| 314 | Ga0207695_10356529 | 3300025913 | Bacteria | 1349 |
| 315 | Ga0207695_10616676 | 3300025913 | Bacteria | 966 |
| 316 | Ga0207671_10001040 | 3300025914 | Bacteria | 33728 |
| 317 | Ga0207671_10004045 | 3300025914 | Bacteria | 14219 |
| 318 | Ga0207671_10004973 | 3300025914 | Bacteria | 12455 |
| 319 | Ga0207671_10030893 | 3300025914 | Bacteria | 3994 |
| 320 | Ga0207671_10131153 | 3300025914 | Bacteria | 1924 |
| 321 | Ga0207671_10142188 | 3300025914 | Bacteria | 1849 |
| 322 | Ga0207671_10159797 | 3300025914 | Bacteria | 1744 |
| 323 | Ga0207671_10453620 | 3300025914 | Bacteria | 1021 |
| 324 | Ga0207660_10007186 | 3300025917 | Bacteria | 7208 |
| 325 | Ga0207660_10026645 | 3300025917 | Bacteria | 3937 |
| 326 | Ga0207660_10080911 | 3300025917 | Bacteria | 2386 |
| 327 | Ga0207657_10043324 | 3300025919 | Bacteria | 3965 |
| 328 | Ga0207657_10146379 | 3300025919 | Bacteria | 1927 |
| 329 | Ga0207657_10533985 | 3300025919 | Bacteria | 918 |
| 330 | Ga0207652_10015048 | 3300025921 | Bacteria | 6275 |
| 331 | Ga0207652_10020517 | 3300025921 | Bacteria | 5443 |
| 332 | Ga0207652_10081881 | 3300025921 | Bacteria | 2824 |
| 333 | Ga0207694_10156594 | 3300025924 | Bacteria | 1838 |
| 334 | Ga0207694_10737240 | 3300025924 | Unclassified | 831 |
| 335 | Ga0207650_10686925 | 3300025925 | Bacteria | 864 |
| 336 | Ga0207687_10309619 | 3300025927 | Bacteria | 1275 |
| 337 | Ga0207687_10958611 | 3300025927 | Bacteria | 733 |
| 338 | Ga0207644_10033864 | 3300025931 | Bacteria | 3573 |
| 339 | Ga0207690_10007346 | 3300025932 | Bacteria | 6540 |
| 340 | Ga0207690_10014185 | 3300025932 | Bacteria | 4807 |
| 341 | Ga0207706_10000662 | 3300025933 | Bacteria | 36264 |
| 342 | Ga0207686_10005823 | 3300025934 | Bacteria | 6613 |
| 343 | Ga0207686_10417597 | 3300025934 | Bacteria | 1025 |
| 344 | Ga0207704_10002226 | 3300025938 | Bacteria | 8700 |
| 345 | Ga0207704_10045232 | 3300025938 | Bacteria | 2614 |
| 346 | Ga0207691_10027168 | 3300025940 | Bacteria | 5369 |
| 347 | Ga0207711_10096689 | 3300025941 | Bacteria | 2607 |
| 348 | Ga0207689_10074538 | 3300025942 | Unclassified | 2788 |
| 349 | Ga0207667_10000014 | 3300025949 | Bacteria | 421261 |
| 350 | Ga0207667_10007695 | 3300025949 | Bacteria | 12895 |
| 351 | Ga0207667_10036206 | 3300025949 | Bacteria | 5291 |
| 352 | Ga0207667_10058276 | 3300025949 | Bacteria | 4052 |
| 353 | Ga0207667_10083618 | 3300025949 | Bacteria | 3305 |
| 354 | Ga0207667_10285852 | 3300025949 | Bacteria | 1685 |
| 355 | Ga0207667_10643442 | 3300025949 | Bacteria | 1066 |
| 356 | Ga0207667_11044124 | 3300025949 | Unclassified | 803 |
| 357 | Ga0207651_10008410 | 3300025960 | Bacteria | 5573 |
| 358 | Ga0207651_10117250 | 3300025960 | Unclassified | 2011 |
| 359 | Ga0207712_10209949 | 3300025961 | Bacteria | 1550 |
| 360 | Ga0207668_10000298 | 3300025972 | Bacteria | 32532 |
| 361 | Ga0207640_10012943 | 3300025981 | Bacteria | 4768 |
| 362 | Ga0207658_10013104 | 3300025986 | Bacteria | 5662 |
| 363 | Ga0207658_10541593 | 3300025986 | Bacteria | 1041 |
| 364 | Ga0207677_10004006 | 3300026023 | Bacteria | 7860 |
| 365 | Ga0207677_10048362 | 3300026023 | Bacteria | 2863 |
| 366 | Ga0207703_10006892 | 3300026035 | Bacteria | 9047 |
| 367 | Ga0207703_10603794 | 3300026035 | Bacteria | 1038 |
| 368 | Ga0207639_10015040 | 3300026041 | Bacteria | 5450 |
| 369 | Ga0207639_10035563 | 3300026041 | Bacteria | 3686 |
| 370 | Ga0207639_10143870 | 3300026041 | Bacteria | 1990 |
| 371 | Ga0207678_10078612 | 3300026067 | Bacteria | 2825 |
| 372 | Ga0207702_10000023 | 3300026078 | Bacteria | 189234 |
| 373 | Ga0207702_10031631 | 3300026078 | Bacteria | 4411 |
| 374 | Ga0207702_10082404 | 3300026078 | Bacteria | 2797 |
| 375 | Ga0207702_10447935 | 3300026078 | Bacteria | 1252 |
| 376 | Ga0207702_10647746 | 3300026078 | Bacteria | 1039 |
| 377 | Ga0207641_10009560 | 3300026088 | Bacteria | 7987 |
| 378 | Ga0207641_10189673 | 3300026088 | Bacteria | 1889 |
| 379 | Ga0207641_10477571 | 3300026088 | Bacteria | 1208 |
| 380 | Ga0207648_10004191 | 3300026089 | Bacteria | 14900 |
| 381 | Ga0207648_10014556 | 3300026089 | Bacteria | 7265 |
| 382 | Ga0207648_10031381 | 3300026089 | Bacteria | 4698 |
| 383 | Ga0207676_10003554 | 3300026095 | Bacteria | 11027 |
| 384 | Ga0207674_10013741 | 3300026116 | Bacteria | 8962 |
| 385 | Ga0207674_10072401 | 3300026116 | Bacteria | 3462 |
| 386 | Ga0207674_10150075 | 3300026116 | Bacteria | 2288 |
| 387 | Ga0207674_10278262 | 3300026116 | Bacteria | 1621 |
| 388 | Ga0207683_10008462 | 3300026121 | Bacteria | 8806 |
| 389 | Ga0207698_10021199 | 3300026142 | Bacteria | 4489 |
| 390 | Ga0207698_10160118 | 3300026142 | Bacteria | 1967 |
| 391 | Ga0207698_10434757 | 3300026142 | Unclassified | 1263 |
| 392 | Ga0207698_10760698 | 3300026142 | Bacteria | 968 |
| 393 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 394 | Ga0268266_10013819 | 3300028379 | Bacteria | 6949 |
| 395 | Ga0268264_10003219 | 3300028381 | Bacteria | 14141 |
| 396 | Ga0268264_10399178 | 3300028381 | Unclassified | 1321 |
| 397 | Ga0268264_10982095 | 3300028381 | Bacteria | 850 |
| 398 | Ga0265318_10009572 | 3300028577 | Bacteria | 4254 |
| 399 | Ga0307517_10001388 | 3300028786 | Bacteria | 40654 |
| 400 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 401 | Ga0307515_10000077 | 3300028794 | Bacteria | 228162 |
| 402 | Ga0307515_10026002 | 3300028794 | Bacteria | 10099 |
| 403 | Ga0307515_10049654 | 3300028794 | Bacteria | 6303 |
| 404 | Ga0316177_1098816 | 3300030731 | Bacteria | 7845 |
| 405 | Ga0316176_1004700 | 3300030732 | Bacteria | 16177 |
| 406 | Ga0316183_1113144 | 3300030742 | Bacteria | 14108 |
| 407 | Ga0316181_1257111 | 3300030744 | Bacteria | 3705 |
| 408 | Ga0307408_100000393 | 3300031548 | Bacteria | 39808 |
| 409 | Ga0307408_100000487 | 3300031548 | Bacteria | 34716 |
| 410 | Ga0307408_101299621 | 3300031548 | Bacteria | 682 |
| 411 | Ga0316576_10314937 | 3300031727 | Bacteria | 1168 |
| 412 | Ga0307405_10002557 | 3300031731 | Bacteria | 8071 |
| 413 | Ga0307405_10015289 | 3300031731 | Bacteria | 4153 |
| 414 | Ga0307412_10005666 | 3300031911 | Bacteria | 7018 |
| 415 | Ga0307412_10064186 | 3300031911 | Bacteria | 2480 |
| 416 | Ga0307412_10384576 | 3300031911 | Bacteria | 1137 |
| 417 | Ga0307414_10019467 | 3300032004 | Bacteria | 4207 |
| 418 | Ga0307414_10097463 | 3300032004 | Bacteria | 2203 |
| 419 | Ga0307414_10114477 | 3300032004 | Bacteria | 2061 |
| 420 | Ga0307414_10377740 | 3300032004 | Bacteria | 1224 |
| 421 | Ga0307414_10418473 | 3300032004 | Bacteria | 1168 |
| 422 | Ga0307414_11116377 | 3300032004 | Unclassified | 728 |
| 423 | Ga0307411_10080200 | 3300032005 | Bacteria | 2243 |
| 424 | Ga0307507_10000143 | 3300033179 | Bacteria | 124248 |
| 425 | Ga0307510_10003117 | 3300033180 | Bacteria | 19187 |
| 426 | Ga0373955_0209888 | 3300035172 | Bacteria | 1161 |
| 427 | Ga0373924_0048357 | 3300035410 | Unclassified | 1757 |
| 428 | Ga0373937_0009187 | 3300036401 | Bacteria | 8581 |
| 429 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 430 | Ga0395899_0000280 | 3300037312 | Bacteria | 66580 |
| 431 | Ga0395899_0000793 | 3300037312 | Bacteria | 30923 |
| 432 | Ga0395899_0025586 | 3300037312 | Bacteria | 4455 |
| 433 | Ga0395899_0435091 | 3300037312 | Unclassified | 862 |
| 434 | Ga0395900_0001123 | 3300037418 | Bacteria | 33875 |
| 435 | Ga0395900_0001235 | 3300037418 | Bacteria | 31424 |
| 436 | Ga0395900_0015395 | 3300037418 | Bacteria | 7795 |
| 437 | Ga0395900_0307677 | 3300037418 | Bacteria | 1569 |
| 438 | Ga0395900_0831215 | 3300037418 | Bacteria | 850 |
| 439 | Ga0395898_0002540 | 3300037466 | Bacteria | 21394 |
| 440 | Ga0395898_0098291 | 3300037466 | Bacteria | 2810 |
| 441 | Ga0395905_0001253 | 3300037471 | Bacteria | 31445 |
| 442 | Ga0395905_0003224 | 3300037471 | Bacteria | 17546 |
| 443 | Ga0395901_0000941 | 3300038443 | Bacteria | 31690 |
| 444 | Ga0395901_0003465 | 3300038443 | Bacteria | 15886 |
| 445 | Ga0400484_07716 | 3300038725 | Bacteria | 8216 |
| 446 | Ga0400490_57711 | 3300038726 | Bacteria | 2589 |
| 447 | Ga0400490_59015 | 3300038726 | Bacteria | 1228 |
| 448 | Ga0451800_1250505 | 3300041459 | Bacteria | 746 |
| 449 | Ga0439431_0000479 | 3300041997 | Bacteria | 8484 |
| 450 | Ga0439431_0083809 | 3300041997 | Bacteria | 862 |
| 451 | Ga0439442_067519 | 3300042002 | Bacteria | 760 |
| 452 | Ga0439449_0098683 | 3300042007 | Bacteria | 1079 |
| 453 | Ga0439457_021317 | 3300042014 | Unclassified | 1437 |
| 454 | Ga0439457_110865 | 3300042014 | Bacteria | 644 |
| 455 | Ga0450923_075414 | 3300042125 | Bacteria | 753 |
| 456 | Ga0439434_0077242 | 3300042435 | Bacteria | 1054 |
| 457 | Ga0466965_0254467 | 3300044683 | Unclassified | 943 |
| 458 | Ga0466961_0015800 | 3300044693 | Bacteria | 4844 |
| 459 | Ga0453684_0044892 | 3300044712 | Bacteria | 5904 |
| 460 | Ga0453684_0058165 | 3300044712 | Bacteria | 4995 |
| 461 | Ga0453684_0118794 | 3300044712 | Bacteria | 3197 |
| 462 | Ga0453684_0172776 | 3300044712 | Bacteria | 2545 |
| 463 | Ga0466957_0608137 | 3300044842 | Bacteria | 766 |
| 464 | Ga0466959_0257309 | 3300045049 | Unclassified | 1202 |
| 465 | Ga0466958_0023604 | 3300045836 | Bacteria | 3613 |
| 466 | Ga0495592_0052042 | 3300046454 | Bacteria | 3041 |
| 467 | Ga0495629_0120850 | 3300046459 | Unclassified | 1825 |
| 468 | Ga0495629_0215041 | 3300046459 | Bacteria | 1327 |
| 469 | Ga0495638_0343569 | 3300046460 | Bacteria | 790 |
| 470 | Ga0495651_0325053 | 3300046462 | Bacteria | 1024 |
| 471 | Ga0495651_0338191 | 3300046462 | Bacteria | 998 |
| 472 | Ga0495650_0000268 | 3300046471 | Bacteria | 99891 |
| 473 | Ga0495650_0061779 | 3300046471 | Bacteria | 1499 |
| 474 | Ga0495605_0126801 | 3300046474 | Bacteria | 1154 |
| 475 | Ga0495662_0170263 | 3300046476 | Bacteria | 1073 |
| 476 | Ga0495585_0000034 | 3300046492 | Bacteria | 143120 |
| 477 | Ga0495585_0001510 | 3300046492 | Bacteria | 18129 |
| 478 | Ga0495596_0011446 | 3300046500 | Bacteria | 3829 |
| 479 | Ga0495583_0037566 | 3300046506 | Bacteria | 2295 |
| 480 | Ga0495606_0000009 | 3300046507 | Bacteria | 306313 |
| 481 | Ga0495606_0003806 | 3300046507 | Bacteria | 15677 |
| 482 | Ga0495606_0028027 | 3300046507 | Bacteria | 3981 |
| 483 | Ga0495610_0002842 | 3300046512 | Bacteria | 14087 |
| 484 | Ga0495616_0000848 | 3300046513 | Bacteria | 22319 |
| 485 | Ga0495616_0000907 | 3300046513 | Bacteria | 21368 |
| 486 | Ga0495618_0544228 | 3300046514 | Unclassified | 696 |
| 487 | Ga0495630_0018405 | 3300046517 | Bacteria | 5132 |
| 488 | Ga0495631_0009175 | 3300046518 | Bacteria | 4955 |
| 489 | Ga0495637_0077790 | 3300046520 | Bacteria | 1327 |
| 490 | Ga0495648_0006307 | 3300046524 | Bacteria | 9699 |
| 491 | Ga0495648_0016466 | 3300046524 | Bacteria | 5332 |
| 492 | Ga0495652_0090646 | 3300046529 | Bacteria | 2501 |
| 493 | Ga0495652_0143476 | 3300046529 | Bacteria | 1875 |
| 494 | Ga0495654_0114740 | 3300046530 | Bacteria | 1225 |
| 495 | Ga0495665_0248059 | 3300046531 | Unclassified | 917 |
| 496 | Ga0495640_0217158 | 3300046533 | Unclassified | 1207 |
| 497 | Ga0495645_0586458 | 3300046543 | Unclassified | 687 |
| 498 | Ga0495633_0000083 | 3300046558 | Bacteria | 125035 |
| 499 | Ga0495633_0000153 | 3300046558 | Bacteria | 90972 |
| 500 | Ga0495633_0017324 | 3300046558 | Bacteria | 3687 |
| 501 | Ga0495633_0034954 | 3300046558 | Unclassified | 2415 |
| 502 | Ga0495668_0000121 | 3300046616 | Bacteria | 116234 |
| 503 | Ga0495611_0081902 | 3300046648 | Bacteria | 1485 |
| 504 | Ga0495625_0000007 | 3300046660 | Bacteria | 565749 |
| 505 | Ga0495625_0001973 | 3300046660 | Bacteria | 23152 |
| 506 | Ga0495625_0006401 | 3300046660 | Bacteria | 10499 |
| 507 | Ga0495625_0008135 | 3300046660 | Bacteria | 8986 |
| 508 | Ga0495625_0078788 | 3300046660 | Bacteria | 2300 |
| 509 | Ga0495625_0316324 | 3300046660 | Bacteria | 995 |
| 510 | Ga0495625_0354201 | 3300046660 | Bacteria | 927 |
| 511 | Ga0495661_0001101 | 3300046665 | Bacteria | 23675 |
| 512 | Ga0495661_0002357 | 3300046665 | Bacteria | 14578 |
| 513 | Ga0495661_0197159 | 3300046665 | Bacteria | 1056 |
| 514 | Ga0495658_0031424 | 3300046683 | Unclassified | 2892 |
| 515 | Ga0495671_0043664 | 3300046692 | Bacteria | 2250 |
| 516 | Ga0495649_0000007 | 3300046694 | Bacteria | 518037 |
| 517 | Ga0495589_0075059 | 3300046794 | Bacteria | 1649 |
| 518 | Ga0495660_0005748 | 3300046810 | Bacteria | 7407 |
| 519 | Ga0495683_0075656 | 3300047323 | Bacteria | 1649 |
| 520 | Ga0495687_001260 | 3300047443 | Bacteria | 23990 |
| 521 | Ga0495687_001497 | 3300047443 | Bacteria | 21340 |
| 522 | Ga0495687_055489 | 3300047443 | Bacteria | 1656 |
| 523 | Ga0495687_109871 | 3300047443 | Bacteria | 1016 |
| 524 | Ga0495675_0326562 | 3300047444 | Bacteria | 907 |
| 525 | Ga0495679_034083 | 3300047446 | Bacteria | 1623 |
| 526 | Ga0495673_0047965 | 3300047469 | Bacteria | 1885 |
| 527 | Ga0495684_0079033 | 3300047471 | Unclassified | 2497 |
| 528 | Ga0495686_0000965 | 3300047472 | Bacteria | 35434 |
| 529 | Ga0495686_0001123 | 3300047472 | Bacteria | 31643 |
| 530 | Ga0495686_0015394 | 3300047472 | Bacteria | 5224 |
| 531 | Ga0495686_0027599 | 3300047472 | Bacteria | 3705 |
| 532 | Ga0495686_0147874 | 3300047472 | Bacteria | 1381 |
| 533 | Ga0496100_0282988 | 3300048903 | Unclassified | 1237 |
| 534 | Ga0496101_0696254 | 3300048904 | Bacteria | 802 |
| 535 | Ga0496104_0714278 | 3300048907 | Bacteria | 910 |
| 536 | Ga0496104_0754499 | 3300048907 | Bacteria | 880 |
| 537 | Ga0496108_0364577 | 3300048911 | Bacteria | 1261 |
| 538 | Ga0496109_0089044 | 3300048912 | Unclassified | 2853 |
| 539 | Ga0496109_0315683 | 3300048912 | Bacteria | 1475 |
| 540 | Ga0496114_0437231 | 3300048917 | Unclassified | 1159 |
| 541 | Ga0496115_0188000 | 3300048918 | Bacteria | 1707 |
| 542 | Ga0496121_0000051 | 3300048924 | Bacteria | 315378 |
| 543 | Ga0496126_0054588 | 3300048929 | Bacteria | 3618 |
| 544 | Ga0495678_040844 | 3300049459 | Bacteria | 1861 |
| 545 | Ga0501300_009279 | 3300049523 | Bacteria | 1436 |
| 546 | Ga0501033_0105592 | 3300049570 | Bacteria | 2053 |
| 547 | Ga0501033_0325518 | 3300049570 | Bacteria | 1079 |
| 548 | Ga0501034_0000007 | 3300049571 | Bacteria | 357805 |
| 549 | Ga0501034_0048239 | 3300049571 | Bacteria | 4298 |
| 550 | Ga0501043_0539458 | 3300049579 | Bacteria | 868 |
| 551 | Ga0501069_0130163 | 3300049585 | Bacteria | 1440 |
| 552 | Ga0501070_0175491 | 3300049586 | Bacteria | 1764 |
| 553 | Ga0501074_0017551 | 3300049590 | Bacteria | 5195 |
| 554 | Ga0501076_0989125 | 3300049592 | Bacteria | 693 |
| 555 | Ga0501223_001851 | 3300049663 | Bacteria | 4776 |
| 556 | Ga0501240_001227 | 3300049673 | Bacteria | 2443 |
| 557 | Ga0501243_009896 | 3300049675 | Unclassified | 1484 |
| 558 | Ga0501080_0158242 | 3300049742 | Bacteria | 2092 |
| 559 | Ga0501083_0042760 | 3300049744 | Bacteria | 3070 |
| 560 | Ga0501241_000377 | 3300049758 | Bacteria | 9724 |
| 561 | Ga0501044_0280459 | 3300049823 | Bacteria | 1600 |
| 562 | nmdc:mga0k408_44_c2 | 3300050493 | Bacteria | 32487 |
| 563 | nmdc:mga0k408_80_c1 | 3300050493 | Bacteria | 45357 |
| 564 | nmdc:mga07m45_148261_c1 | 3300050496 | Bacteria | 1360 |
| 565 | nmdc:mga07m45_66674_c1 | 3300050496 | Bacteria | 2045 |
| 566 | Ga0500635_0000452 | 3300053080 | Bacteria | 11825 |
| 567 | Ga0500644_0002231 | 3300053088 | Bacteria | 4887 |
| 568 | Ga0500556_0116398 | 3300053104 | Bacteria | 1040 |
| 569 | Ga0500569_000051 | 3300053109 | Bacteria | 21519 |
| 570 | Ga0500607_023581 | 3300053121 | Bacteria | 3446 |
| 571 | Ga0500608_001705 | 3300053122 | Bacteria | 7868 |
| 572 | Ga0500608_139355 | 3300053122 | Bacteria | 1078 |
| 573 | Ga0500618_000006 | 3300053125 | Bacteria | 239188 |
| 574 | Ga0500618_033030 | 3300053125 | Bacteria | 1208 |
| 575 | Ga0500658_0004833 | 3300053134 | Bacteria | 5025 |
| 576 | Ga0500561_0020371 | 3300053137 | Bacteria | 1550 |
| 577 | Ga0500577_0000576 | 3300053142 | Bacteria | 9471 |
| 578 | Ga0500590_013643 | 3300053148 | Bacteria | 4174 |
| 579 | Ga0500616_0022449 | 3300053153 | Bacteria | 3522 |
| 580 | Ga0500622_0000673 | 3300053156 | Bacteria | 30220 |
| 581 | Ga0500622_0001513 | 3300053156 | Bacteria | 18450 |
| 582 | Ga0500624_000567 | 3300053157 | Bacteria | 10211 |
| 583 | Ga0500633_0004242 | 3300053160 | Bacteria | 3263 |
| 584 | Ga0500634_0116500 | 3300053161 | Bacteria | 1308 |
| 585 | Ga0500636_0011566 | 3300053177 | Bacteria | 5167 |
| 586 | Ga0501082_0271393 | 3300060353 | Bacteria | 1476 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042014 | Ga0439457_110865 | Ga0439457_110865_26_571 | 180 |
| 2 | iso_pu_bacteria | 2890737413 | 2890740313 | 181 |
| 3 | 3300046507 | Ga0495606_0003806 | Ga0495606_0003806_8445_9095 | 190 |
| 4 | 3300047471 | Ga0495684_0079033 | Ga0495684_0079033_617_1267 | 190 |
| 5 | 3300046558 | Ga0495633_0000153 | Ga0495633_0000153_69385_70002 | 193 |
| 6 | 3300044712 | Ga0453684_0044892 | Ga0453684_0044892_5221_5835 | 198 |
| 7 | 3300038725 | Ga0400484_07716 | Ga0400484_07716_360_974 | 200 |
| 8 | 3300038726 | Ga0400490_57711 | Ga0400490_57711_1960_2574 | 200 |
| 9 | 3300038726 | Ga0400490_59015 | Ga0400490_59015_599_1213 | 200 |
| 10 | 3300005458 | Ga0070681_10376082 | Ga0070681_103760822 | 201 |
| 11 | 3300025949 | Ga0207667_11044124 | Ga0207667_110441241 | 201 |
| 12 | 3300044712 | Ga0453684_0118794 | Ga0453684_0118794_330_947 | 201 |
| 13 | iso_pu_bacteria | 2522125168 | 2522548265 | 201 |
| 14 | iso_pu_bacteria | 2599185184 | 2599480765 | 201 |
| 15 | iso_pu_bacteria | 2818991442 | 2819577217 | 201 |
| 16 | iso_pu_bacteria | 2818991460 | 2819676361 | 201 |
| 17 | iso_pu_bacteria | 2821136567 | 2821140520 | 201 |
| 18 | iso_pu_bacteria | 2840677318 | 2840679293 | 201 |
| 19 | iso_pu_bacteria | 2842903701 | 2842904847 | 201 |
| 20 | iso_pu_bacteria | 2883068021 | 2883069922 | 201 |
| 21 | iso_pu_bacteria | 2884791551 | 2884796193 | 201 |
| 22 | iso_pu_bacteria | 2884933994 | 2884934837 | 201 |
| 23 | iso_pu_bacteria | 2896085136 | 2896087104 | 201 |
| 24 | iso_pu_bacteria | 2896317667 | 2896320938 | 201 |
| 25 | iso_pu_bacteria | 2898713307 | 2898716027 | 201 |
| 26 | iso_pu_bacteria | 2904467357 | 2904472940 | 201 |
| 27 | iso_pu_bacteria | 2919437846 | 2919439933 | 201 |
| 28 | iso_pu_bacteria | 2928078545 | 2928081658 | 201 |
| 29 | iso_pu_bacteria | 2928147474 | 2928150314 | 201 |
| 30 | iso_pu_bacteria | 2929177148 | 2929178298 | 201 |
| 31 | iso_pu_bacteria | 2929239360 | 2929240599 | 201 |
| 32 | iso_pu_bacteria | 2929921140 | 2929922447 | 201 |
| 33 | iso_pu_bacteria | 2932082852 | 2932085138 | 201 |
| 34 | iso_pu_bacteria | 2945977869 | 2945980664 | 201 |
| 35 | iso_pu_bacteria | 3003233435 | 3003236487 | 201 |
| 36 | iso_pu_bacteria | 8003151029 | 8003153871 | 201 |
| 37 | iso_pu_bacteria | 8055588893 | 8055590136 | 201 |
| 38 | 3300005288 | Ga0065714_10213702 | Ga0065714_102137022 | 202 |
| 39 | 3300041459 | Ga0451800_1250505 | Ga0451800_1250505_123_731 | 202 |
| 40 | iso_pu_bacteria | 2896109856 | 2896114397 | 202 |
| 41 | 3300002077 | JGI24744J21845_10012713 | JGI24744J21845_100127132 | 203 |
| 42 | 3300005337 | Ga0070682_100033894 | Ga0070682_1000338942 | 203 |
| 43 | 3300005355 | Ga0070671_100294613 | Ga0070671_1002946131 | 203 |
| 44 | 3300005355 | Ga0070671_100727141 | Ga0070671_1007271411 | 203 |
| 45 | 3300005459 | Ga0068867_100042981 | Ga0068867_1000429813 | 203 |
| 46 | 3300005543 | Ga0070672_100835063 | Ga0070672_1008350631 | 203 |
| 47 | 3300006237 | Ga0097621_100006952 | Ga0097621_1000069522 | 203 |
| 48 | 3300006358 | Ga0068871_100001976 | Ga0068871_1000019769 | 203 |
| 49 | 3300009093 | Ga0105240_10027963 | Ga0105240_100279634 | 203 |
| 50 | 3300013296 | Ga0157374_11069221 | Ga0157374_110692211 | 203 |
| 51 | 3300013306 | Ga0163162_10873141 | Ga0163162_108731411 | 203 |
| 52 | 3300013308 | Ga0157375_10533170 | Ga0157375_105331702 | 203 |
| 53 | 3300013308 | Ga0157375_10721740 | Ga0157375_107217402 | 203 |
| 54 | 3300014326 | Ga0157380_10000011 | Ga0157380_1000001111 | 203 |
| 55 | 3300025913 | Ga0207695_10144936 | Ga0207695_101449363 | 203 |
| 56 | 3300025925 | Ga0207650_10686925 | Ga0207650_106869251 | 203 |
| 57 | 3300025986 | Ga0207658_10541593 | Ga0207658_105415932 | 203 |
| 58 | 3300026089 | Ga0207648_10014556 | Ga0207648_100145563 | 203 |
| 59 | 3300026142 | Ga0207698_10160118 | Ga0207698_101601181 | 203 |
| 60 | 3300032004 | Ga0307414_10114477 | Ga0307414_101144772 | 203 |
| 61 | 3300048912 | Ga0496109_0315683 | Ga0496109_0315683_476_1087 | 203 |
| 62 | 3300049571 | Ga0501034_0000007 | Ga0501034_0000007_73572_74195 | 203 |
| 63 | 3300005328 | Ga0070676_10012058 | Ga0070676_100120583 | 204 |
| 64 | 3300005334 | Ga0068869_100121472 | Ga0068869_1001214722 | 204 |
| 65 | 3300005335 | Ga0070666_10010165 | Ga0070666_100101656 | 204 |
| 66 | 3300005336 | Ga0070680_100023459 | Ga0070680_1000234594 | 204 |
| 67 | 3300005338 | Ga0068868_100007993 | Ga0068868_1000079934 | 204 |
| 68 | 3300005341 | Ga0070691_10099457 | Ga0070691_100994572 | 204 |
| 69 | 3300005354 | Ga0070675_100019801 | Ga0070675_1000198016 | 204 |
| 70 | 3300005355 | Ga0070671_100105996 | Ga0070671_1001059962 | 204 |
| 71 | 3300005355 | Ga0070671_100140233 | Ga0070671_1001402333 | 204 |
| 72 | 3300005364 | Ga0070673_100014307 | Ga0070673_1000143076 | 204 |
| 73 | 3300005367 | Ga0070667_100000031 | Ga0070667_1000000314 | 204 |
| 74 | 3300005458 | Ga0070681_10115268 | Ga0070681_101152682 | 204 |
| 75 | 3300005459 | Ga0068867_100012634 | Ga0068867_1000126342 | 204 |
| 76 | 3300005530 | Ga0070679_100165325 | Ga0070679_1001653252 | 204 |
| 77 | 3300005535 | Ga0070684_100447855 | Ga0070684_1004478553 | 204 |
| 78 | 3300005539 | Ga0068853_100019053 | Ga0068853_1000190532 | 204 |
| 79 | 3300005543 | Ga0070672_100005602 | Ga0070672_1000056024 | 204 |
| 80 | 3300005548 | Ga0070665_100002650 | Ga0070665_1000026501 | 204 |
| 81 | 3300005614 | Ga0068856_100966031 | Ga0068856_1009660311 | 204 |
| 82 | 3300005616 | Ga0068852_100141912 | Ga0068852_1001419122 | 204 |
| 83 | 3300005618 | Ga0068864_100006018 | Ga0068864_1000060184 | 204 |
| 84 | 3300005834 | Ga0068851_10001096 | Ga0068851_1000109613 | 204 |
| 85 | 3300005841 | Ga0068863_100018879 | Ga0068863_1000188795 | 204 |
| 86 | 3300005841 | Ga0068863_100499893 | Ga0068863_1004998932 | 204 |
| 87 | 3300005842 | Ga0068858_100021942 | Ga0068858_1000219422 | 204 |
| 88 | 3300005843 | Ga0068860_100016192 | Ga0068860_1000161924 | 204 |
| 89 | 3300005843 | Ga0068860_100243294 | Ga0068860_1002432942 | 204 |
| 90 | 3300006237 | Ga0097621_100003766 | Ga0097621_1000037664 | 204 |
| 91 | 3300006237 | Ga0097621_100010393 | Ga0097621_1000103934 | 204 |
| 92 | 3300006358 | Ga0068871_100007909 | Ga0068871_1000079094 | 204 |
| 93 | 3300006358 | Ga0068871_100012713 | Ga0068871_1000127135 | 204 |
| 94 | 3300006881 | Ga0068865_100004346 | Ga0068865_1000043462 | 204 |
| 95 | 3300009093 | Ga0105240_10025938 | Ga0105240_100259382 | 204 |
| 96 | 3300009093 | Ga0105240_10039588 | Ga0105240_100395887 | 204 |
| 97 | 3300009093 | Ga0105240_10176466 | Ga0105240_101764664 | 204 |
| 98 | 3300009098 | Ga0105245_10473657 | Ga0105245_104736572 | 204 |
| 99 | 3300009101 | Ga0105247_10027343 | Ga0105247_100273433 | 204 |
| 100 | 3300009148 | Ga0105243_10091725 | Ga0105243_100917253 | 204 |
| 101 | 3300009174 | Ga0105241_10722340 | Ga0105241_107223401 | 204 |
| 102 | 3300009176 | Ga0105242_10035688 | Ga0105242_100356882 | 204 |
| 103 | 3300009177 | Ga0105248_10046424 | Ga0105248_100464245 | 204 |
| 104 | 3300009545 | Ga0105237_10730910 | Ga0105237_107309102 | 204 |
| 105 | 3300009551 | Ga0105238_10735217 | Ga0105238_107352171 | 204 |
| 106 | 3300009553 | Ga0105249_10345667 | Ga0105249_103456672 | 204 |
| 107 | 3300010375 | Ga0105239_10188861 | Ga0105239_101888612 | 204 |
| 108 | 3300011119 | Ga0105246_10586072 | Ga0105246_105860722 | 204 |
| 109 | 3300013102 | Ga0157371_10375272 | Ga0157371_103752722 | 204 |
| 110 | 3300013104 | Ga0157370_10021907 | Ga0157370_100219077 | 204 |
| 111 | 3300013105 | Ga0157369_10718673 | Ga0157369_107186732 | 204 |
| 112 | 3300013296 | Ga0157374_10015781 | Ga0157374_100157816 | 204 |
| 113 | 3300013296 | Ga0157374_10020461 | Ga0157374_100204614 | 204 |
| 114 | 3300013297 | Ga0157378_10014751 | Ga0157378_100147512 | 204 |
| 115 | 3300013297 | Ga0157378_11352396 | Ga0157378_113523961 | 204 |
| 116 | 3300013306 | Ga0163162_10018688 | Ga0163162_100186884 | 204 |
| 117 | 3300013307 | Ga0157372_10356668 | Ga0157372_103566682 | 204 |
| 118 | 3300013307 | Ga0157372_10391523 | Ga0157372_103915232 | 204 |
| 119 | 3300013308 | Ga0157375_10023788 | Ga0157375_100237887 | 204 |
| 120 | 3300013308 | Ga0157375_10137594 | Ga0157375_101375942 | 204 |
| 121 | 3300014325 | Ga0163163_10000174 | Ga0163163_100001744 | 204 |
| 122 | 3300014325 | Ga0163163_10474446 | Ga0163163_104744462 | 204 |
| 123 | 3300014968 | Ga0157379_10007490 | Ga0157379_100074903 | 204 |
| 124 | 3300014968 | Ga0157379_10015024 | Ga0157379_100150242 | 204 |
| 125 | 3300014968 | Ga0157379_10375806 | Ga0157379_103758062 | 204 |
| 126 | 3300014969 | Ga0157376_10029662 | Ga0157376_100296624 | 204 |
| 127 | 3300014969 | Ga0157376_10144501 | Ga0157376_101445013 | 204 |
| 128 | 3300017792 | Ga0163161_10009734 | Ga0163161_100097342 | 204 |
| 129 | 3300025315 | Ga0207697_10037886 | Ga0207697_100378862 | 204 |
| 130 | 3300025321 | Ga0207656_10045330 | Ga0207656_100453302 | 204 |
| 131 | 3300025903 | Ga0207680_10005574 | Ga0207680_100055742 | 204 |
| 132 | 3300025907 | Ga0207645_10011365 | Ga0207645_100113653 | 204 |
| 133 | 3300025911 | Ga0207654_10041602 | Ga0207654_100416023 | 204 |
| 134 | 3300025912 | Ga0207707_10016419 | Ga0207707_100164196 | 204 |
| 135 | 3300025913 | Ga0207695_10030928 | Ga0207695_100309286 | 204 |
| 136 | 3300025913 | Ga0207695_10111298 | Ga0207695_101112982 | 204 |
| 137 | 3300025913 | Ga0207695_10120103 | Ga0207695_101201033 | 204 |
| 138 | 3300025917 | Ga0207660_10007186 | Ga0207660_100071868 | 204 |
| 139 | 3300025919 | Ga0207657_10146379 | Ga0207657_101463792 | 204 |
| 140 | 3300025921 | Ga0207652_10015048 | Ga0207652_100150482 | 204 |
| 141 | 3300025927 | Ga0207687_10309619 | Ga0207687_103096192 | 204 |
| 142 | 3300025934 | Ga0207686_10417597 | Ga0207686_104175971 | 204 |
| 143 | 3300025938 | Ga0207704_10045232 | Ga0207704_100452323 | 204 |
| 144 | 3300025940 | Ga0207691_10027168 | Ga0207691_100271686 | 204 |
| 145 | 3300025941 | Ga0207711_10096689 | Ga0207711_100966891 | 204 |
| 146 | 3300025942 | Ga0207689_10074538 | Ga0207689_100745383 | 204 |
| 147 | 3300025960 | Ga0207651_10008410 | Ga0207651_100084102 | 204 |
| 148 | 3300025961 | Ga0207712_10209949 | Ga0207712_102099492 | 204 |
| 149 | 3300025972 | Ga0207668_10000298 | Ga0207668_100002984 | 204 |
| 150 | 3300025986 | Ga0207658_10013104 | Ga0207658_100131041 | 204 |
| 151 | 3300026023 | Ga0207677_10004006 | Ga0207677_100040064 | 204 |
| 152 | 3300026035 | Ga0207703_10006892 | Ga0207703_100068928 | 204 |
| 153 | 3300026041 | Ga0207639_10015040 | Ga0207639_100150402 | 204 |
| 154 | 3300026088 | Ga0207641_10009560 | Ga0207641_100095604 | 204 |
| 155 | 3300026088 | Ga0207641_10477571 | Ga0207641_104775711 | 204 |
| 156 | 3300026089 | Ga0207648_10031381 | Ga0207648_100313812 | 204 |
| 157 | 3300026095 | Ga0207676_10003554 | Ga0207676_1000355412 | 204 |
| 158 | 3300026142 | Ga0207698_10021199 | Ga0207698_100211992 | 204 |
| 159 | 3300026142 | Ga0207698_10760698 | Ga0207698_107606981 | 204 |
| 160 | 3300028379 | Ga0268266_10013819 | Ga0268266_100138197 | 204 |
| 161 | 3300028381 | Ga0268264_10003219 | Ga0268264_100032192 | 204 |
| 162 | 3300028381 | Ga0268264_10399178 | Ga0268264_103991782 | 204 |
| 163 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012150 | 204 |
| 164 | 3300031548 | Ga0307408_100000393 | Ga0307408_10000039323 | 204 |
| 165 | 3300031911 | Ga0307412_10064186 | Ga0307412_100641862 | 204 |
| 166 | 3300035172 | Ga0373955_0209888 | Ga0373955_0209888_41_667 | 204 |
| 167 | 3300035410 | Ga0373924_0048357 | Ga0373924_0048357_223_918 | 204 |
| 168 | 3300036401 | Ga0373937_0009187 | Ga0373937_0009187_104_721 | 204 |
| 169 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_313034_313669 | 204 |
| 170 | 3300046459 | Ga0495629_0120850 | Ga0495629_0120850_1036_1653 | 204 |
| 171 | 3300046514 | Ga0495618_0544228 | Ga0495618_0544228_21_638 | 204 |
| 172 | 3300046517 | Ga0495630_0018405 | Ga0495630_0018405_13_708 | 204 |
| 173 | 3300046531 | Ga0495665_0248059 | Ga0495665_0248059_75_692 | 204 |
| 174 | 3300046533 | Ga0495640_0217158 | Ga0495640_0217158_262_879 | 204 |
| 175 | 3300046543 | Ga0495645_0586458 | Ga0495645_0586458_43_663 | 204 |
| 176 | 3300046558 | Ga0495633_0034954 | Ga0495633_0034954_793_1410 | 204 |
| 177 | 3300046683 | Ga0495658_0031424 | Ga0495658_0031424_293_910 | 204 |
| 178 | 3300047444 | Ga0495675_0326562 | Ga0495675_0326562_236_853 | 204 |
| 179 | 3300048903 | Ga0496100_0282988 | Ga0496100_0282988_294_941 | 204 |
| 180 | 3300048907 | Ga0496104_0714278 | Ga0496104_0714278_244_861 | 204 |
| 181 | 3300048907 | Ga0496104_0754499 | Ga0496104_0754499_99_725 | 204 |
| 182 | 3300048911 | Ga0496108_0364577 | Ga0496108_0364577_458_1075 | 204 |
| 183 | 3300048912 | Ga0496109_0089044 | Ga0496109_0089044_89_706 | 204 |
| 184 | 3300048917 | Ga0496114_0437231 | Ga0496114_0437231_438_1055 | 204 |
| 185 | 3300048918 | Ga0496115_0188000 | Ga0496115_0188000_563_1189 | 204 |
| 186 | 3300049570 | Ga0501033_0105592 | Ga0501033_0105592_1261_1884 | 204 |
| 187 | 3300049579 | Ga0501043_0539458 | Ga0501043_0539458_35_664 | 204 |
| 188 | 3300049585 | Ga0501069_0130163 | Ga0501069_0130163_463_1092 | 204 |
| 189 | 3300049586 | Ga0501070_0175491 | Ga0501070_0175491_110_739 | 204 |
| 190 | 3300049590 | Ga0501074_0017551 | Ga0501074_0017551_1728_2357 | 204 |
| 191 | 3300049592 | Ga0501076_0989125 | Ga0501076_0989125_44_673 | 204 |
| 192 | 3300049742 | Ga0501080_0158242 | Ga0501080_0158242_514_1140 | 204 |
| 193 | 3300049744 | Ga0501083_0042760 | Ga0501083_0042760_24_650 | 204 |
| 194 | 3300049823 | Ga0501044_0280459 | Ga0501044_0280459_952_1581 | 204 |
| 195 | 3300060353 | Ga0501082_0271393 | Ga0501082_0271393_210_836 | 204 |
| 196 | 3300001979 | JGI24740J21852_10007285 | JGI24740J21852_100072852 | 205 |
| 197 | 3300001989 | JGI24739J22299_10028909 | JGI24739J22299_100289093 | 205 |
| 198 | 3300001990 | JGI24737J22298_10003208 | JGI24737J22298_100032085 | 205 |
| 199 | 3300001990 | JGI24737J22298_10035536 | JGI24737J22298_100355362 | 205 |
| 200 | 3300002067 | JGI24735J21928_10000093 | JGI24735J21928_1000009311 | 205 |
| 201 | 3300002737 | JGI25162J39368_1000008 | JGI25162J39368_1000008356 | 205 |
| 202 | 3300002737 | JGI25162J39368_1000097 | JGI25162J39368_100009711 | 205 |
| 203 | 3300002737 | JGI25162J39368_1001750 | JGI25162J39368_10017504 | 205 |
| 204 | 3300002738 | JGI25154J39366_1000021 | JGI25154J39366_1000021128 | 205 |
| 205 | 3300002741 | JGI25157J39369_1013421 | JGI25157J39369_10134211 | 205 |
| 206 | 3300002772 | JGI25164J39214_1002319 | JGI25164J39214_10023193 | 205 |
| 207 | 3300003214 | JGI25165J46597_1001806 | JGI25165J46597_10018061 | 205 |
| 208 | 3300003316 | rootH1_10051127 | rootH1_100511273 | 205 |
| 209 | 3300003320 | rootH2_10001273 | rootH2_100012739 | 205 |
| 210 | 3300003320 | rootH2_10015677 | rootH2_100156775 | 205 |
| 211 | 3300003320 | rootH2_10207088 | rootH2_102070882 | 205 |
| 212 | 3300003320 | rootH2_10241535 | rootH2_102415352 | 205 |
| 213 | 3300003320 | rootH2_10323976 | rootH2_103239762 | 205 |
| 214 | 3300003322 | rootL2_10071036 | rootL2_100710364 | 205 |
| 215 | 3300003322 | rootL2_10128366 | rootL2_101283662 | 205 |
| 216 | 3300003322 | rootL2_10211313 | rootL2_102113131 | 205 |
| 217 | 3300003323 | rootH1_10000975 | rootH1_100009757 | 205 |
| 218 | 3300003323 | rootH1_10009825 | rootH1_100098256 | 205 |
| 219 | 3300003323 | rootH1_10035177 | rootH1_100351775 | 205 |
| 220 | 3300003323 | rootH1_10035178 | rootH1_100351782 | 205 |
| 221 | 3300003323 | rootH1_10136596 | rootH1_101365962 | 205 |
| 222 | 3300003354 | JGI25160J50197_1023819 | JGI25160J50197_10238192 | 205 |
| 223 | 3300003761 | Ga0055535_1004402 | Ga0055535_10044023 | 205 |
| 224 | 3300003762 | Ga0055542_1007561 | Ga0055542_10075613 | 205 |
| 225 | 3300003781 | Ga0055536_1016448 | Ga0055536_10164483 | 205 |
| 226 | 3300003794 | Ga0055531_10000092 | Ga0055531_1000009231 | 205 |
| 227 | 3300004625 | Ga0055543_1021073 | Ga0055543_10210732 | 205 |
| 228 | 3300004799 | Ga0058863_11443821 | Ga0058863_114438213 | 205 |
| 229 | 3300005262 | Ga0065165_1000060 | Ga0065165_100006099 | 205 |
| 230 | 3300005288 | Ga0065714_10026122 | Ga0065714_100261222 | 205 |
| 231 | 3300005288 | Ga0065714_10067802 | Ga0065714_100678027 | 205 |
| 232 | 3300005327 | Ga0070658_10000675 | Ga0070658_1000067523 | 205 |
| 233 | 3300005327 | Ga0070658_10059384 | Ga0070658_100593842 | 205 |
| 234 | 3300005328 | Ga0070676_10000573 | Ga0070676_100005738 | 205 |
| 235 | 3300005331 | Ga0070670_100499261 | Ga0070670_1004992612 | 205 |
| 236 | 3300005336 | Ga0070680_100040616 | Ga0070680_1000406162 | 205 |
| 237 | 3300005336 | Ga0070680_100553862 | Ga0070680_1005538621 | 205 |
| 238 | 3300005339 | Ga0070660_100545149 | Ga0070660_1005451491 | 205 |
| 239 | 3300005339 | Ga0070660_100602064 | Ga0070660_1006020642 | 205 |
| 240 | 3300005344 | Ga0070661_100629605 | Ga0070661_1006296051 | 205 |
| 241 | 3300005355 | Ga0070671_100017095 | Ga0070671_1000170953 | 205 |
| 242 | 3300005355 | Ga0070671_100799075 | Ga0070671_1007990751 | 205 |
| 243 | 3300005364 | Ga0070673_100066919 | Ga0070673_1000669193 | 205 |
| 244 | 3300005364 | Ga0070673_100398659 | Ga0070673_1003986592 | 205 |
| 245 | 3300005366 | Ga0070659_100003641 | Ga0070659_1000036419 | 205 |
| 246 | 3300005366 | Ga0070659_100167730 | Ga0070659_1001677302 | 205 |
| 247 | 3300005455 | Ga0070663_100240630 | Ga0070663_1002406303 | 205 |
| 248 | 3300005457 | Ga0070662_100002625 | Ga0070662_1000026252 | 205 |
| 249 | 3300005458 | Ga0070681_10015787 | Ga0070681_100157876 | 205 |
| 250 | 3300005459 | Ga0068867_100001804 | Ga0068867_10000180412 | 205 |
| 251 | 3300005530 | Ga0070679_100081468 | Ga0070679_1000814682 | 205 |
| 252 | 3300005539 | Ga0068853_100010363 | Ga0068853_1000103634 | 205 |
| 253 | 3300005539 | Ga0068853_100046477 | Ga0068853_1000464773 | 205 |
| 254 | 3300005539 | Ga0068853_100105460 | Ga0068853_1001054604 | 205 |
| 255 | 3300005539 | Ga0068853_100256849 | Ga0068853_1002568492 | 205 |
| 256 | 3300005539 | Ga0068853_100830848 | Ga0068853_1008308482 | 205 |
| 257 | 3300005548 | Ga0070665_100000017 | Ga0070665_10000001762 | 205 |
| 258 | 3300005563 | Ga0068855_100000021 | Ga0068855_100000021175 | 205 |
| 259 | 3300005563 | Ga0068855_100001368 | Ga0068855_10000136824 | 205 |
| 260 | 3300005563 | Ga0068855_100144084 | Ga0068855_1001440843 | 205 |
| 261 | 3300005563 | Ga0068855_100163887 | Ga0068855_1001638872 | 205 |
| 262 | 3300005563 | Ga0068855_100306528 | Ga0068855_1003065282 | 205 |
| 263 | 3300005563 | Ga0068855_100438346 | Ga0068855_1004383462 | 205 |
| 264 | 3300005563 | Ga0068855_100574291 | Ga0068855_1005742912 | 205 |
| 265 | 3300005563 | Ga0068855_100922152 | Ga0068855_1009221522 | 205 |
| 266 | 3300005563 | Ga0068855_101055044 | Ga0068855_1010550441 | 205 |
| 267 | 3300005577 | Ga0068857_100056246 | Ga0068857_1000562463 | 205 |
| 268 | 3300005577 | Ga0068857_100076675 | Ga0068857_1000766753 | 205 |
| 269 | 3300005577 | Ga0068857_100128053 | Ga0068857_1001280532 | 205 |
| 270 | 3300005578 | Ga0068854_100113235 | Ga0068854_1001132352 | 205 |
| 271 | 3300005614 | Ga0068856_100000006 | Ga0068856_10000000686 | 205 |
| 272 | 3300005614 | Ga0068856_100004027 | Ga0068856_1000040278 | 205 |
| 273 | 3300005614 | Ga0068856_100036749 | Ga0068856_1000367494 | 205 |
| 274 | 3300005614 | Ga0068856_100050093 | Ga0068856_1000500933 | 205 |
| 275 | 3300005614 | Ga0068856_100339350 | Ga0068856_1003393502 | 205 |
| 276 | 3300005614 | Ga0068856_100604468 | Ga0068856_1006044682 | 205 |
| 277 | 3300005614 | Ga0068856_100972375 | Ga0068856_1009723751 | 205 |
| 278 | 3300005616 | Ga0068852_100005157 | Ga0068852_1000051574 | 205 |
| 279 | 3300005616 | Ga0068852_100215680 | Ga0068852_1002156801 | 205 |
| 280 | 3300005617 | Ga0068859_100000451 | Ga0068859_1000004514 | 205 |
| 281 | 3300005618 | Ga0068864_100514509 | Ga0068864_1005145092 | 205 |
| 282 | 3300005718 | Ga0068866_10183668 | Ga0068866_101836682 | 205 |
| 283 | 3300005841 | Ga0068863_100039830 | Ga0068863_1000398303 | 205 |
| 284 | 3300005842 | Ga0068858_100389251 | Ga0068858_1003892512 | 205 |
| 285 | 3300006173 | Ga0070716_100430837 | Ga0070716_1004308371 | 205 |
| 286 | 3300006195 | Ga0075366_10000019 | Ga0075366_1000001938 | 205 |
| 287 | 3300006195 | Ga0075366_10000496 | Ga0075366_1000049612 | 205 |
| 288 | 3300006195 | Ga0075366_10000779 | Ga0075366_100007793 | 205 |
| 289 | 3300006237 | Ga0097621_100006550 | Ga0097621_1000065502 | 205 |
| 290 | 3300006353 | Ga0075370_10089453 | Ga0075370_100894533 | 205 |
| 291 | 3300006353 | Ga0075370_10205516 | Ga0075370_102055162 | 205 |
| 292 | 3300006358 | Ga0068871_100000491 | Ga0068871_1000004912 | 205 |
| 293 | 3300006881 | Ga0068865_100000070 | Ga0068865_10000007025 | 205 |
| 294 | 3300006931 | Ga0097620_100000451 | Ga0097620_10000045136 | 205 |
| 295 | 3300009093 | Ga0105240_10000083 | Ga0105240_10000083115 | 205 |
| 296 | 3300009093 | Ga0105240_10008396 | Ga0105240_100083968 | 205 |
| 297 | 3300009093 | Ga0105240_10083621 | Ga0105240_100836213 | 205 |
| 298 | 3300009093 | Ga0105240_10225835 | Ga0105240_102258351 | 205 |
| 299 | 3300009093 | Ga0105240_10269418 | Ga0105240_102694182 | 205 |
| 300 | 3300009093 | Ga0105240_10296890 | Ga0105240_102968902 | 205 |
| 301 | 3300009093 | Ga0105240_10361767 | Ga0105240_103617671 | 205 |
| 302 | 3300009093 | Ga0105240_10385162 | Ga0105240_103851622 | 205 |
| 303 | 3300009093 | Ga0105240_10495934 | Ga0105240_104959342 | 205 |
| 304 | 3300009093 | Ga0105240_10511430 | Ga0105240_105114302 | 205 |
| 305 | 3300009093 | Ga0105240_10857896 | Ga0105240_108578961 | 205 |
| 306 | 3300009093 | Ga0105240_11244867 | Ga0105240_112448671 | 205 |
| 307 | 3300009093 | Ga0105240_11247030 | Ga0105240_112470301 | 205 |
| 308 | 3300009098 | Ga0105245_10958546 | Ga0105245_109585461 | 205 |
| 309 | 3300009174 | Ga0105241_10005957 | Ga0105241_100059575 | 205 |
| 310 | 3300009174 | Ga0105241_10015143 | Ga0105241_100151436 | 205 |
| 311 | 3300009176 | Ga0105242_10023716 | Ga0105242_100237165 | 205 |
| 312 | 3300009176 | Ga0105242_11291975 | Ga0105242_112919751 | 205 |
| 313 | 3300009545 | Ga0105237_10000138 | Ga0105237_100001389 | 205 |
| 314 | 3300009545 | Ga0105237_10002154 | Ga0105237_100021545 | 205 |
| 315 | 3300009545 | Ga0105237_10007680 | Ga0105237_1000768011 | 205 |
| 316 | 3300009545 | Ga0105237_10008458 | Ga0105237_1000845810 | 205 |
| 317 | 3300009545 | Ga0105237_10053901 | Ga0105237_100539015 | 205 |
| 318 | 3300009545 | Ga0105237_10141157 | Ga0105237_101411572 | 205 |
| 319 | 3300009545 | Ga0105237_10240923 | Ga0105237_102409232 | 205 |
| 320 | 3300009545 | Ga0105237_10272179 | Ga0105237_102721792 | 205 |
| 321 | 3300009545 | Ga0105237_10689663 | Ga0105237_106896632 | 205 |
| 322 | 3300009551 | Ga0105238_10005277 | Ga0105238_100052779 | 205 |
| 323 | 3300009551 | Ga0105238_10105278 | Ga0105238_101052783 | 205 |
| 324 | 3300009551 | Ga0105238_10230185 | Ga0105238_102301853 | 205 |
| 325 | 3300009551 | Ga0105238_10969985 | Ga0105238_109699852 | 205 |
| 326 | 3300009553 | Ga0105249_10472583 | Ga0105249_104725832 | 205 |
| 327 | 3300010375 | Ga0105239_10000026 | Ga0105239_10000026170 | 205 |
| 328 | 3300010375 | Ga0105239_10000130 | Ga0105239_1000013030 | 205 |
| 329 | 3300010375 | Ga0105239_10002143 | Ga0105239_100021435 | 205 |
| 330 | 3300010375 | Ga0105239_10012139 | Ga0105239_100121392 | 205 |
| 331 | 3300010375 | Ga0105239_10025142 | Ga0105239_100251423 | 205 |
| 332 | 3300010375 | Ga0105239_10100768 | Ga0105239_101007683 | 205 |
| 333 | 3300010375 | Ga0105239_10137613 | Ga0105239_101376133 | 205 |
| 334 | 3300010375 | Ga0105239_10152826 | Ga0105239_101528263 | 205 |
| 335 | 3300010375 | Ga0105239_10354620 | Ga0105239_103546202 | 205 |
| 336 | 3300010375 | Ga0105239_10424527 | Ga0105239_104245272 | 205 |
| 337 | 3300010375 | Ga0105239_10666606 | Ga0105239_106666062 | 205 |
| 338 | 3300010375 | Ga0105239_10688901 | Ga0105239_106889011 | 205 |
| 339 | 3300010375 | Ga0105239_11200131 | Ga0105239_112001312 | 205 |
| 340 | 3300011119 | Ga0105246_10253392 | Ga0105246_102533922 | 205 |
| 341 | 3300011119 | Ga0105246_10395036 | Ga0105246_103950362 | 205 |
| 342 | 3300013100 | Ga0157373_10000057 | Ga0157373_1000005781 | 205 |
| 343 | 3300013100 | Ga0157373_10487969 | Ga0157373_104879691 | 205 |
| 344 | 3300013102 | Ga0157371_10000480 | Ga0157371_1000048030 | 205 |
| 345 | 3300013102 | Ga0157371_10015232 | Ga0157371_100152327 | 205 |
| 346 | 3300013102 | Ga0157371_10044041 | Ga0157371_100440413 | 205 |
| 347 | 3300013102 | Ga0157371_10362593 | Ga0157371_103625932 | 205 |
| 348 | 3300013104 | Ga0157370_10015989 | Ga0157370_100159895 | 205 |
| 349 | 3300013104 | Ga0157370_10018014 | Ga0157370_100180147 | 205 |
| 350 | 3300013104 | Ga0157370_10085253 | Ga0157370_100852533 | 205 |
| 351 | 3300013104 | Ga0157370_10162454 | Ga0157370_101624544 | 205 |
| 352 | 3300013104 | Ga0157370_10260024 | Ga0157370_102600242 | 205 |
| 353 | 3300013105 | Ga0157369_10000301 | Ga0157369_1000030139 | 205 |
| 354 | 3300013105 | Ga0157369_10271904 | Ga0157369_102719042 | 205 |
| 355 | 3300013105 | Ga0157369_10391029 | Ga0157369_103910292 | 205 |
| 356 | 3300013296 | Ga0157374_10002863 | Ga0157374_100028638 | 205 |
| 357 | 3300013296 | Ga0157374_10003120 | Ga0157374_100031208 | 205 |
| 358 | 3300013296 | Ga0157374_10008123 | Ga0157374_100081232 | 205 |
| 359 | 3300013296 | Ga0157374_10201079 | Ga0157374_102010792 | 205 |
| 360 | 3300013296 | Ga0157374_10321735 | Ga0157374_103217352 | 205 |
| 361 | 3300013297 | Ga0157378_10007469 | Ga0157378_100074693 | 205 |
| 362 | 3300013297 | Ga0157378_10343634 | Ga0157378_103436342 | 205 |
| 363 | 3300013306 | Ga0163162_10000026 | Ga0163162_10000026101 | 205 |
| 364 | 3300013306 | Ga0163162_10011373 | Ga0163162_100113736 | 205 |
| 365 | 3300013306 | Ga0163162_10024812 | Ga0163162_100248125 | 205 |
| 366 | 3300013306 | Ga0163162_11575775 | Ga0163162_115757751 | 205 |
| 367 | 3300013307 | Ga0157372_10000037 | Ga0157372_10000037110 | 205 |
| 368 | 3300013307 | Ga0157372_10000158 | Ga0157372_100001587 | 205 |
| 369 | 3300013307 | Ga0157372_10006525 | Ga0157372_100065258 | 205 |
| 370 | 3300013307 | Ga0157372_10188347 | Ga0157372_101883473 | 205 |
| 371 | 3300013307 | Ga0157372_10290738 | Ga0157372_102907382 | 205 |
| 372 | 3300013307 | Ga0157372_10310872 | Ga0157372_103108723 | 205 |
| 373 | 3300013308 | Ga0157375_10111239 | Ga0157375_101112393 | 205 |
| 374 | 3300013308 | Ga0157375_10164228 | Ga0157375_101642284 | 205 |
| 375 | 3300013308 | Ga0157375_10296764 | Ga0157375_102967643 | 205 |
| 376 | 3300013308 | Ga0157375_10779700 | Ga0157375_107797002 | 205 |
| 377 | 3300014325 | Ga0163163_10102441 | Ga0163163_101024412 | 205 |
| 378 | 3300014745 | Ga0157377_10288539 | Ga0157377_102885392 | 205 |
| 379 | 3300015265 | Ga0182005_1000042 | Ga0182005_100004274 | 205 |
| 380 | 3300017792 | Ga0163161_10277896 | Ga0163161_102778962 | 205 |
| 381 | 3300025208 | Ga0209436_104712 | Ga0209436_1047122 | 205 |
| 382 | 3300025231 | Ga0207427_100083 | Ga0207427_100083104 | 205 |
| 383 | 3300025233 | Ga0209437_100021 | Ga0209437_100021363 | 205 |
| 384 | 3300025233 | Ga0209437_100030 | Ga0209437_10003089 | 205 |
| 385 | 3300025242 | Ga0209258_100032 | Ga0209258_10003210 | 205 |
| 386 | 3300025246 | Ga0209646_1000050 | Ga0209646_1000050126 | 205 |
| 387 | 3300025250 | Ga0209026_1000195 | Ga0209026_100019553 | 205 |
| 388 | 3300025250 | Ga0209026_1001818 | Ga0209026_10018187 | 205 |
| 389 | 3300025250 | Ga0209026_1007931 | Ga0209026_10079313 | 205 |
| 390 | 3300025254 | Ga0209148_1000167 | Ga0209148_1000167125 | 205 |
| 391 | 3300025261 | Ga0209233_1000035 | Ga0209233_1000035275 | 205 |
| 392 | 3300025261 | Ga0209233_1002780 | Ga0209233_10027802 | 205 |
| 393 | 3300025272 | Ga0209455_1004639 | Ga0209455_10046393 | 205 |
| 394 | 3300025284 | Ga0209130_1006047 | Ga0209130_10060473 | 205 |
| 395 | 3300025292 | Ga0209676_1000351 | Ga0209676_100035133 | 205 |
| 396 | 3300025302 | Ga0207426_1000250 | Ga0207426_100025025 | 205 |
| 397 | 3300025302 | Ga0207426_1005879 | Ga0207426_10058794 | 205 |
| 398 | 3300025304 | Ga0209257_1000128 | Ga0209257_100012864 | 205 |
| 399 | 3300025899 | Ga0207642_10354547 | Ga0207642_103545471 | 205 |
| 400 | 3300025904 | Ga0207647_10002483 | Ga0207647_100024838 | 205 |
| 401 | 3300025904 | Ga0207647_10014044 | Ga0207647_100140444 | 205 |
| 402 | 3300025907 | Ga0207645_10002024 | Ga0207645_1000202410 | 205 |
| 403 | 3300025909 | Ga0207705_10000035 | Ga0207705_10000035198 | 205 |
| 404 | 3300025909 | Ga0207705_10342794 | Ga0207705_103427941 | 205 |
| 405 | 3300025911 | Ga0207654_10021925 | Ga0207654_100219252 | 205 |
| 406 | 3300025912 | Ga0207707_10009099 | Ga0207707_100090993 | 205 |
| 407 | 3300025913 | Ga0207695_10000127 | Ga0207695_10000127114 | 205 |
| 408 | 3300025913 | Ga0207695_10006085 | Ga0207695_1000608511 | 205 |
| 409 | 3300025913 | Ga0207695_10012308 | Ga0207695_100123084 | 205 |
| 410 | 3300025913 | Ga0207695_10042968 | Ga0207695_100429682 | 205 |
| 411 | 3300025913 | Ga0207695_10218518 | Ga0207695_102185182 | 205 |
| 412 | 3300025913 | Ga0207695_10221844 | Ga0207695_102218443 | 205 |
| 413 | 3300025913 | Ga0207695_10356529 | Ga0207695_103565291 | 205 |
| 414 | 3300025913 | Ga0207695_10616676 | Ga0207695_106166762 | 205 |
| 415 | 3300025914 | Ga0207671_10001040 | Ga0207671_1000104021 | 205 |
| 416 | 3300025914 | Ga0207671_10004045 | Ga0207671_100040459 | 205 |
| 417 | 3300025914 | Ga0207671_10004973 | Ga0207671_100049738 | 205 |
| 418 | 3300025914 | Ga0207671_10030893 | Ga0207671_100308935 | 205 |
| 419 | 3300025914 | Ga0207671_10131153 | Ga0207671_101311531 | 205 |
| 420 | 3300025914 | Ga0207671_10142188 | Ga0207671_101421882 | 205 |
| 421 | 3300025914 | Ga0207671_10159797 | Ga0207671_101597972 | 205 |
| 422 | 3300025914 | Ga0207671_10453620 | Ga0207671_104536202 | 205 |
| 423 | 3300025917 | Ga0207660_10026645 | Ga0207660_100266452 | 205 |
| 424 | 3300025917 | Ga0207660_10080911 | Ga0207660_100809112 | 205 |
| 425 | 3300025919 | Ga0207657_10043324 | Ga0207657_100433247 | 205 |
| 426 | 3300025919 | Ga0207657_10533985 | Ga0207657_105339851 | 205 |
| 427 | 3300025921 | Ga0207652_10020517 | Ga0207652_100205176 | 205 |
| 428 | 3300025921 | Ga0207652_10081881 | Ga0207652_100818812 | 205 |
| 429 | 3300025924 | Ga0207694_10156594 | Ga0207694_101565942 | 205 |
| 430 | 3300025924 | Ga0207694_10737240 | Ga0207694_107372401 | 205 |
| 431 | 3300025927 | Ga0207687_10958611 | Ga0207687_109586111 | 205 |
| 432 | 3300025931 | Ga0207644_10033864 | Ga0207644_100338643 | 205 |
| 433 | 3300025932 | Ga0207690_10007346 | Ga0207690_100073461 | 205 |
| 434 | 3300025932 | Ga0207690_10014185 | Ga0207690_100141854 | 205 |
| 435 | 3300025933 | Ga0207706_10000662 | Ga0207706_1000066234 | 205 |
| 436 | 3300025934 | Ga0207686_10005823 | Ga0207686_100058235 | 205 |
| 437 | 3300025938 | Ga0207704_10002226 | Ga0207704_100022268 | 205 |
| 438 | 3300025949 | Ga0207667_10000014 | Ga0207667_10000014384 | 205 |
| 439 | 3300025949 | Ga0207667_10007695 | Ga0207667_100076956 | 205 |
| 440 | 3300025949 | Ga0207667_10036206 | Ga0207667_100362065 | 205 |
| 441 | 3300025949 | Ga0207667_10058276 | Ga0207667_100582763 | 205 |
| 442 | 3300025949 | Ga0207667_10083618 | Ga0207667_100836183 | 205 |
| 443 | 3300025949 | Ga0207667_10285852 | Ga0207667_102858522 | 205 |
| 444 | 3300025949 | Ga0207667_10643442 | Ga0207667_106434422 | 205 |
| 445 | 3300025960 | Ga0207651_10117250 | Ga0207651_101172503 | 205 |
| 446 | 3300025981 | Ga0207640_10012943 | Ga0207640_100129434 | 205 |
| 447 | 3300026023 | Ga0207677_10048362 | Ga0207677_100483623 | 205 |
| 448 | 3300026035 | Ga0207703_10603794 | Ga0207703_106037942 | 205 |
| 449 | 3300026041 | Ga0207639_10035563 | Ga0207639_100355633 | 205 |
| 450 | 3300026041 | Ga0207639_10143870 | Ga0207639_101438702 | 205 |
| 451 | 3300026067 | Ga0207678_10078612 | Ga0207678_100786123 | 205 |
| 452 | 3300026078 | Ga0207702_10000023 | Ga0207702_1000002370 | 205 |
| 453 | 3300026078 | Ga0207702_10031631 | Ga0207702_100316312 | 205 |
| 454 | 3300026078 | Ga0207702_10082404 | Ga0207702_100824042 | 205 |
| 455 | 3300026078 | Ga0207702_10447935 | Ga0207702_104479352 | 205 |
| 456 | 3300026078 | Ga0207702_10647746 | Ga0207702_106477462 | 205 |
| 457 | 3300026088 | Ga0207641_10189673 | Ga0207641_101896731 | 205 |
| 458 | 3300026089 | Ga0207648_10004191 | Ga0207648_100041912 | 205 |
| 459 | 3300026116 | Ga0207674_10013741 | Ga0207674_100137419 | 205 |
| 460 | 3300026116 | Ga0207674_10072401 | Ga0207674_100724013 | 205 |
| 461 | 3300026116 | Ga0207674_10150075 | Ga0207674_101500752 | 205 |
| 462 | 3300026116 | Ga0207674_10278262 | Ga0207674_102782622 | 205 |
| 463 | 3300026121 | Ga0207683_10008462 | Ga0207683_100084623 | 205 |
| 464 | 3300026142 | Ga0207698_10434757 | Ga0207698_104347572 | 205 |
| 465 | 3300028379 | Ga0268266_10000037 | Ga0268266_10000037252 | 205 |
| 466 | 3300028381 | Ga0268264_10982095 | Ga0268264_109820951 | 205 |
| 467 | 3300028577 | Ga0265318_10009572 | Ga0265318_100095722 | 205 |
| 468 | 3300028786 | Ga0307517_10001388 | Ga0307517_1000138844 | 205 |
| 469 | 3300028794 | Ga0307515_10000077 | Ga0307515_10000077156 | 205 |
| 470 | 3300028794 | Ga0307515_10026002 | Ga0307515_100260022 | 205 |
| 471 | 3300028794 | Ga0307515_10049654 | Ga0307515_100496546 | 205 |
| 472 | 3300030731 | Ga0316177_1098816 | Ga0316177_10988166 | 205 |
| 473 | 3300030732 | Ga0316176_1004700 | Ga0316176_100470011 | 205 |
| 474 | 3300030742 | Ga0316183_1113144 | Ga0316183_11131446 | 205 |
| 475 | 3300030744 | Ga0316181_1257111 | Ga0316181_12571115 | 205 |
| 476 | 3300031548 | Ga0307408_100000487 | Ga0307408_1000004872 | 205 |
| 477 | 3300031548 | Ga0307408_101299621 | Ga0307408_1012996211 | 205 |
| 478 | 3300031727 | Ga0316576_10314937 | Ga0316576_103149372 | 205 |
| 479 | 3300031731 | Ga0307405_10002557 | Ga0307405_100025574 | 205 |
| 480 | 3300031731 | Ga0307405_10015289 | Ga0307405_100152892 | 205 |
| 481 | 3300031911 | Ga0307412_10005666 | Ga0307412_100056667 | 205 |
| 482 | 3300031911 | Ga0307412_10384576 | Ga0307412_103845762 | 205 |
| 483 | 3300032004 | Ga0307414_10019467 | Ga0307414_100194676 | 205 |
| 484 | 3300032004 | Ga0307414_10097463 | Ga0307414_100974633 | 205 |
| 485 | 3300032004 | Ga0307414_10377740 | Ga0307414_103777402 | 205 |
| 486 | 3300032004 | Ga0307414_10418473 | Ga0307414_104184732 | 205 |
| 487 | 3300032004 | Ga0307414_11116377 | Ga0307414_111163771 | 205 |
| 488 | 3300032005 | Ga0307411_10080200 | Ga0307411_100802003 | 205 |
| 489 | 3300033179 | Ga0307507_10000143 | Ga0307507_100001432 | 205 |
| 490 | 3300033180 | Ga0307510_10003117 | Ga0307510_1000311717 | 205 |
| 491 | 3300037312 | Ga0395899_0000280 | Ga0395899_0000280_19136_19768 | 205 |
| 492 | 3300037312 | Ga0395899_0000793 | Ga0395899_0000793_19605_20225 | 205 |
| 493 | 3300037312 | Ga0395899_0025586 | Ga0395899_0025586_2621_3241 | 205 |
| 494 | 3300037312 | Ga0395899_0435091 | Ga0395899_0435091_33_659 | 205 |
| 495 | 3300037418 | Ga0395900_0001123 | Ga0395900_0001123_1837_2454 | 205 |
| 496 | 3300037418 | Ga0395900_0001235 | Ga0395900_0001235_10738_11358 | 205 |
| 497 | 3300037418 | Ga0395900_0015395 | Ga0395900_0015395_7073_7693 | 205 |
| 498 | 3300037418 | Ga0395900_0307677 | Ga0395900_0307677_277_894 | 205 |
| 499 | 3300037418 | Ga0395900_0831215 | Ga0395900_0831215_195_827 | 205 |
| 500 | 3300037466 | Ga0395898_0002540 | Ga0395898_0002540_10065_10685 | 205 |
| 501 | 3300037466 | Ga0395898_0098291 | Ga0395898_0098291_743_1363 | 205 |
| 502 | 3300037471 | Ga0395905_0001253 | Ga0395905_0001253_10738_11358 | 205 |
| 503 | 3300037471 | Ga0395905_0003224 | Ga0395905_0003224_9238_9858 | 205 |
| 504 | 3300038443 | Ga0395901_0000941 | Ga0395901_0000941_10738_11358 | 205 |
| 505 | 3300038443 | Ga0395901_0003465 | Ga0395901_0003465_8238_8858 | 205 |
| 506 | 3300041997 | Ga0439431_0000479 | Ga0439431_0000479_1819_2436 | 205 |
| 507 | 3300041997 | Ga0439431_0083809 | Ga0439431_0083809_183_800 | 205 |
| 508 | 3300042002 | Ga0439442_067519 | Ga0439442_067519_130_747 | 205 |
| 509 | 3300042007 | Ga0439449_0098683 | Ga0439449_0098683_357_974 | 205 |
| 510 | 3300042014 | Ga0439457_021317 | Ga0439457_021317_37_654 | 205 |
| 511 | 3300042125 | Ga0450923_075414 | Ga0450923_075414_54_671 | 205 |
| 512 | 3300042435 | Ga0439434_0077242 | Ga0439434_0077242_138_755 | 205 |
| 513 | 3300044683 | Ga0466965_0254467 | Ga0466965_0254467_39_656 | 205 |
| 514 | 3300044693 | Ga0466961_0015800 | Ga0466961_0015800_1331_1963 | 205 |
| 515 | 3300044712 | Ga0453684_0058165 | Ga0453684_0058165_1234_1857 | 205 |
| 516 | 3300044712 | Ga0453684_0172776 | Ga0453684_0172776_416_1069 | 205 |
| 517 | 3300044842 | Ga0466957_0608137 | Ga0466957_0608137_114_731 | 205 |
| 518 | 3300045049 | Ga0466959_0257309 | Ga0466959_0257309_318_935 | 205 |
| 519 | 3300045836 | Ga0466958_0023604 | Ga0466958_0023604_584_1216 | 205 |
| 520 | 3300046454 | Ga0495592_0052042 | Ga0495592_0052042_1599_2222 | 205 |
| 521 | 3300046459 | Ga0495629_0215041 | Ga0495629_0215041_586_1224 | 205 |
| 522 | 3300046460 | Ga0495638_0343569 | Ga0495638_0343569_52_672 | 205 |
| 523 | 3300046462 | Ga0495651_0325053 | Ga0495651_0325053_225_878 | 205 |
| 524 | 3300046462 | Ga0495651_0338191 | Ga0495651_0338191_244_867 | 205 |
| 525 | 3300046471 | Ga0495650_0000268 | Ga0495650_0000268_27274_27894 | 205 |
| 526 | 3300046471 | Ga0495650_0061779 | Ga0495650_0061779_182_802 | 205 |
| 527 | 3300046474 | Ga0495605_0126801 | Ga0495605_0126801_332_952 | 205 |
| 528 | 3300046476 | Ga0495662_0170263 | Ga0495662_0170263_282_905 | 205 |
| 529 | 3300046492 | Ga0495585_0000034 | Ga0495585_0000034_98497_99117 | 205 |
| 530 | 3300046492 | Ga0495585_0001510 | Ga0495585_0001510_3521_4159 | 205 |
| 531 | 3300046500 | Ga0495596_0011446 | Ga0495596_0011446_1575_2210 | 205 |
| 532 | 3300046506 | Ga0495583_0037566 | Ga0495583_0037566_804_1424 | 205 |
| 533 | 3300046507 | Ga0495606_0000009 | Ga0495606_0000009_1261_1881 | 205 |
| 534 | 3300046507 | Ga0495606_0028027 | Ga0495606_0028027_487_1107 | 205 |
| 535 | 3300046512 | Ga0495610_0002842 | Ga0495610_0002842_6655_7275 | 205 |
| 536 | 3300046513 | Ga0495616_0000848 | Ga0495616_0000848_5260_5880 | 205 |
| 537 | 3300046513 | Ga0495616_0000907 | Ga0495616_0000907_18075_18731 | 205 |
| 538 | 3300046518 | Ga0495631_0009175 | Ga0495631_0009175_703_1323 | 205 |
| 539 | 3300046520 | Ga0495637_0077790 | Ga0495637_0077790_58_678 | 205 |
| 540 | 3300046524 | Ga0495648_0006307 | Ga0495648_0006307_6811_7449 | 205 |
| 541 | 3300046524 | Ga0495648_0016466 | Ga0495648_0016466_2778_3398 | 205 |
| 542 | 3300046529 | Ga0495652_0090646 | Ga0495652_0090646_1691_2314 | 205 |
| 543 | 3300046529 | Ga0495652_0143476 | Ga0495652_0143476_750_1370 | 205 |
| 544 | 3300046530 | Ga0495654_0114740 | Ga0495654_0114740_505_1143 | 205 |
| 545 | 3300046558 | Ga0495633_0000083 | Ga0495633_0000083_75572_76192 | 205 |
| 546 | 3300046558 | Ga0495633_0017324 | Ga0495633_0017324_860_1480 | 205 |
| 547 | 3300046616 | Ga0495668_0000121 | Ga0495668_0000121_107724_108344 | 205 |
| 548 | 3300046648 | Ga0495611_0081902 | Ga0495611_0081902_225_845 | 205 |
| 549 | 3300046660 | Ga0495625_0000007 | Ga0495625_0000007_357176_357796 | 205 |
| 550 | 3300046660 | Ga0495625_0001973 | Ga0495625_0001973_16784_17404 | 205 |
| 551 | 3300046660 | Ga0495625_0006401 | Ga0495625_0006401_3533_4171 | 205 |
| 552 | 3300046660 | Ga0495625_0008135 | Ga0495625_0008135_6789_7409 | 205 |
| 553 | 3300046660 | Ga0495625_0078788 | Ga0495625_0078788_167_799 | 205 |
| 554 | 3300046660 | Ga0495625_0316324 | Ga0495625_0316324_205_825 | 205 |
| 555 | 3300046660 | Ga0495625_0354201 | Ga0495625_0354201_220_858 | 205 |
| 556 | 3300046665 | Ga0495661_0001101 | Ga0495661_0001101_5860_6480 | 205 |
| 557 | 3300046665 | Ga0495661_0002357 | Ga0495661_0002357_10373_10993 | 205 |
| 558 | 3300046665 | Ga0495661_0197159 | Ga0495661_0197159_106_726 | 205 |
| 559 | 3300046692 | Ga0495671_0043664 | Ga0495671_0043664_751_1371 | 205 |
| 560 | 3300046694 | Ga0495649_0000007 | Ga0495649_0000007_79717_80337 | 205 |
| 561 | 3300046794 | Ga0495589_0075059 | Ga0495589_0075059_98_718 | 205 |
| 562 | 3300046810 | Ga0495660_0005748 | Ga0495660_0005748_4234_4857 | 205 |
| 563 | 3300047323 | Ga0495683_0075656 | Ga0495683_0075656_927_1547 | 205 |
| 564 | 3300047443 | Ga0495687_001260 | Ga0495687_001260_14913_15548 | 205 |
| 565 | 3300047443 | Ga0495687_001497 | Ga0495687_001497_3069_3689 | 205 |
| 566 | 3300047443 | Ga0495687_055489 | Ga0495687_055489_283_900 | 205 |
| 567 | 3300047443 | Ga0495687_109871 | Ga0495687_109871_142_768 | 205 |
| 568 | 3300047446 | Ga0495679_034083 | Ga0495679_034083_592_1215 | 205 |
| 569 | 3300047469 | Ga0495673_0047965 | Ga0495673_0047965_1061_1681 | 205 |
| 570 | 3300047472 | Ga0495686_0000965 | Ga0495686_0000965_4900_5520 | 205 |
| 571 | 3300047472 | Ga0495686_0001123 | Ga0495686_0001123_26774_27400 | 205 |
| 572 | 3300047472 | Ga0495686_0015394 | Ga0495686_0015394_3150_3791 | 205 |
| 573 | 3300047472 | Ga0495686_0027599 | Ga0495686_0027599_719_1408 | 205 |
| 574 | 3300047472 | Ga0495686_0147874 | Ga0495686_0147874_86_712 | 205 |
| 575 | 3300048904 | Ga0496101_0696254 | Ga0496101_0696254_66_683 | 205 |
| 576 | 3300048924 | Ga0496121_0000051 | Ga0496121_0000051_130534_131151 | 205 |
| 577 | 3300048929 | Ga0496126_0054588 | Ga0496126_0054588_1043_1660 | 205 |
| 578 | 3300049459 | Ga0495678_040844 | Ga0495678_040844_935_1591 | 205 |
| 579 | 3300049523 | Ga0501300_009279 | Ga0501300_009279_507_1124 | 205 |
| 580 | 3300049570 | Ga0501033_0325518 | Ga0501033_0325518_272_889 | 205 |
| 581 | 3300049571 | Ga0501034_0048239 | Ga0501034_0048239_2984_3601 | 205 |
| 582 | 3300049663 | Ga0501223_001851 | Ga0501223_001851_1738_2355 | 205 |
| 583 | 3300049673 | Ga0501240_001227 | Ga0501240_001227_1770_2393 | 205 |
| 584 | 3300049675 | Ga0501243_009896 | Ga0501243_009896_115_732 | 205 |
| 585 | 3300049758 | Ga0501241_000377 | Ga0501241_000377_5327_5947 | 205 |
| 586 | 3300050493 | nmdc:mga0k408_44_c2 | nmdc:mga0k408_44_c2_3759_4379 | 205 |
| 587 | 3300050493 | nmdc:mga0k408_80_c1 | nmdc:mga0k408_80_c1_21451_22080 | 205 |
| 588 | 3300050496 | nmdc:mga07m45_148261_c1 | nmdc:mga07m45_148261_c1_157_777 | 205 |
| 589 | 3300050496 | nmdc:mga07m45_66674_c1 | nmdc:mga07m45_66674_c1_1219_1836 | 205 |
| 590 | 3300053080 | Ga0500635_0000452 | Ga0500635_0000452_2620_3240 | 205 |
| 591 | 3300053088 | Ga0500644_0002231 | Ga0500644_0002231_415_1041 | 205 |
| 592 | 3300053104 | Ga0500556_0116398 | Ga0500556_0116398_366_992 | 205 |
| 593 | 3300053109 | Ga0500569_000051 | Ga0500569_000051_15580_16206 | 205 |
| 594 | 3300053121 | Ga0500607_023581 | Ga0500607_023581_1842_2468 | 205 |
| 595 | 3300053122 | Ga0500608_001705 | Ga0500608_001705_6049_6669 | 205 |
| 596 | 3300053122 | Ga0500608_139355 | Ga0500608_139355_164_784 | 205 |
| 597 | 3300053125 | Ga0500618_000006 | Ga0500618_000006_178007_178627 | 205 |
| 598 | 3300053125 | Ga0500618_033030 | Ga0500618_033030_76_696 | 205 |
| 599 | 3300053134 | Ga0500658_0004833 | Ga0500658_0004833_1822_2448 | 205 |
| 600 | 3300053137 | Ga0500561_0020371 | Ga0500561_0020371_283_909 | 205 |
| 601 | 3300053142 | Ga0500577_0000576 | Ga0500577_0000576_7052_7678 | 205 |
| 602 | 3300053148 | Ga0500590_013643 | Ga0500590_013643_823_1449 | 205 |
| 603 | 3300053153 | Ga0500616_0022449 | Ga0500616_0022449_2190_2816 | 205 |
| 604 | 3300053156 | Ga0500622_0000673 | Ga0500622_0000673_16787_17404 | 205 |
| 605 | 3300053156 | Ga0500622_0001513 | Ga0500622_0001513_5960_6592 | 205 |
| 606 | 3300053157 | Ga0500624_000567 | Ga0500624_000567_4678_5298 | 205 |
| 607 | 3300053160 | Ga0500633_0004242 | Ga0500633_0004242_1109_1735 | 205 |
| 608 | 3300053161 | Ga0500634_0116500 | Ga0500634_0116500_427_1053 | 205 |
| 609 | 3300053177 | Ga0500636_0011566 | Ga0500636_0011566_1414_2040 | 205 |
| 610 | iso_pu_bacteria | 2852623160 | 2852626385 | 205 |
| 611 | iso_pu_bacteria | 2977232053 | 2977234643 | 205 |
| 612 | 2162886007 | SwRhRL2b_contig_1677431 | SwRhRL2b_0189.00007340 | 206 |
| 613 | 3300005289 | Ga0065704_10079379 | Ga0065704_100793792 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o17-assembly1.cif.gz_B | abc transporter nosdfy e154q, atp-bound in lipid nanodisc | 0.8607 | 1 | 185 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.8547 | 1 | 199 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.8534 | 3 | 186 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.8514 | 3 | 186 |
| 7f04-assembly1.cif.gz_A | cytochrome c-type biogenesis protein ccmabcd from e. coli in complex with heme and atp. | 0.8512 | 2 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4CKA0_1_130_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8984 | 116 | 186 | 3.40.50.300 |
| af_A0A1D6P1I8_181_285_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8817 | 2 | 56 | 3.40.50.300 |
| af_E9PWJ7_506_745_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8758 | 3 | 188 | 3.40.50.300 |
| af_X2JG15_1642_1882_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8695 | 2 | 186 | 3.40.50.300 |
| af_Q69XA0_568_896_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8683 | 3 | 201 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1T5PCN8-F1-model_v4 | ABC-type multidrug transport system, ATPase component | 0.9837 | 1 | 203 |
GO:0005524
GO:0016887 |
| AF-A0A1T5PCN8-F1-model_v4 | ABC-type multidrug transport system, ATPase component | 0.9789 | 1 | 203 |
GO:0005524
GO:0016887 |
| AF-A0A4Q3KY04-F1-model_v4 | deleted | 0.9702 | 57 | 203 |
|
| AF-A0A3B8IG06-F1-model_v4 | ABC transporter ATP-binding protein | 0.9642 | 2 | 199 |
GO:0005524
GO:0016887 |
| AF-A0A4Q3KY04-F1-model_v4 | deleted | 0.9511 | 57 | 203 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar