F469246

General Info

Members Datasets Scaffolds Average Seq Length
613 306 586 207

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10296890|Ga0105240_102968902
Length 250
Sequence LGILKKFIVHGGFAHLKLKANKLSAKSLPAMNHELLTMNSISISLQNIGRRFNRDWIFRGVDYTFTGSNSYAILGPNGSGKSTLLQVLNGSLAPSVGQLKYTFNDAEVEVGEVYQHLSLAAPYLELIEEFTLNEVIDFHFKFKGYKAGMDKNGVIELLGMQSSKNKMIRYFSSGMKQRLKLALAFCSNTPMLMLDEPTSNLDTQGVDWYLSLVQKFAADRLTLVCSNQQHEYGFCNERLNISDYKKEGKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
8 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
9 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
10 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
11 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
12 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
13 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
14 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
15 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
16 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
17 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
18 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
19 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
20 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
21 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
22 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
23 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
24 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
25 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
26 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
27 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
28 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
34 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
35 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
36 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
37 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
49 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
186 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
187 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
188 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
206 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
209 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
212 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
279 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
280 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
288 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
291 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
292 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
293 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
294 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
295 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
296 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
297 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
300 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
301 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
302 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
303 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
306 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0.16
Isolates 4.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.97
Nodule 0
Rhizoplane 1.79
Rhizosphere 81.4
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1677431 2162886007 Bacteria 3055
2 JGI24740J21852_10007285 3300001979 Bacteria 4506
3 JGI24739J22299_10028909 3300001989 Bacteria 1931
4 JGI24737J22298_10003208 3300001990 Bacteria 5802
5 JGI24737J22298_10035536 3300001990 Bacteria 1541
6 JGI24735J21928_10000093 3300002067 Bacteria 33623
7 JGI24744J21845_10012713 3300002077 Bacteria 1703
8 JGI25162J39368_1000008 3300002737 Bacteria 397212
9 JGI25162J39368_1000097 3300002737 Bacteria 96520
10 JGI25162J39368_1001750 3300002737 Bacteria 10388
11 JGI25154J39366_1000021 3300002738 Bacteria 221559
12 JGI25157J39369_1013421 3300002741 Bacteria 1031
13 JGI25164J39214_1002319 3300002772 Bacteria 3036
14 JGI25165J46597_1001806 3300003214 Bacteria 9076
15 rootH1_10051127 3300003316 Bacteria 5024
16 rootH1_10051127 3300003323 Bacteria 4055
17 rootH2_10001273 3300003320 Bacteria 179792
18 rootH2_10015677 3300003320 Bacteria 11191
19 rootH2_10207088 3300003320 Bacteria 1608
20 rootH2_10241535 3300003320 Bacteria 1131
21 rootH2_10323976 3300003320 Bacteria 1489
22 rootL2_10071036 3300003322 Bacteria 4256
23 rootL2_10128366 3300003322 Unclassified 2084
24 rootL2_10211313 3300003322 Bacteria 1481
25 rootH1_10000975 3300003316 Bacteria 12698
26 rootH1_10000975 3300003323 Bacteria 22074
27 rootH1_10009825 3300003323 Bacteria 13487
28 rootH1_10035177 3300003323 Bacteria 4291
29 rootH1_10035178 3300003323 Bacteria 2286
30 rootH1_10136596 3300003323 Bacteria 2329
31 JGI25160J50197_1023819 3300003354 Bacteria 1754
32 Ga0055535_1004402 3300003761 Bacteria 3432
33 Ga0055542_1007561 3300003762 Bacteria 2196
34 Ga0055536_1016448 3300003781 Unclassified 2472
35 Ga0055531_10000092 3300003794 Bacteria 99176
36 Ga0055543_1021073 3300004625 Bacteria 1191
37 Ga0058863_11443821 3300004799 Bacteria 4283
38 Ga0065165_1000060 3300005262 Bacteria 180226
39 Ga0065714_10026122 3300005288 Bacteria 1554
40 Ga0065714_10067802 3300005288 Bacteria 5187
41 Ga0065714_10213702 3300005288 Unclassified 859
42 Ga0065704_10079379 3300005289 Bacteria 4180
43 Ga0070658_10000675 3300005327 Bacteria 29517
44 Ga0070658_10059384 3300005327 Bacteria 3114
45 Ga0070676_10000573 3300005328 Bacteria 17839
46 Ga0070676_10012058 3300005328 Bacteria 4712
47 Ga0070670_100499261 3300005331 Bacteria 1082
48 Ga0068869_100121472 3300005334 Bacteria 1998
49 Ga0070666_10010165 3300005335 Bacteria 5878
50 Ga0070680_100023459 3300005336 Bacteria 4920
51 Ga0070680_100040616 3300005336 Bacteria 3768
52 Ga0070680_100553862 3300005336 Unclassified 986
53 Ga0070682_100033894 3300005337 Bacteria 3105
54 Ga0068868_100007993 3300005338 Bacteria 7559
55 Ga0070660_100545149 3300005339 Bacteria 967
56 Ga0070660_100602064 3300005339 Bacteria 919
57 Ga0070691_10099457 3300005341 Bacteria 1443
58 Ga0070661_100629605 3300005344 Bacteria 869
59 Ga0070675_100019801 3300005354 Bacteria 5367
60 Ga0070671_100017095 3300005355 Bacteria 5869
61 Ga0070671_100105996 3300005355 Bacteria 2359
62 Ga0070671_100140233 3300005355 Bacteria 2040
63 Ga0070671_100294613 3300005355 Bacteria 1381
64 Ga0070671_100727141 3300005355 Bacteria 862
65 Ga0070671_100799075 3300005355 Bacteria 821
66 Ga0070673_100014307 3300005364 Bacteria 5519
67 Ga0070673_100066919 3300005364 Bacteria 2872
68 Ga0070673_100398659 3300005364 Bacteria 1230
69 Ga0070659_100003641 3300005366 Bacteria 10976
70 Ga0070659_100167730 3300005366 Bacteria 1797
71 Ga0070667_100000031 3300005367 Bacteria 177447
72 Ga0070663_100240630 3300005455 Bacteria 1428
73 Ga0070662_100002625 3300005457 Bacteria 11085
74 Ga0070681_10015787 3300005458 Bacteria 7528
75 Ga0070681_10115268 3300005458 Bacteria 2625
76 Ga0070681_10376082 3300005458 Bacteria 1331
77 Ga0068867_100001804 3300005459 Bacteria 14902
78 Ga0068867_100012634 3300005459 Bacteria 5972
79 Ga0068867_100042981 3300005459 Bacteria 3307
80 Ga0070679_100081468 3300005530 Bacteria 3226
81 Ga0070679_100165325 3300005530 Bacteria 2186
82 Ga0070684_100447855 3300005535 Bacteria 1193
83 Ga0068853_100010363 3300005539 Bacteria 7540
84 Ga0068853_100019053 3300005539 Bacteria 5686
85 Ga0068853_100046477 3300005539 Bacteria 3722
86 Ga0068853_100105460 3300005539 Bacteria 2497
87 Ga0068853_100256849 3300005539 Bacteria 1605
88 Ga0068853_100830848 3300005539 Bacteria 885
89 Ga0070672_100005602 3300005543 Bacteria 8350
90 Ga0070672_100835063 3300005543 Bacteria 812
91 Ga0070665_100000017 3300005548 Bacteria 448013
92 Ga0070665_100002650 3300005548 Bacteria 19467
93 Ga0068855_100000021 3300005563 Bacteria 195708
94 Ga0068855_100001368 3300005563 Bacteria 30198
95 Ga0068855_100144084 3300005563 Bacteria 2714
96 Ga0068855_100163887 3300005563 Bacteria 2521
97 Ga0068855_100306528 3300005563 Bacteria 1758
98 Ga0068855_100438346 3300005563 Unclassified 1427
99 Ga0068855_100574291 3300005563 Bacteria 1218
100 Ga0068855_100922152 3300005563 Bacteria 922
101 Ga0068855_101055044 3300005563 Unclassified 851
102 Ga0068857_100056246 3300005577 Bacteria 3491
103 Ga0068857_100076675 3300005577 Bacteria 2982
104 Ga0068857_100128053 3300005577 Bacteria 2288
105 Ga0068854_100113235 3300005578 Bacteria 2049
106 Ga0068856_100000006 3300005614 Bacteria 223827
107 Ga0068856_100004027 3300005614 Bacteria 14713
108 Ga0068856_100036749 3300005614 Bacteria 4803
109 Ga0068856_100050093 3300005614 Bacteria 4117
110 Ga0068856_100339350 3300005614 Bacteria 1521
111 Ga0068856_100604468 3300005614 Bacteria 1118
112 Ga0068856_100966031 3300005614 Bacteria 870
113 Ga0068856_100972375 3300005614 Bacteria 867
114 Ga0068852_100005157 3300005616 Bacteria 9313
115 Ga0068852_100141912 3300005616 Bacteria 2224
116 Ga0068852_100215680 3300005616 Unclassified 1823
117 Ga0068859_100000451 3300005617 Bacteria 40880
118 Ga0068864_100006018 3300005618 Bacteria 9961
119 Ga0068864_100514509 3300005618 Bacteria 1153
120 Ga0068866_10183668 3300005718 Bacteria 1237
121 Ga0068851_10001096 3300005834 Bacteria 11756
122 Ga0068863_100018879 3300005841 Bacteria 6598
123 Ga0068863_100039830 3300005841 Bacteria 4469
124 Ga0068863_100499893 3300005841 Bacteria 1197
125 Ga0068858_100021942 3300005842 Bacteria 5963
126 Ga0068858_100389251 3300005842 Bacteria 1338
127 Ga0068860_100016192 3300005843 Bacteria 7272
128 Ga0068860_100243294 3300005843 Bacteria 1750
129 Ga0070716_100430837 3300006173 Unclassified 956
130 Ga0075366_10000019 3300006195 Bacteria 59333
131 Ga0075366_10000496 3300006195 Bacteria 18213
132 Ga0075366_10000779 3300006195 Bacteria 15223
133 Ga0097621_100003766 3300006237 Bacteria 10512
134 Ga0097621_100006550 3300006237 Bacteria 8272
135 Ga0097621_100006952 3300006237 Bacteria 8056
136 Ga0097621_100010393 3300006237 Bacteria 6809
137 Ga0075370_10089453 3300006353 Bacteria 1775
138 Ga0075370_10205516 3300006353 Bacteria 1162
139 Ga0068871_100000491 3300006358 Bacteria 27057
140 Ga0068871_100001976 3300006358 Bacteria 13888
141 Ga0068871_100007909 3300006358 Bacteria 7623
142 Ga0068871_100012713 3300006358 Bacteria 6222
143 Ga0068865_100000070 3300006881 Bacteria 53670
144 Ga0068865_100004346 3300006881 Bacteria 8550
145 Ga0097620_100000451 3300006931 Bacteria 40880
146 Ga0105240_10000083 3300009093 Bacteria 192934
147 Ga0105240_10008396 3300009093 Bacteria 14776
148 Ga0105240_10025938 3300009093 Bacteria 7697
149 Ga0105240_10027963 3300009093 Bacteria 7376
150 Ga0105240_10039588 3300009093 Bacteria 6035
151 Ga0105240_10083621 3300009093 Bacteria 3916
152 Ga0105240_10176466 3300009093 Bacteria 2526
153 Ga0105240_10225835 3300009093 Bacteria 2179
154 Ga0105240_10269418 3300009093 Bacteria 1961
155 Ga0105240_10296890 3300009093 Bacteria 1850
156 Ga0105240_10361767 3300009093 Bacteria 1643
157 Ga0105240_10385162 3300009093 Bacteria 1582
158 Ga0105240_10495934 3300009093 Unclassified 1359
159 Ga0105240_10511430 3300009093 Bacteria 1334
160 Ga0105240_10857896 3300009093 Unclassified 980
161 Ga0105240_11244867 3300009093 Bacteria 787
162 Ga0105240_11247030 3300009093 Unclassified 786
163 Ga0105245_10473657 3300009098 Bacteria 1264
164 Ga0105245_10958546 3300009098 Bacteria 899
165 Ga0105247_10027343 3300009101 Unclassified 3450
166 Ga0105243_10091725 3300009148 Bacteria 2502
167 Ga0105241_10005957 3300009174 Bacteria 8989
168 Ga0105241_10015143 3300009174 Bacteria 5649
169 Ga0105241_10722340 3300009174 Bacteria 911
170 Ga0105242_10023716 3300009176 Bacteria 4838
171 Ga0105242_10035688 3300009176 Bacteria 3987
172 Ga0105242_11291975 3300009176 Bacteria 753
173 Ga0105248_10046424 3300009177 Bacteria 4868
174 Ga0105237_10000138 3300009545 Bacteria 102411
175 Ga0105237_10002154 3300009545 Bacteria 24772
176 Ga0105237_10007680 3300009545 Bacteria 11784
177 Ga0105237_10008458 3300009545 Bacteria 11136
178 Ga0105237_10053901 3300009545 Bacteria 4031
179 Ga0105237_10141157 3300009545 Bacteria 2403
180 Ga0105237_10240923 3300009545 Bacteria 1810
181 Ga0105237_10272179 3300009545 Bacteria 1696
182 Ga0105237_10689663 3300009545 Bacteria 1028
183 Ga0105237_10730910 3300009545 Bacteria 996
184 Ga0105238_10005277 3300009551 Bacteria 12781
185 Ga0105238_10105278 3300009551 Bacteria 2803
186 Ga0105238_10230185 3300009551 Bacteria 1830
187 Ga0105238_10735217 3300009551 Bacteria 1000
188 Ga0105238_10969985 3300009551 Bacteria 870
189 Ga0105249_10345667 3300009553 Bacteria 1505
190 Ga0105249_10472583 3300009553 Bacteria 1295
191 Ga0105239_10000026 3300010375 Bacteria 248302
192 Ga0105239_10000130 3300010375 Bacteria 105894
193 Ga0105239_10002143 3300010375 Bacteria 25398
194 Ga0105239_10012139 3300010375 Bacteria 9606
195 Ga0105239_10025142 3300010375 Bacteria 6558
196 Ga0105239_10100768 3300010375 Bacteria 3195
197 Ga0105239_10137613 3300010375 Bacteria 2719
198 Ga0105239_10152826 3300010375 Bacteria 2576
199 Ga0105239_10188861 3300010375 Unclassified 2306
200 Ga0105239_10354620 3300010375 Bacteria 1656
201 Ga0105239_10424527 3300010375 Bacteria 1506
202 Ga0105239_10666606 3300010375 Bacteria 1188
203 Ga0105239_10688901 3300010375 Bacteria 1168
204 Ga0105239_11200131 3300010375 Bacteria 874
205 Ga0105246_10253392 3300011119 Bacteria 1398
206 Ga0105246_10395036 3300011119 Bacteria 1147
207 Ga0105246_10586072 3300011119 Bacteria 961
208 Ga0157373_10000057 3300013100 Bacteria 99697
209 Ga0157373_10487969 3300013100 Bacteria 889
210 Ga0157371_10000480 3300013102 Bacteria 48687
211 Ga0157371_10015232 3300013102 Bacteria 5775
212 Ga0157371_10044041 3300013102 Bacteria 3179
213 Ga0157371_10362593 3300013102 Bacteria 1056
214 Ga0157371_10375272 3300013102 Bacteria 1038
215 Ga0157370_10015989 3300013104 Bacteria 7612
216 Ga0157370_10018014 3300013104 Bacteria 7108
217 Ga0157370_10021907 3300013104 Bacteria 6364
218 Ga0157370_10085253 3300013104 Bacteria 2967
219 Ga0157370_10162454 3300013104 Bacteria 2078
220 Ga0157370_10260024 3300013104 Bacteria 1604
221 Ga0157369_10000301 3300013105 Bacteria 66010
222 Ga0157369_10271904 3300013105 Bacteria 1765
223 Ga0157369_10391029 3300013105 Unclassified 1443
224 Ga0157369_10718673 3300013105 Bacteria 1028
225 Ga0157374_10002863 3300013296 Bacteria 14485
226 Ga0157374_10003120 3300013296 Bacteria 13919
227 Ga0157374_10008123 3300013296 Bacteria 8969
228 Ga0157374_10015781 3300013296 Bacteria 6634
229 Ga0157374_10020461 3300013296 Bacteria 5870
230 Ga0157374_10201079 3300013296 Bacteria 1951
231 Ga0157374_10321735 3300013296 Bacteria 1533
232 Ga0157374_11069221 3300013296 Bacteria 827
233 Ga0157378_10007469 3300013297 Bacteria 9550
234 Ga0157378_10014751 3300013297 Bacteria 6847
235 Ga0157378_10343634 3300013297 Bacteria 1456
236 Ga0157378_11352396 3300013297 Bacteria 754
237 Ga0163162_10000026 3300013306 Bacteria 178701
238 Ga0163162_10011373 3300013306 Bacteria 8677
239 Ga0163162_10018688 3300013306 Bacteria 6791
240 Ga0163162_10024812 3300013306 Bacteria 5922
241 Ga0163162_10873141 3300013306 Bacteria 1014
242 Ga0163162_11575775 3300013306 Bacteria 749
243 Ga0157372_10000037 3300013307 Bacteria 172444
244 Ga0157372_10000158 3300013307 Bacteria 73709
245 Ga0157372_10006525 3300013307 Bacteria 12417
246 Ga0157372_10188347 3300013307 Bacteria 2389
247 Ga0157372_10290738 3300013307 Bacteria 1900
248 Ga0157372_10310872 3300013307 Bacteria 1834
249 Ga0157372_10356668 3300013307 Bacteria 1704
250 Ga0157372_10391523 3300013307 Bacteria 1619
251 Ga0157375_10023788 3300013308 Bacteria 5660
252 Ga0157375_10111239 3300013308 Bacteria 2838
253 Ga0157375_10137594 3300013308 Bacteria 2567
254 Ga0157375_10164228 3300013308 Bacteria 2364
255 Ga0157375_10296764 3300013308 Bacteria 1779
256 Ga0157375_10533170 3300013308 Unclassified 1337
257 Ga0157375_10721740 3300013308 Bacteria 1149
258 Ga0157375_10779700 3300013308 Bacteria 1106
259 Ga0163163_10000174 3300014325 Bacteria 67568
260 Ga0163163_10102441 3300014325 Bacteria 2886
261 Ga0163163_10474446 3300014325 Bacteria 1312
262 Ga0157380_10000011 3300014326 Bacteria 132153
263 Ga0157377_10288539 3300014745 Bacteria 1078
264 Ga0157379_10007490 3300014968 Bacteria 9449
265 Ga0157379_10015024 3300014968 Bacteria 6792
266 Ga0157379_10375806 3300014968 Bacteria 1303
267 Ga0157376_10029662 3300014969 Bacteria 4359
268 Ga0157376_10144501 3300014969 Bacteria 2138
269 Ga0182005_1000042 3300015265 Bacteria 146854
270 Ga0163161_10009734 3300017792 Bacteria 6659
271 Ga0163161_10277896 3300017792 Bacteria 1313
272 Ga0209436_104712 3300025208 Bacteria 3305
273 Ga0207427_100083 3300025231 Bacteria 142745
274 Ga0209437_100021 3300025233 Bacteria 646400
275 Ga0209437_100030 3300025233 Bacteria 532466
276 Ga0209258_100032 3300025242 Bacteria 452764
277 Ga0209646_1000050 3300025246 Bacteria 296599
278 Ga0209026_1000195 3300025250 Bacteria 84589
279 Ga0209026_1001818 3300025250 Bacteria 8781
280 Ga0209026_1007931 3300025250 Bacteria 2294
281 Ga0209148_1000167 3300025254 Bacteria 135407
282 Ga0209233_1000035 3300025261 Bacteria 568478
283 Ga0209233_1002780 3300025261 Bacteria 6290
284 Ga0209455_1004639 3300025272 Bacteria 4433
285 Ga0209130_1006047 3300025284 Bacteria 4023
286 Ga0209676_1000351 3300025292 Bacteria 87135
287 Ga0207426_1000250 3300025302 Bacteria 117492
288 Ga0207426_1005879 3300025302 Bacteria 5463
289 Ga0209257_1000128 3300025304 Bacteria 214268
290 Ga0207697_10037886 3300025315 Bacteria 1977
291 Ga0207656_10045330 3300025321 Bacteria 1881
292 Ga0207642_10354547 3300025899 Bacteria 866
293 Ga0207680_10005574 3300025903 Bacteria 6019
294 Ga0207647_10002483 3300025904 Bacteria 13965
295 Ga0207647_10014044 3300025904 Bacteria 5537
296 Ga0207645_10002024 3300025907 Bacteria 16278
297 Ga0207645_10011365 3300025907 Bacteria 6083
298 Ga0207705_10000035 3300025909 Bacteria 201649
299 Ga0207705_10342794 3300025909 Unclassified 1150
300 Ga0207654_10021925 3300025911 Bacteria 3402
301 Ga0207654_10041602 3300025911 Bacteria 2596
302 Ga0207707_10009099 3300025912 Bacteria 8629
303 Ga0207707_10016419 3300025912 Bacteria 6458
304 Ga0207695_10000127 3300025913 Bacteria 227338
305 Ga0207695_10006085 3300025913 Bacteria 15745
306 Ga0207695_10012308 3300025913 Bacteria 10277
307 Ga0207695_10030928 3300025913 Bacteria 5886
308 Ga0207695_10042968 3300025913 Bacteria 4821
309 Ga0207695_10111298 3300025913 Unclassified 2717
310 Ga0207695_10120103 3300025913 Bacteria 2597
311 Ga0207695_10144936 3300025913 Bacteria 2320
312 Ga0207695_10218518 3300025913 Bacteria 1814
313 Ga0207695_10221844 3300025913 Bacteria 1797
314 Ga0207695_10356529 3300025913 Bacteria 1349
315 Ga0207695_10616676 3300025913 Bacteria 966
316 Ga0207671_10001040 3300025914 Bacteria 33728
317 Ga0207671_10004045 3300025914 Bacteria 14219
318 Ga0207671_10004973 3300025914 Bacteria 12455
319 Ga0207671_10030893 3300025914 Bacteria 3994
320 Ga0207671_10131153 3300025914 Bacteria 1924
321 Ga0207671_10142188 3300025914 Bacteria 1849
322 Ga0207671_10159797 3300025914 Bacteria 1744
323 Ga0207671_10453620 3300025914 Bacteria 1021
324 Ga0207660_10007186 3300025917 Bacteria 7208
325 Ga0207660_10026645 3300025917 Bacteria 3937
326 Ga0207660_10080911 3300025917 Bacteria 2386
327 Ga0207657_10043324 3300025919 Bacteria 3965
328 Ga0207657_10146379 3300025919 Bacteria 1927
329 Ga0207657_10533985 3300025919 Bacteria 918
330 Ga0207652_10015048 3300025921 Bacteria 6275
331 Ga0207652_10020517 3300025921 Bacteria 5443
332 Ga0207652_10081881 3300025921 Bacteria 2824
333 Ga0207694_10156594 3300025924 Bacteria 1838
334 Ga0207694_10737240 3300025924 Unclassified 831
335 Ga0207650_10686925 3300025925 Bacteria 864
336 Ga0207687_10309619 3300025927 Bacteria 1275
337 Ga0207687_10958611 3300025927 Bacteria 733
338 Ga0207644_10033864 3300025931 Bacteria 3573
339 Ga0207690_10007346 3300025932 Bacteria 6540
340 Ga0207690_10014185 3300025932 Bacteria 4807
341 Ga0207706_10000662 3300025933 Bacteria 36264
342 Ga0207686_10005823 3300025934 Bacteria 6613
343 Ga0207686_10417597 3300025934 Bacteria 1025
344 Ga0207704_10002226 3300025938 Bacteria 8700
345 Ga0207704_10045232 3300025938 Bacteria 2614
346 Ga0207691_10027168 3300025940 Bacteria 5369
347 Ga0207711_10096689 3300025941 Bacteria 2607
348 Ga0207689_10074538 3300025942 Unclassified 2788
349 Ga0207667_10000014 3300025949 Bacteria 421261
350 Ga0207667_10007695 3300025949 Bacteria 12895
351 Ga0207667_10036206 3300025949 Bacteria 5291
352 Ga0207667_10058276 3300025949 Bacteria 4052
353 Ga0207667_10083618 3300025949 Bacteria 3305
354 Ga0207667_10285852 3300025949 Bacteria 1685
355 Ga0207667_10643442 3300025949 Bacteria 1066
356 Ga0207667_11044124 3300025949 Unclassified 803
357 Ga0207651_10008410 3300025960 Bacteria 5573
358 Ga0207651_10117250 3300025960 Unclassified 2011
359 Ga0207712_10209949 3300025961 Bacteria 1550
360 Ga0207668_10000298 3300025972 Bacteria 32532
361 Ga0207640_10012943 3300025981 Bacteria 4768
362 Ga0207658_10013104 3300025986 Bacteria 5662
363 Ga0207658_10541593 3300025986 Bacteria 1041
364 Ga0207677_10004006 3300026023 Bacteria 7860
365 Ga0207677_10048362 3300026023 Bacteria 2863
366 Ga0207703_10006892 3300026035 Bacteria 9047
367 Ga0207703_10603794 3300026035 Bacteria 1038
368 Ga0207639_10015040 3300026041 Bacteria 5450
369 Ga0207639_10035563 3300026041 Bacteria 3686
370 Ga0207639_10143870 3300026041 Bacteria 1990
371 Ga0207678_10078612 3300026067 Bacteria 2825
372 Ga0207702_10000023 3300026078 Bacteria 189234
373 Ga0207702_10031631 3300026078 Bacteria 4411
374 Ga0207702_10082404 3300026078 Bacteria 2797
375 Ga0207702_10447935 3300026078 Bacteria 1252
376 Ga0207702_10647746 3300026078 Bacteria 1039
377 Ga0207641_10009560 3300026088 Bacteria 7987
378 Ga0207641_10189673 3300026088 Bacteria 1889
379 Ga0207641_10477571 3300026088 Bacteria 1208
380 Ga0207648_10004191 3300026089 Bacteria 14900
381 Ga0207648_10014556 3300026089 Bacteria 7265
382 Ga0207648_10031381 3300026089 Bacteria 4698
383 Ga0207676_10003554 3300026095 Bacteria 11027
384 Ga0207674_10013741 3300026116 Bacteria 8962
385 Ga0207674_10072401 3300026116 Bacteria 3462
386 Ga0207674_10150075 3300026116 Bacteria 2288
387 Ga0207674_10278262 3300026116 Bacteria 1621
388 Ga0207683_10008462 3300026121 Bacteria 8806
389 Ga0207698_10021199 3300026142 Bacteria 4489
390 Ga0207698_10160118 3300026142 Bacteria 1967
391 Ga0207698_10434757 3300026142 Unclassified 1263
392 Ga0207698_10760698 3300026142 Bacteria 968
393 Ga0268266_10000037 3300028379 Bacteria 342368
394 Ga0268266_10013819 3300028379 Bacteria 6949
395 Ga0268264_10003219 3300028381 Bacteria 14141
396 Ga0268264_10399178 3300028381 Unclassified 1321
397 Ga0268264_10982095 3300028381 Bacteria 850
398 Ga0265318_10009572 3300028577 Bacteria 4254
399 Ga0307517_10001388 3300028786 Bacteria 40654
400 Ga0307515_10000001 3300028794 Bacteria 4259510
401 Ga0307515_10000077 3300028794 Bacteria 228162
402 Ga0307515_10026002 3300028794 Bacteria 10099
403 Ga0307515_10049654 3300028794 Bacteria 6303
404 Ga0316177_1098816 3300030731 Bacteria 7845
405 Ga0316176_1004700 3300030732 Bacteria 16177
406 Ga0316183_1113144 3300030742 Bacteria 14108
407 Ga0316181_1257111 3300030744 Bacteria 3705
408 Ga0307408_100000393 3300031548 Bacteria 39808
409 Ga0307408_100000487 3300031548 Bacteria 34716
410 Ga0307408_101299621 3300031548 Bacteria 682
411 Ga0316576_10314937 3300031727 Bacteria 1168
412 Ga0307405_10002557 3300031731 Bacteria 8071
413 Ga0307405_10015289 3300031731 Bacteria 4153
414 Ga0307412_10005666 3300031911 Bacteria 7018
415 Ga0307412_10064186 3300031911 Bacteria 2480
416 Ga0307412_10384576 3300031911 Bacteria 1137
417 Ga0307414_10019467 3300032004 Bacteria 4207
418 Ga0307414_10097463 3300032004 Bacteria 2203
419 Ga0307414_10114477 3300032004 Bacteria 2061
420 Ga0307414_10377740 3300032004 Bacteria 1224
421 Ga0307414_10418473 3300032004 Bacteria 1168
422 Ga0307414_11116377 3300032004 Unclassified 728
423 Ga0307411_10080200 3300032005 Bacteria 2243
424 Ga0307507_10000143 3300033179 Bacteria 124248
425 Ga0307510_10003117 3300033180 Bacteria 19187
426 Ga0373955_0209888 3300035172 Bacteria 1161
427 Ga0373924_0048357 3300035410 Unclassified 1757
428 Ga0373937_0009187 3300036401 Bacteria 8581
429 Ga0395899_0000017 3300037312 Bacteria 440179
430 Ga0395899_0000280 3300037312 Bacteria 66580
431 Ga0395899_0000793 3300037312 Bacteria 30923
432 Ga0395899_0025586 3300037312 Bacteria 4455
433 Ga0395899_0435091 3300037312 Unclassified 862
434 Ga0395900_0001123 3300037418 Bacteria 33875
435 Ga0395900_0001235 3300037418 Bacteria 31424
436 Ga0395900_0015395 3300037418 Bacteria 7795
437 Ga0395900_0307677 3300037418 Bacteria 1569
438 Ga0395900_0831215 3300037418 Bacteria 850
439 Ga0395898_0002540 3300037466 Bacteria 21394
440 Ga0395898_0098291 3300037466 Bacteria 2810
441 Ga0395905_0001253 3300037471 Bacteria 31445
442 Ga0395905_0003224 3300037471 Bacteria 17546
443 Ga0395901_0000941 3300038443 Bacteria 31690
444 Ga0395901_0003465 3300038443 Bacteria 15886
445 Ga0400484_07716 3300038725 Bacteria 8216
446 Ga0400490_57711 3300038726 Bacteria 2589
447 Ga0400490_59015 3300038726 Bacteria 1228
448 Ga0451800_1250505 3300041459 Bacteria 746
449 Ga0439431_0000479 3300041997 Bacteria 8484
450 Ga0439431_0083809 3300041997 Bacteria 862
451 Ga0439442_067519 3300042002 Bacteria 760
452 Ga0439449_0098683 3300042007 Bacteria 1079
453 Ga0439457_021317 3300042014 Unclassified 1437
454 Ga0439457_110865 3300042014 Bacteria 644
455 Ga0450923_075414 3300042125 Bacteria 753
456 Ga0439434_0077242 3300042435 Bacteria 1054
457 Ga0466965_0254467 3300044683 Unclassified 943
458 Ga0466961_0015800 3300044693 Bacteria 4844
459 Ga0453684_0044892 3300044712 Bacteria 5904
460 Ga0453684_0058165 3300044712 Bacteria 4995
461 Ga0453684_0118794 3300044712 Bacteria 3197
462 Ga0453684_0172776 3300044712 Bacteria 2545
463 Ga0466957_0608137 3300044842 Bacteria 766
464 Ga0466959_0257309 3300045049 Unclassified 1202
465 Ga0466958_0023604 3300045836 Bacteria 3613
466 Ga0495592_0052042 3300046454 Bacteria 3041
467 Ga0495629_0120850 3300046459 Unclassified 1825
468 Ga0495629_0215041 3300046459 Bacteria 1327
469 Ga0495638_0343569 3300046460 Bacteria 790
470 Ga0495651_0325053 3300046462 Bacteria 1024
471 Ga0495651_0338191 3300046462 Bacteria 998
472 Ga0495650_0000268 3300046471 Bacteria 99891
473 Ga0495650_0061779 3300046471 Bacteria 1499
474 Ga0495605_0126801 3300046474 Bacteria 1154
475 Ga0495662_0170263 3300046476 Bacteria 1073
476 Ga0495585_0000034 3300046492 Bacteria 143120
477 Ga0495585_0001510 3300046492 Bacteria 18129
478 Ga0495596_0011446 3300046500 Bacteria 3829
479 Ga0495583_0037566 3300046506 Bacteria 2295
480 Ga0495606_0000009 3300046507 Bacteria 306313
481 Ga0495606_0003806 3300046507 Bacteria 15677
482 Ga0495606_0028027 3300046507 Bacteria 3981
483 Ga0495610_0002842 3300046512 Bacteria 14087
484 Ga0495616_0000848 3300046513 Bacteria 22319
485 Ga0495616_0000907 3300046513 Bacteria 21368
486 Ga0495618_0544228 3300046514 Unclassified 696
487 Ga0495630_0018405 3300046517 Bacteria 5132
488 Ga0495631_0009175 3300046518 Bacteria 4955
489 Ga0495637_0077790 3300046520 Bacteria 1327
490 Ga0495648_0006307 3300046524 Bacteria 9699
491 Ga0495648_0016466 3300046524 Bacteria 5332
492 Ga0495652_0090646 3300046529 Bacteria 2501
493 Ga0495652_0143476 3300046529 Bacteria 1875
494 Ga0495654_0114740 3300046530 Bacteria 1225
495 Ga0495665_0248059 3300046531 Unclassified 917
496 Ga0495640_0217158 3300046533 Unclassified 1207
497 Ga0495645_0586458 3300046543 Unclassified 687
498 Ga0495633_0000083 3300046558 Bacteria 125035
499 Ga0495633_0000153 3300046558 Bacteria 90972
500 Ga0495633_0017324 3300046558 Bacteria 3687
501 Ga0495633_0034954 3300046558 Unclassified 2415
502 Ga0495668_0000121 3300046616 Bacteria 116234
503 Ga0495611_0081902 3300046648 Bacteria 1485
504 Ga0495625_0000007 3300046660 Bacteria 565749
505 Ga0495625_0001973 3300046660 Bacteria 23152
506 Ga0495625_0006401 3300046660 Bacteria 10499
507 Ga0495625_0008135 3300046660 Bacteria 8986
508 Ga0495625_0078788 3300046660 Bacteria 2300
509 Ga0495625_0316324 3300046660 Bacteria 995
510 Ga0495625_0354201 3300046660 Bacteria 927
511 Ga0495661_0001101 3300046665 Bacteria 23675
512 Ga0495661_0002357 3300046665 Bacteria 14578
513 Ga0495661_0197159 3300046665 Bacteria 1056
514 Ga0495658_0031424 3300046683 Unclassified 2892
515 Ga0495671_0043664 3300046692 Bacteria 2250
516 Ga0495649_0000007 3300046694 Bacteria 518037
517 Ga0495589_0075059 3300046794 Bacteria 1649
518 Ga0495660_0005748 3300046810 Bacteria 7407
519 Ga0495683_0075656 3300047323 Bacteria 1649
520 Ga0495687_001260 3300047443 Bacteria 23990
521 Ga0495687_001497 3300047443 Bacteria 21340
522 Ga0495687_055489 3300047443 Bacteria 1656
523 Ga0495687_109871 3300047443 Bacteria 1016
524 Ga0495675_0326562 3300047444 Bacteria 907
525 Ga0495679_034083 3300047446 Bacteria 1623
526 Ga0495673_0047965 3300047469 Bacteria 1885
527 Ga0495684_0079033 3300047471 Unclassified 2497
528 Ga0495686_0000965 3300047472 Bacteria 35434
529 Ga0495686_0001123 3300047472 Bacteria 31643
530 Ga0495686_0015394 3300047472 Bacteria 5224
531 Ga0495686_0027599 3300047472 Bacteria 3705
532 Ga0495686_0147874 3300047472 Bacteria 1381
533 Ga0496100_0282988 3300048903 Unclassified 1237
534 Ga0496101_0696254 3300048904 Bacteria 802
535 Ga0496104_0714278 3300048907 Bacteria 910
536 Ga0496104_0754499 3300048907 Bacteria 880
537 Ga0496108_0364577 3300048911 Bacteria 1261
538 Ga0496109_0089044 3300048912 Unclassified 2853
539 Ga0496109_0315683 3300048912 Bacteria 1475
540 Ga0496114_0437231 3300048917 Unclassified 1159
541 Ga0496115_0188000 3300048918 Bacteria 1707
542 Ga0496121_0000051 3300048924 Bacteria 315378
543 Ga0496126_0054588 3300048929 Bacteria 3618
544 Ga0495678_040844 3300049459 Bacteria 1861
545 Ga0501300_009279 3300049523 Bacteria 1436
546 Ga0501033_0105592 3300049570 Bacteria 2053
547 Ga0501033_0325518 3300049570 Bacteria 1079
548 Ga0501034_0000007 3300049571 Bacteria 357805
549 Ga0501034_0048239 3300049571 Bacteria 4298
550 Ga0501043_0539458 3300049579 Bacteria 868
551 Ga0501069_0130163 3300049585 Bacteria 1440
552 Ga0501070_0175491 3300049586 Bacteria 1764
553 Ga0501074_0017551 3300049590 Bacteria 5195
554 Ga0501076_0989125 3300049592 Bacteria 693
555 Ga0501223_001851 3300049663 Bacteria 4776
556 Ga0501240_001227 3300049673 Bacteria 2443
557 Ga0501243_009896 3300049675 Unclassified 1484
558 Ga0501080_0158242 3300049742 Bacteria 2092
559 Ga0501083_0042760 3300049744 Bacteria 3070
560 Ga0501241_000377 3300049758 Bacteria 9724
561 Ga0501044_0280459 3300049823 Bacteria 1600
562 nmdc:mga0k408_44_c2 3300050493 Bacteria 32487
563 nmdc:mga0k408_80_c1 3300050493 Bacteria 45357
564 nmdc:mga07m45_148261_c1 3300050496 Bacteria 1360
565 nmdc:mga07m45_66674_c1 3300050496 Bacteria 2045
566 Ga0500635_0000452 3300053080 Bacteria 11825
567 Ga0500644_0002231 3300053088 Bacteria 4887
568 Ga0500556_0116398 3300053104 Bacteria 1040
569 Ga0500569_000051 3300053109 Bacteria 21519
570 Ga0500607_023581 3300053121 Bacteria 3446
571 Ga0500608_001705 3300053122 Bacteria 7868
572 Ga0500608_139355 3300053122 Bacteria 1078
573 Ga0500618_000006 3300053125 Bacteria 239188
574 Ga0500618_033030 3300053125 Bacteria 1208
575 Ga0500658_0004833 3300053134 Bacteria 5025
576 Ga0500561_0020371 3300053137 Bacteria 1550
577 Ga0500577_0000576 3300053142 Bacteria 9471
578 Ga0500590_013643 3300053148 Bacteria 4174
579 Ga0500616_0022449 3300053153 Bacteria 3522
580 Ga0500622_0000673 3300053156 Bacteria 30220
581 Ga0500622_0001513 3300053156 Bacteria 18450
582 Ga0500624_000567 3300053157 Bacteria 10211
583 Ga0500633_0004242 3300053160 Bacteria 3263
584 Ga0500634_0116500 3300053161 Bacteria 1308
585 Ga0500636_0011566 3300053177 Bacteria 5167
586 Ga0501082_0271393 3300060353 Bacteria 1476

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042014 Ga0439457_110865 Ga0439457_110865_26_571 180
2 iso_pu_bacteria 2890737413 2890740313 181
3 3300046507 Ga0495606_0003806 Ga0495606_0003806_8445_9095 190
4 3300047471 Ga0495684_0079033 Ga0495684_0079033_617_1267 190
5 3300046558 Ga0495633_0000153 Ga0495633_0000153_69385_70002 193
6 3300044712 Ga0453684_0044892 Ga0453684_0044892_5221_5835 198
7 3300038725 Ga0400484_07716 Ga0400484_07716_360_974 200
8 3300038726 Ga0400490_57711 Ga0400490_57711_1960_2574 200
9 3300038726 Ga0400490_59015 Ga0400490_59015_599_1213 200
10 3300005458 Ga0070681_10376082 Ga0070681_103760822 201
11 3300025949 Ga0207667_11044124 Ga0207667_110441241 201
12 3300044712 Ga0453684_0118794 Ga0453684_0118794_330_947 201
13 iso_pu_bacteria 2522125168 2522548265 201
14 iso_pu_bacteria 2599185184 2599480765 201
15 iso_pu_bacteria 2818991442 2819577217 201
16 iso_pu_bacteria 2818991460 2819676361 201
17 iso_pu_bacteria 2821136567 2821140520 201
18 iso_pu_bacteria 2840677318 2840679293 201
19 iso_pu_bacteria 2842903701 2842904847 201
20 iso_pu_bacteria 2883068021 2883069922 201
21 iso_pu_bacteria 2884791551 2884796193 201
22 iso_pu_bacteria 2884933994 2884934837 201
23 iso_pu_bacteria 2896085136 2896087104 201
24 iso_pu_bacteria 2896317667 2896320938 201
25 iso_pu_bacteria 2898713307 2898716027 201
26 iso_pu_bacteria 2904467357 2904472940 201
27 iso_pu_bacteria 2919437846 2919439933 201
28 iso_pu_bacteria 2928078545 2928081658 201
29 iso_pu_bacteria 2928147474 2928150314 201
30 iso_pu_bacteria 2929177148 2929178298 201
31 iso_pu_bacteria 2929239360 2929240599 201
32 iso_pu_bacteria 2929921140 2929922447 201
33 iso_pu_bacteria 2932082852 2932085138 201
34 iso_pu_bacteria 2945977869 2945980664 201
35 iso_pu_bacteria 3003233435 3003236487 201
36 iso_pu_bacteria 8003151029 8003153871 201
37 iso_pu_bacteria 8055588893 8055590136 201
38 3300005288 Ga0065714_10213702 Ga0065714_102137022 202
39 3300041459 Ga0451800_1250505 Ga0451800_1250505_123_731 202
40 iso_pu_bacteria 2896109856 2896114397 202
41 3300002077 JGI24744J21845_10012713 JGI24744J21845_100127132 203
42 3300005337 Ga0070682_100033894 Ga0070682_1000338942 203
43 3300005355 Ga0070671_100294613 Ga0070671_1002946131 203
44 3300005355 Ga0070671_100727141 Ga0070671_1007271411 203
45 3300005459 Ga0068867_100042981 Ga0068867_1000429813 203
46 3300005543 Ga0070672_100835063 Ga0070672_1008350631 203
47 3300006237 Ga0097621_100006952 Ga0097621_1000069522 203
48 3300006358 Ga0068871_100001976 Ga0068871_1000019769 203
49 3300009093 Ga0105240_10027963 Ga0105240_100279634 203
50 3300013296 Ga0157374_11069221 Ga0157374_110692211 203
51 3300013306 Ga0163162_10873141 Ga0163162_108731411 203
52 3300013308 Ga0157375_10533170 Ga0157375_105331702 203
53 3300013308 Ga0157375_10721740 Ga0157375_107217402 203
54 3300014326 Ga0157380_10000011 Ga0157380_1000001111 203
55 3300025913 Ga0207695_10144936 Ga0207695_101449363 203
56 3300025925 Ga0207650_10686925 Ga0207650_106869251 203
57 3300025986 Ga0207658_10541593 Ga0207658_105415932 203
58 3300026089 Ga0207648_10014556 Ga0207648_100145563 203
59 3300026142 Ga0207698_10160118 Ga0207698_101601181 203
60 3300032004 Ga0307414_10114477 Ga0307414_101144772 203
61 3300048912 Ga0496109_0315683 Ga0496109_0315683_476_1087 203
62 3300049571 Ga0501034_0000007 Ga0501034_0000007_73572_74195 203
63 3300005328 Ga0070676_10012058 Ga0070676_100120583 204
64 3300005334 Ga0068869_100121472 Ga0068869_1001214722 204
65 3300005335 Ga0070666_10010165 Ga0070666_100101656 204
66 3300005336 Ga0070680_100023459 Ga0070680_1000234594 204
67 3300005338 Ga0068868_100007993 Ga0068868_1000079934 204
68 3300005341 Ga0070691_10099457 Ga0070691_100994572 204
69 3300005354 Ga0070675_100019801 Ga0070675_1000198016 204
70 3300005355 Ga0070671_100105996 Ga0070671_1001059962 204
71 3300005355 Ga0070671_100140233 Ga0070671_1001402333 204
72 3300005364 Ga0070673_100014307 Ga0070673_1000143076 204
73 3300005367 Ga0070667_100000031 Ga0070667_1000000314 204
74 3300005458 Ga0070681_10115268 Ga0070681_101152682 204
75 3300005459 Ga0068867_100012634 Ga0068867_1000126342 204
76 3300005530 Ga0070679_100165325 Ga0070679_1001653252 204
77 3300005535 Ga0070684_100447855 Ga0070684_1004478553 204
78 3300005539 Ga0068853_100019053 Ga0068853_1000190532 204
79 3300005543 Ga0070672_100005602 Ga0070672_1000056024 204
80 3300005548 Ga0070665_100002650 Ga0070665_1000026501 204
81 3300005614 Ga0068856_100966031 Ga0068856_1009660311 204
82 3300005616 Ga0068852_100141912 Ga0068852_1001419122 204
83 3300005618 Ga0068864_100006018 Ga0068864_1000060184 204
84 3300005834 Ga0068851_10001096 Ga0068851_1000109613 204
85 3300005841 Ga0068863_100018879 Ga0068863_1000188795 204
86 3300005841 Ga0068863_100499893 Ga0068863_1004998932 204
87 3300005842 Ga0068858_100021942 Ga0068858_1000219422 204
88 3300005843 Ga0068860_100016192 Ga0068860_1000161924 204
89 3300005843 Ga0068860_100243294 Ga0068860_1002432942 204
90 3300006237 Ga0097621_100003766 Ga0097621_1000037664 204
91 3300006237 Ga0097621_100010393 Ga0097621_1000103934 204
92 3300006358 Ga0068871_100007909 Ga0068871_1000079094 204
93 3300006358 Ga0068871_100012713 Ga0068871_1000127135 204
94 3300006881 Ga0068865_100004346 Ga0068865_1000043462 204
95 3300009093 Ga0105240_10025938 Ga0105240_100259382 204
96 3300009093 Ga0105240_10039588 Ga0105240_100395887 204
97 3300009093 Ga0105240_10176466 Ga0105240_101764664 204
98 3300009098 Ga0105245_10473657 Ga0105245_104736572 204
99 3300009101 Ga0105247_10027343 Ga0105247_100273433 204
100 3300009148 Ga0105243_10091725 Ga0105243_100917253 204
101 3300009174 Ga0105241_10722340 Ga0105241_107223401 204
102 3300009176 Ga0105242_10035688 Ga0105242_100356882 204
103 3300009177 Ga0105248_10046424 Ga0105248_100464245 204
104 3300009545 Ga0105237_10730910 Ga0105237_107309102 204
105 3300009551 Ga0105238_10735217 Ga0105238_107352171 204
106 3300009553 Ga0105249_10345667 Ga0105249_103456672 204
107 3300010375 Ga0105239_10188861 Ga0105239_101888612 204
108 3300011119 Ga0105246_10586072 Ga0105246_105860722 204
109 3300013102 Ga0157371_10375272 Ga0157371_103752722 204
110 3300013104 Ga0157370_10021907 Ga0157370_100219077 204
111 3300013105 Ga0157369_10718673 Ga0157369_107186732 204
112 3300013296 Ga0157374_10015781 Ga0157374_100157816 204
113 3300013296 Ga0157374_10020461 Ga0157374_100204614 204
114 3300013297 Ga0157378_10014751 Ga0157378_100147512 204
115 3300013297 Ga0157378_11352396 Ga0157378_113523961 204
116 3300013306 Ga0163162_10018688 Ga0163162_100186884 204
117 3300013307 Ga0157372_10356668 Ga0157372_103566682 204
118 3300013307 Ga0157372_10391523 Ga0157372_103915232 204
119 3300013308 Ga0157375_10023788 Ga0157375_100237887 204
120 3300013308 Ga0157375_10137594 Ga0157375_101375942 204
121 3300014325 Ga0163163_10000174 Ga0163163_100001744 204
122 3300014325 Ga0163163_10474446 Ga0163163_104744462 204
123 3300014968 Ga0157379_10007490 Ga0157379_100074903 204
124 3300014968 Ga0157379_10015024 Ga0157379_100150242 204
125 3300014968 Ga0157379_10375806 Ga0157379_103758062 204
126 3300014969 Ga0157376_10029662 Ga0157376_100296624 204
127 3300014969 Ga0157376_10144501 Ga0157376_101445013 204
128 3300017792 Ga0163161_10009734 Ga0163161_100097342 204
129 3300025315 Ga0207697_10037886 Ga0207697_100378862 204
130 3300025321 Ga0207656_10045330 Ga0207656_100453302 204
131 3300025903 Ga0207680_10005574 Ga0207680_100055742 204
132 3300025907 Ga0207645_10011365 Ga0207645_100113653 204
133 3300025911 Ga0207654_10041602 Ga0207654_100416023 204
134 3300025912 Ga0207707_10016419 Ga0207707_100164196 204
135 3300025913 Ga0207695_10030928 Ga0207695_100309286 204
136 3300025913 Ga0207695_10111298 Ga0207695_101112982 204
137 3300025913 Ga0207695_10120103 Ga0207695_101201033 204
138 3300025917 Ga0207660_10007186 Ga0207660_100071868 204
139 3300025919 Ga0207657_10146379 Ga0207657_101463792 204
140 3300025921 Ga0207652_10015048 Ga0207652_100150482 204
141 3300025927 Ga0207687_10309619 Ga0207687_103096192 204
142 3300025934 Ga0207686_10417597 Ga0207686_104175971 204
143 3300025938 Ga0207704_10045232 Ga0207704_100452323 204
144 3300025940 Ga0207691_10027168 Ga0207691_100271686 204
145 3300025941 Ga0207711_10096689 Ga0207711_100966891 204
146 3300025942 Ga0207689_10074538 Ga0207689_100745383 204
147 3300025960 Ga0207651_10008410 Ga0207651_100084102 204
148 3300025961 Ga0207712_10209949 Ga0207712_102099492 204
149 3300025972 Ga0207668_10000298 Ga0207668_100002984 204
150 3300025986 Ga0207658_10013104 Ga0207658_100131041 204
151 3300026023 Ga0207677_10004006 Ga0207677_100040064 204
152 3300026035 Ga0207703_10006892 Ga0207703_100068928 204
153 3300026041 Ga0207639_10015040 Ga0207639_100150402 204
154 3300026088 Ga0207641_10009560 Ga0207641_100095604 204
155 3300026088 Ga0207641_10477571 Ga0207641_104775711 204
156 3300026089 Ga0207648_10031381 Ga0207648_100313812 204
157 3300026095 Ga0207676_10003554 Ga0207676_1000355412 204
158 3300026142 Ga0207698_10021199 Ga0207698_100211992 204
159 3300026142 Ga0207698_10760698 Ga0207698_107606981 204
160 3300028379 Ga0268266_10013819 Ga0268266_100138197 204
161 3300028381 Ga0268264_10003219 Ga0268264_100032192 204
162 3300028381 Ga0268264_10399178 Ga0268264_103991782 204
163 3300028794 Ga0307515_10000001 Ga0307515_100000012150 204
164 3300031548 Ga0307408_100000393 Ga0307408_10000039323 204
165 3300031911 Ga0307412_10064186 Ga0307412_100641862 204
166 3300035172 Ga0373955_0209888 Ga0373955_0209888_41_667 204
167 3300035410 Ga0373924_0048357 Ga0373924_0048357_223_918 204
168 3300036401 Ga0373937_0009187 Ga0373937_0009187_104_721 204
169 3300037312 Ga0395899_0000017 Ga0395899_0000017_313034_313669 204
170 3300046459 Ga0495629_0120850 Ga0495629_0120850_1036_1653 204
171 3300046514 Ga0495618_0544228 Ga0495618_0544228_21_638 204
172 3300046517 Ga0495630_0018405 Ga0495630_0018405_13_708 204
173 3300046531 Ga0495665_0248059 Ga0495665_0248059_75_692 204
174 3300046533 Ga0495640_0217158 Ga0495640_0217158_262_879 204
175 3300046543 Ga0495645_0586458 Ga0495645_0586458_43_663 204
176 3300046558 Ga0495633_0034954 Ga0495633_0034954_793_1410 204
177 3300046683 Ga0495658_0031424 Ga0495658_0031424_293_910 204
178 3300047444 Ga0495675_0326562 Ga0495675_0326562_236_853 204
179 3300048903 Ga0496100_0282988 Ga0496100_0282988_294_941 204
180 3300048907 Ga0496104_0714278 Ga0496104_0714278_244_861 204
181 3300048907 Ga0496104_0754499 Ga0496104_0754499_99_725 204
182 3300048911 Ga0496108_0364577 Ga0496108_0364577_458_1075 204
183 3300048912 Ga0496109_0089044 Ga0496109_0089044_89_706 204
184 3300048917 Ga0496114_0437231 Ga0496114_0437231_438_1055 204
185 3300048918 Ga0496115_0188000 Ga0496115_0188000_563_1189 204
186 3300049570 Ga0501033_0105592 Ga0501033_0105592_1261_1884 204
187 3300049579 Ga0501043_0539458 Ga0501043_0539458_35_664 204
188 3300049585 Ga0501069_0130163 Ga0501069_0130163_463_1092 204
189 3300049586 Ga0501070_0175491 Ga0501070_0175491_110_739 204
190 3300049590 Ga0501074_0017551 Ga0501074_0017551_1728_2357 204
191 3300049592 Ga0501076_0989125 Ga0501076_0989125_44_673 204
192 3300049742 Ga0501080_0158242 Ga0501080_0158242_514_1140 204
193 3300049744 Ga0501083_0042760 Ga0501083_0042760_24_650 204
194 3300049823 Ga0501044_0280459 Ga0501044_0280459_952_1581 204
195 3300060353 Ga0501082_0271393 Ga0501082_0271393_210_836 204
196 3300001979 JGI24740J21852_10007285 JGI24740J21852_100072852 205
197 3300001989 JGI24739J22299_10028909 JGI24739J22299_100289093 205
198 3300001990 JGI24737J22298_10003208 JGI24737J22298_100032085 205
199 3300001990 JGI24737J22298_10035536 JGI24737J22298_100355362 205
200 3300002067 JGI24735J21928_10000093 JGI24735J21928_1000009311 205
201 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008356 205
202 3300002737 JGI25162J39368_1000097 JGI25162J39368_100009711 205
203 3300002737 JGI25162J39368_1001750 JGI25162J39368_10017504 205
204 3300002738 JGI25154J39366_1000021 JGI25154J39366_1000021128 205
205 3300002741 JGI25157J39369_1013421 JGI25157J39369_10134211 205
206 3300002772 JGI25164J39214_1002319 JGI25164J39214_10023193 205
207 3300003214 JGI25165J46597_1001806 JGI25165J46597_10018061 205
208 3300003316 rootH1_10051127 rootH1_100511273 205
209 3300003320 rootH2_10001273 rootH2_100012739 205
210 3300003320 rootH2_10015677 rootH2_100156775 205
211 3300003320 rootH2_10207088 rootH2_102070882 205
212 3300003320 rootH2_10241535 rootH2_102415352 205
213 3300003320 rootH2_10323976 rootH2_103239762 205
214 3300003322 rootL2_10071036 rootL2_100710364 205
215 3300003322 rootL2_10128366 rootL2_101283662 205
216 3300003322 rootL2_10211313 rootL2_102113131 205
217 3300003323 rootH1_10000975 rootH1_100009757 205
218 3300003323 rootH1_10009825 rootH1_100098256 205
219 3300003323 rootH1_10035177 rootH1_100351775 205
220 3300003323 rootH1_10035178 rootH1_100351782 205
221 3300003323 rootH1_10136596 rootH1_101365962 205
222 3300003354 JGI25160J50197_1023819 JGI25160J50197_10238192 205
223 3300003761 Ga0055535_1004402 Ga0055535_10044023 205
224 3300003762 Ga0055542_1007561 Ga0055542_10075613 205
225 3300003781 Ga0055536_1016448 Ga0055536_10164483 205
226 3300003794 Ga0055531_10000092 Ga0055531_1000009231 205
227 3300004625 Ga0055543_1021073 Ga0055543_10210732 205
228 3300004799 Ga0058863_11443821 Ga0058863_114438213 205
229 3300005262 Ga0065165_1000060 Ga0065165_100006099 205
230 3300005288 Ga0065714_10026122 Ga0065714_100261222 205
231 3300005288 Ga0065714_10067802 Ga0065714_100678027 205
232 3300005327 Ga0070658_10000675 Ga0070658_1000067523 205
233 3300005327 Ga0070658_10059384 Ga0070658_100593842 205
234 3300005328 Ga0070676_10000573 Ga0070676_100005738 205
235 3300005331 Ga0070670_100499261 Ga0070670_1004992612 205
236 3300005336 Ga0070680_100040616 Ga0070680_1000406162 205
237 3300005336 Ga0070680_100553862 Ga0070680_1005538621 205
238 3300005339 Ga0070660_100545149 Ga0070660_1005451491 205
239 3300005339 Ga0070660_100602064 Ga0070660_1006020642 205
240 3300005344 Ga0070661_100629605 Ga0070661_1006296051 205
241 3300005355 Ga0070671_100017095 Ga0070671_1000170953 205
242 3300005355 Ga0070671_100799075 Ga0070671_1007990751 205
243 3300005364 Ga0070673_100066919 Ga0070673_1000669193 205
244 3300005364 Ga0070673_100398659 Ga0070673_1003986592 205
245 3300005366 Ga0070659_100003641 Ga0070659_1000036419 205
246 3300005366 Ga0070659_100167730 Ga0070659_1001677302 205
247 3300005455 Ga0070663_100240630 Ga0070663_1002406303 205
248 3300005457 Ga0070662_100002625 Ga0070662_1000026252 205
249 3300005458 Ga0070681_10015787 Ga0070681_100157876 205
250 3300005459 Ga0068867_100001804 Ga0068867_10000180412 205
251 3300005530 Ga0070679_100081468 Ga0070679_1000814682 205
252 3300005539 Ga0068853_100010363 Ga0068853_1000103634 205
253 3300005539 Ga0068853_100046477 Ga0068853_1000464773 205
254 3300005539 Ga0068853_100105460 Ga0068853_1001054604 205
255 3300005539 Ga0068853_100256849 Ga0068853_1002568492 205
256 3300005539 Ga0068853_100830848 Ga0068853_1008308482 205
257 3300005548 Ga0070665_100000017 Ga0070665_10000001762 205
258 3300005563 Ga0068855_100000021 Ga0068855_100000021175 205
259 3300005563 Ga0068855_100001368 Ga0068855_10000136824 205
260 3300005563 Ga0068855_100144084 Ga0068855_1001440843 205
261 3300005563 Ga0068855_100163887 Ga0068855_1001638872 205
262 3300005563 Ga0068855_100306528 Ga0068855_1003065282 205
263 3300005563 Ga0068855_100438346 Ga0068855_1004383462 205
264 3300005563 Ga0068855_100574291 Ga0068855_1005742912 205
265 3300005563 Ga0068855_100922152 Ga0068855_1009221522 205
266 3300005563 Ga0068855_101055044 Ga0068855_1010550441 205
267 3300005577 Ga0068857_100056246 Ga0068857_1000562463 205
268 3300005577 Ga0068857_100076675 Ga0068857_1000766753 205
269 3300005577 Ga0068857_100128053 Ga0068857_1001280532 205
270 3300005578 Ga0068854_100113235 Ga0068854_1001132352 205
271 3300005614 Ga0068856_100000006 Ga0068856_10000000686 205
272 3300005614 Ga0068856_100004027 Ga0068856_1000040278 205
273 3300005614 Ga0068856_100036749 Ga0068856_1000367494 205
274 3300005614 Ga0068856_100050093 Ga0068856_1000500933 205
275 3300005614 Ga0068856_100339350 Ga0068856_1003393502 205
276 3300005614 Ga0068856_100604468 Ga0068856_1006044682 205
277 3300005614 Ga0068856_100972375 Ga0068856_1009723751 205
278 3300005616 Ga0068852_100005157 Ga0068852_1000051574 205
279 3300005616 Ga0068852_100215680 Ga0068852_1002156801 205
280 3300005617 Ga0068859_100000451 Ga0068859_1000004514 205
281 3300005618 Ga0068864_100514509 Ga0068864_1005145092 205
282 3300005718 Ga0068866_10183668 Ga0068866_101836682 205
283 3300005841 Ga0068863_100039830 Ga0068863_1000398303 205
284 3300005842 Ga0068858_100389251 Ga0068858_1003892512 205
285 3300006173 Ga0070716_100430837 Ga0070716_1004308371 205
286 3300006195 Ga0075366_10000019 Ga0075366_1000001938 205
287 3300006195 Ga0075366_10000496 Ga0075366_1000049612 205
288 3300006195 Ga0075366_10000779 Ga0075366_100007793 205
289 3300006237 Ga0097621_100006550 Ga0097621_1000065502 205
290 3300006353 Ga0075370_10089453 Ga0075370_100894533 205
291 3300006353 Ga0075370_10205516 Ga0075370_102055162 205
292 3300006358 Ga0068871_100000491 Ga0068871_1000004912 205
293 3300006881 Ga0068865_100000070 Ga0068865_10000007025 205
294 3300006931 Ga0097620_100000451 Ga0097620_10000045136 205
295 3300009093 Ga0105240_10000083 Ga0105240_10000083115 205
296 3300009093 Ga0105240_10008396 Ga0105240_100083968 205
297 3300009093 Ga0105240_10083621 Ga0105240_100836213 205
298 3300009093 Ga0105240_10225835 Ga0105240_102258351 205
299 3300009093 Ga0105240_10269418 Ga0105240_102694182 205
300 3300009093 Ga0105240_10296890 Ga0105240_102968902 205
301 3300009093 Ga0105240_10361767 Ga0105240_103617671 205
302 3300009093 Ga0105240_10385162 Ga0105240_103851622 205
303 3300009093 Ga0105240_10495934 Ga0105240_104959342 205
304 3300009093 Ga0105240_10511430 Ga0105240_105114302 205
305 3300009093 Ga0105240_10857896 Ga0105240_108578961 205
306 3300009093 Ga0105240_11244867 Ga0105240_112448671 205
307 3300009093 Ga0105240_11247030 Ga0105240_112470301 205
308 3300009098 Ga0105245_10958546 Ga0105245_109585461 205
309 3300009174 Ga0105241_10005957 Ga0105241_100059575 205
310 3300009174 Ga0105241_10015143 Ga0105241_100151436 205
311 3300009176 Ga0105242_10023716 Ga0105242_100237165 205
312 3300009176 Ga0105242_11291975 Ga0105242_112919751 205
313 3300009545 Ga0105237_10000138 Ga0105237_100001389 205
314 3300009545 Ga0105237_10002154 Ga0105237_100021545 205
315 3300009545 Ga0105237_10007680 Ga0105237_1000768011 205
316 3300009545 Ga0105237_10008458 Ga0105237_1000845810 205
317 3300009545 Ga0105237_10053901 Ga0105237_100539015 205
318 3300009545 Ga0105237_10141157 Ga0105237_101411572 205
319 3300009545 Ga0105237_10240923 Ga0105237_102409232 205
320 3300009545 Ga0105237_10272179 Ga0105237_102721792 205
321 3300009545 Ga0105237_10689663 Ga0105237_106896632 205
322 3300009551 Ga0105238_10005277 Ga0105238_100052779 205
323 3300009551 Ga0105238_10105278 Ga0105238_101052783 205
324 3300009551 Ga0105238_10230185 Ga0105238_102301853 205
325 3300009551 Ga0105238_10969985 Ga0105238_109699852 205
326 3300009553 Ga0105249_10472583 Ga0105249_104725832 205
327 3300010375 Ga0105239_10000026 Ga0105239_10000026170 205
328 3300010375 Ga0105239_10000130 Ga0105239_1000013030 205
329 3300010375 Ga0105239_10002143 Ga0105239_100021435 205
330 3300010375 Ga0105239_10012139 Ga0105239_100121392 205
331 3300010375 Ga0105239_10025142 Ga0105239_100251423 205
332 3300010375 Ga0105239_10100768 Ga0105239_101007683 205
333 3300010375 Ga0105239_10137613 Ga0105239_101376133 205
334 3300010375 Ga0105239_10152826 Ga0105239_101528263 205
335 3300010375 Ga0105239_10354620 Ga0105239_103546202 205
336 3300010375 Ga0105239_10424527 Ga0105239_104245272 205
337 3300010375 Ga0105239_10666606 Ga0105239_106666062 205
338 3300010375 Ga0105239_10688901 Ga0105239_106889011 205
339 3300010375 Ga0105239_11200131 Ga0105239_112001312 205
340 3300011119 Ga0105246_10253392 Ga0105246_102533922 205
341 3300011119 Ga0105246_10395036 Ga0105246_103950362 205
342 3300013100 Ga0157373_10000057 Ga0157373_1000005781 205
343 3300013100 Ga0157373_10487969 Ga0157373_104879691 205
344 3300013102 Ga0157371_10000480 Ga0157371_1000048030 205
345 3300013102 Ga0157371_10015232 Ga0157371_100152327 205
346 3300013102 Ga0157371_10044041 Ga0157371_100440413 205
347 3300013102 Ga0157371_10362593 Ga0157371_103625932 205
348 3300013104 Ga0157370_10015989 Ga0157370_100159895 205
349 3300013104 Ga0157370_10018014 Ga0157370_100180147 205
350 3300013104 Ga0157370_10085253 Ga0157370_100852533 205
351 3300013104 Ga0157370_10162454 Ga0157370_101624544 205
352 3300013104 Ga0157370_10260024 Ga0157370_102600242 205
353 3300013105 Ga0157369_10000301 Ga0157369_1000030139 205
354 3300013105 Ga0157369_10271904 Ga0157369_102719042 205
355 3300013105 Ga0157369_10391029 Ga0157369_103910292 205
356 3300013296 Ga0157374_10002863 Ga0157374_100028638 205
357 3300013296 Ga0157374_10003120 Ga0157374_100031208 205
358 3300013296 Ga0157374_10008123 Ga0157374_100081232 205
359 3300013296 Ga0157374_10201079 Ga0157374_102010792 205
360 3300013296 Ga0157374_10321735 Ga0157374_103217352 205
361 3300013297 Ga0157378_10007469 Ga0157378_100074693 205
362 3300013297 Ga0157378_10343634 Ga0157378_103436342 205
363 3300013306 Ga0163162_10000026 Ga0163162_10000026101 205
364 3300013306 Ga0163162_10011373 Ga0163162_100113736 205
365 3300013306 Ga0163162_10024812 Ga0163162_100248125 205
366 3300013306 Ga0163162_11575775 Ga0163162_115757751 205
367 3300013307 Ga0157372_10000037 Ga0157372_10000037110 205
368 3300013307 Ga0157372_10000158 Ga0157372_100001587 205
369 3300013307 Ga0157372_10006525 Ga0157372_100065258 205
370 3300013307 Ga0157372_10188347 Ga0157372_101883473 205
371 3300013307 Ga0157372_10290738 Ga0157372_102907382 205
372 3300013307 Ga0157372_10310872 Ga0157372_103108723 205
373 3300013308 Ga0157375_10111239 Ga0157375_101112393 205
374 3300013308 Ga0157375_10164228 Ga0157375_101642284 205
375 3300013308 Ga0157375_10296764 Ga0157375_102967643 205
376 3300013308 Ga0157375_10779700 Ga0157375_107797002 205
377 3300014325 Ga0163163_10102441 Ga0163163_101024412 205
378 3300014745 Ga0157377_10288539 Ga0157377_102885392 205
379 3300015265 Ga0182005_1000042 Ga0182005_100004274 205
380 3300017792 Ga0163161_10277896 Ga0163161_102778962 205
381 3300025208 Ga0209436_104712 Ga0209436_1047122 205
382 3300025231 Ga0207427_100083 Ga0207427_100083104 205
383 3300025233 Ga0209437_100021 Ga0209437_100021363 205
384 3300025233 Ga0209437_100030 Ga0209437_10003089 205
385 3300025242 Ga0209258_100032 Ga0209258_10003210 205
386 3300025246 Ga0209646_1000050 Ga0209646_1000050126 205
387 3300025250 Ga0209026_1000195 Ga0209026_100019553 205
388 3300025250 Ga0209026_1001818 Ga0209026_10018187 205
389 3300025250 Ga0209026_1007931 Ga0209026_10079313 205
390 3300025254 Ga0209148_1000167 Ga0209148_1000167125 205
391 3300025261 Ga0209233_1000035 Ga0209233_1000035275 205
392 3300025261 Ga0209233_1002780 Ga0209233_10027802 205
393 3300025272 Ga0209455_1004639 Ga0209455_10046393 205
394 3300025284 Ga0209130_1006047 Ga0209130_10060473 205
395 3300025292 Ga0209676_1000351 Ga0209676_100035133 205
396 3300025302 Ga0207426_1000250 Ga0207426_100025025 205
397 3300025302 Ga0207426_1005879 Ga0207426_10058794 205
398 3300025304 Ga0209257_1000128 Ga0209257_100012864 205
399 3300025899 Ga0207642_10354547 Ga0207642_103545471 205
400 3300025904 Ga0207647_10002483 Ga0207647_100024838 205
401 3300025904 Ga0207647_10014044 Ga0207647_100140444 205
402 3300025907 Ga0207645_10002024 Ga0207645_1000202410 205
403 3300025909 Ga0207705_10000035 Ga0207705_10000035198 205
404 3300025909 Ga0207705_10342794 Ga0207705_103427941 205
405 3300025911 Ga0207654_10021925 Ga0207654_100219252 205
406 3300025912 Ga0207707_10009099 Ga0207707_100090993 205
407 3300025913 Ga0207695_10000127 Ga0207695_10000127114 205
408 3300025913 Ga0207695_10006085 Ga0207695_1000608511 205
409 3300025913 Ga0207695_10012308 Ga0207695_100123084 205
410 3300025913 Ga0207695_10042968 Ga0207695_100429682 205
411 3300025913 Ga0207695_10218518 Ga0207695_102185182 205
412 3300025913 Ga0207695_10221844 Ga0207695_102218443 205
413 3300025913 Ga0207695_10356529 Ga0207695_103565291 205
414 3300025913 Ga0207695_10616676 Ga0207695_106166762 205
415 3300025914 Ga0207671_10001040 Ga0207671_1000104021 205
416 3300025914 Ga0207671_10004045 Ga0207671_100040459 205
417 3300025914 Ga0207671_10004973 Ga0207671_100049738 205
418 3300025914 Ga0207671_10030893 Ga0207671_100308935 205
419 3300025914 Ga0207671_10131153 Ga0207671_101311531 205
420 3300025914 Ga0207671_10142188 Ga0207671_101421882 205
421 3300025914 Ga0207671_10159797 Ga0207671_101597972 205
422 3300025914 Ga0207671_10453620 Ga0207671_104536202 205
423 3300025917 Ga0207660_10026645 Ga0207660_100266452 205
424 3300025917 Ga0207660_10080911 Ga0207660_100809112 205
425 3300025919 Ga0207657_10043324 Ga0207657_100433247 205
426 3300025919 Ga0207657_10533985 Ga0207657_105339851 205
427 3300025921 Ga0207652_10020517 Ga0207652_100205176 205
428 3300025921 Ga0207652_10081881 Ga0207652_100818812 205
429 3300025924 Ga0207694_10156594 Ga0207694_101565942 205
430 3300025924 Ga0207694_10737240 Ga0207694_107372401 205
431 3300025927 Ga0207687_10958611 Ga0207687_109586111 205
432 3300025931 Ga0207644_10033864 Ga0207644_100338643 205
433 3300025932 Ga0207690_10007346 Ga0207690_100073461 205
434 3300025932 Ga0207690_10014185 Ga0207690_100141854 205
435 3300025933 Ga0207706_10000662 Ga0207706_1000066234 205
436 3300025934 Ga0207686_10005823 Ga0207686_100058235 205
437 3300025938 Ga0207704_10002226 Ga0207704_100022268 205
438 3300025949 Ga0207667_10000014 Ga0207667_10000014384 205
439 3300025949 Ga0207667_10007695 Ga0207667_100076956 205
440 3300025949 Ga0207667_10036206 Ga0207667_100362065 205
441 3300025949 Ga0207667_10058276 Ga0207667_100582763 205
442 3300025949 Ga0207667_10083618 Ga0207667_100836183 205
443 3300025949 Ga0207667_10285852 Ga0207667_102858522 205
444 3300025949 Ga0207667_10643442 Ga0207667_106434422 205
445 3300025960 Ga0207651_10117250 Ga0207651_101172503 205
446 3300025981 Ga0207640_10012943 Ga0207640_100129434 205
447 3300026023 Ga0207677_10048362 Ga0207677_100483623 205
448 3300026035 Ga0207703_10603794 Ga0207703_106037942 205
449 3300026041 Ga0207639_10035563 Ga0207639_100355633 205
450 3300026041 Ga0207639_10143870 Ga0207639_101438702 205
451 3300026067 Ga0207678_10078612 Ga0207678_100786123 205
452 3300026078 Ga0207702_10000023 Ga0207702_1000002370 205
453 3300026078 Ga0207702_10031631 Ga0207702_100316312 205
454 3300026078 Ga0207702_10082404 Ga0207702_100824042 205
455 3300026078 Ga0207702_10447935 Ga0207702_104479352 205
456 3300026078 Ga0207702_10647746 Ga0207702_106477462 205
457 3300026088 Ga0207641_10189673 Ga0207641_101896731 205
458 3300026089 Ga0207648_10004191 Ga0207648_100041912 205
459 3300026116 Ga0207674_10013741 Ga0207674_100137419 205
460 3300026116 Ga0207674_10072401 Ga0207674_100724013 205
461 3300026116 Ga0207674_10150075 Ga0207674_101500752 205
462 3300026116 Ga0207674_10278262 Ga0207674_102782622 205
463 3300026121 Ga0207683_10008462 Ga0207683_100084623 205
464 3300026142 Ga0207698_10434757 Ga0207698_104347572 205
465 3300028379 Ga0268266_10000037 Ga0268266_10000037252 205
466 3300028381 Ga0268264_10982095 Ga0268264_109820951 205
467 3300028577 Ga0265318_10009572 Ga0265318_100095722 205
468 3300028786 Ga0307517_10001388 Ga0307517_1000138844 205
469 3300028794 Ga0307515_10000077 Ga0307515_10000077156 205
470 3300028794 Ga0307515_10026002 Ga0307515_100260022 205
471 3300028794 Ga0307515_10049654 Ga0307515_100496546 205
472 3300030731 Ga0316177_1098816 Ga0316177_10988166 205
473 3300030732 Ga0316176_1004700 Ga0316176_100470011 205
474 3300030742 Ga0316183_1113144 Ga0316183_11131446 205
475 3300030744 Ga0316181_1257111 Ga0316181_12571115 205
476 3300031548 Ga0307408_100000487 Ga0307408_1000004872 205
477 3300031548 Ga0307408_101299621 Ga0307408_1012996211 205
478 3300031727 Ga0316576_10314937 Ga0316576_103149372 205
479 3300031731 Ga0307405_10002557 Ga0307405_100025574 205
480 3300031731 Ga0307405_10015289 Ga0307405_100152892 205
481 3300031911 Ga0307412_10005666 Ga0307412_100056667 205
482 3300031911 Ga0307412_10384576 Ga0307412_103845762 205
483 3300032004 Ga0307414_10019467 Ga0307414_100194676 205
484 3300032004 Ga0307414_10097463 Ga0307414_100974633 205
485 3300032004 Ga0307414_10377740 Ga0307414_103777402 205
486 3300032004 Ga0307414_10418473 Ga0307414_104184732 205
487 3300032004 Ga0307414_11116377 Ga0307414_111163771 205
488 3300032005 Ga0307411_10080200 Ga0307411_100802003 205
489 3300033179 Ga0307507_10000143 Ga0307507_100001432 205
490 3300033180 Ga0307510_10003117 Ga0307510_1000311717 205
491 3300037312 Ga0395899_0000280 Ga0395899_0000280_19136_19768 205
492 3300037312 Ga0395899_0000793 Ga0395899_0000793_19605_20225 205
493 3300037312 Ga0395899_0025586 Ga0395899_0025586_2621_3241 205
494 3300037312 Ga0395899_0435091 Ga0395899_0435091_33_659 205
495 3300037418 Ga0395900_0001123 Ga0395900_0001123_1837_2454 205
496 3300037418 Ga0395900_0001235 Ga0395900_0001235_10738_11358 205
497 3300037418 Ga0395900_0015395 Ga0395900_0015395_7073_7693 205
498 3300037418 Ga0395900_0307677 Ga0395900_0307677_277_894 205
499 3300037418 Ga0395900_0831215 Ga0395900_0831215_195_827 205
500 3300037466 Ga0395898_0002540 Ga0395898_0002540_10065_10685 205
501 3300037466 Ga0395898_0098291 Ga0395898_0098291_743_1363 205
502 3300037471 Ga0395905_0001253 Ga0395905_0001253_10738_11358 205
503 3300037471 Ga0395905_0003224 Ga0395905_0003224_9238_9858 205
504 3300038443 Ga0395901_0000941 Ga0395901_0000941_10738_11358 205
505 3300038443 Ga0395901_0003465 Ga0395901_0003465_8238_8858 205
506 3300041997 Ga0439431_0000479 Ga0439431_0000479_1819_2436 205
507 3300041997 Ga0439431_0083809 Ga0439431_0083809_183_800 205
508 3300042002 Ga0439442_067519 Ga0439442_067519_130_747 205
509 3300042007 Ga0439449_0098683 Ga0439449_0098683_357_974 205
510 3300042014 Ga0439457_021317 Ga0439457_021317_37_654 205
511 3300042125 Ga0450923_075414 Ga0450923_075414_54_671 205
512 3300042435 Ga0439434_0077242 Ga0439434_0077242_138_755 205
513 3300044683 Ga0466965_0254467 Ga0466965_0254467_39_656 205
514 3300044693 Ga0466961_0015800 Ga0466961_0015800_1331_1963 205
515 3300044712 Ga0453684_0058165 Ga0453684_0058165_1234_1857 205
516 3300044712 Ga0453684_0172776 Ga0453684_0172776_416_1069 205
517 3300044842 Ga0466957_0608137 Ga0466957_0608137_114_731 205
518 3300045049 Ga0466959_0257309 Ga0466959_0257309_318_935 205
519 3300045836 Ga0466958_0023604 Ga0466958_0023604_584_1216 205
520 3300046454 Ga0495592_0052042 Ga0495592_0052042_1599_2222 205
521 3300046459 Ga0495629_0215041 Ga0495629_0215041_586_1224 205
522 3300046460 Ga0495638_0343569 Ga0495638_0343569_52_672 205
523 3300046462 Ga0495651_0325053 Ga0495651_0325053_225_878 205
524 3300046462 Ga0495651_0338191 Ga0495651_0338191_244_867 205
525 3300046471 Ga0495650_0000268 Ga0495650_0000268_27274_27894 205
526 3300046471 Ga0495650_0061779 Ga0495650_0061779_182_802 205
527 3300046474 Ga0495605_0126801 Ga0495605_0126801_332_952 205
528 3300046476 Ga0495662_0170263 Ga0495662_0170263_282_905 205
529 3300046492 Ga0495585_0000034 Ga0495585_0000034_98497_99117 205
530 3300046492 Ga0495585_0001510 Ga0495585_0001510_3521_4159 205
531 3300046500 Ga0495596_0011446 Ga0495596_0011446_1575_2210 205
532 3300046506 Ga0495583_0037566 Ga0495583_0037566_804_1424 205
533 3300046507 Ga0495606_0000009 Ga0495606_0000009_1261_1881 205
534 3300046507 Ga0495606_0028027 Ga0495606_0028027_487_1107 205
535 3300046512 Ga0495610_0002842 Ga0495610_0002842_6655_7275 205
536 3300046513 Ga0495616_0000848 Ga0495616_0000848_5260_5880 205
537 3300046513 Ga0495616_0000907 Ga0495616_0000907_18075_18731 205
538 3300046518 Ga0495631_0009175 Ga0495631_0009175_703_1323 205
539 3300046520 Ga0495637_0077790 Ga0495637_0077790_58_678 205
540 3300046524 Ga0495648_0006307 Ga0495648_0006307_6811_7449 205
541 3300046524 Ga0495648_0016466 Ga0495648_0016466_2778_3398 205
542 3300046529 Ga0495652_0090646 Ga0495652_0090646_1691_2314 205
543 3300046529 Ga0495652_0143476 Ga0495652_0143476_750_1370 205
544 3300046530 Ga0495654_0114740 Ga0495654_0114740_505_1143 205
545 3300046558 Ga0495633_0000083 Ga0495633_0000083_75572_76192 205
546 3300046558 Ga0495633_0017324 Ga0495633_0017324_860_1480 205
547 3300046616 Ga0495668_0000121 Ga0495668_0000121_107724_108344 205
548 3300046648 Ga0495611_0081902 Ga0495611_0081902_225_845 205
549 3300046660 Ga0495625_0000007 Ga0495625_0000007_357176_357796 205
550 3300046660 Ga0495625_0001973 Ga0495625_0001973_16784_17404 205
551 3300046660 Ga0495625_0006401 Ga0495625_0006401_3533_4171 205
552 3300046660 Ga0495625_0008135 Ga0495625_0008135_6789_7409 205
553 3300046660 Ga0495625_0078788 Ga0495625_0078788_167_799 205
554 3300046660 Ga0495625_0316324 Ga0495625_0316324_205_825 205
555 3300046660 Ga0495625_0354201 Ga0495625_0354201_220_858 205
556 3300046665 Ga0495661_0001101 Ga0495661_0001101_5860_6480 205
557 3300046665 Ga0495661_0002357 Ga0495661_0002357_10373_10993 205
558 3300046665 Ga0495661_0197159 Ga0495661_0197159_106_726 205
559 3300046692 Ga0495671_0043664 Ga0495671_0043664_751_1371 205
560 3300046694 Ga0495649_0000007 Ga0495649_0000007_79717_80337 205
561 3300046794 Ga0495589_0075059 Ga0495589_0075059_98_718 205
562 3300046810 Ga0495660_0005748 Ga0495660_0005748_4234_4857 205
563 3300047323 Ga0495683_0075656 Ga0495683_0075656_927_1547 205
564 3300047443 Ga0495687_001260 Ga0495687_001260_14913_15548 205
565 3300047443 Ga0495687_001497 Ga0495687_001497_3069_3689 205
566 3300047443 Ga0495687_055489 Ga0495687_055489_283_900 205
567 3300047443 Ga0495687_109871 Ga0495687_109871_142_768 205
568 3300047446 Ga0495679_034083 Ga0495679_034083_592_1215 205
569 3300047469 Ga0495673_0047965 Ga0495673_0047965_1061_1681 205
570 3300047472 Ga0495686_0000965 Ga0495686_0000965_4900_5520 205
571 3300047472 Ga0495686_0001123 Ga0495686_0001123_26774_27400 205
572 3300047472 Ga0495686_0015394 Ga0495686_0015394_3150_3791 205
573 3300047472 Ga0495686_0027599 Ga0495686_0027599_719_1408 205
574 3300047472 Ga0495686_0147874 Ga0495686_0147874_86_712 205
575 3300048904 Ga0496101_0696254 Ga0496101_0696254_66_683 205
576 3300048924 Ga0496121_0000051 Ga0496121_0000051_130534_131151 205
577 3300048929 Ga0496126_0054588 Ga0496126_0054588_1043_1660 205
578 3300049459 Ga0495678_040844 Ga0495678_040844_935_1591 205
579 3300049523 Ga0501300_009279 Ga0501300_009279_507_1124 205
580 3300049570 Ga0501033_0325518 Ga0501033_0325518_272_889 205
581 3300049571 Ga0501034_0048239 Ga0501034_0048239_2984_3601 205
582 3300049663 Ga0501223_001851 Ga0501223_001851_1738_2355 205
583 3300049673 Ga0501240_001227 Ga0501240_001227_1770_2393 205
584 3300049675 Ga0501243_009896 Ga0501243_009896_115_732 205
585 3300049758 Ga0501241_000377 Ga0501241_000377_5327_5947 205
586 3300050493 nmdc:mga0k408_44_c2 nmdc:mga0k408_44_c2_3759_4379 205
587 3300050493 nmdc:mga0k408_80_c1 nmdc:mga0k408_80_c1_21451_22080 205
588 3300050496 nmdc:mga07m45_148261_c1 nmdc:mga07m45_148261_c1_157_777 205
589 3300050496 nmdc:mga07m45_66674_c1 nmdc:mga07m45_66674_c1_1219_1836 205
590 3300053080 Ga0500635_0000452 Ga0500635_0000452_2620_3240 205
591 3300053088 Ga0500644_0002231 Ga0500644_0002231_415_1041 205
592 3300053104 Ga0500556_0116398 Ga0500556_0116398_366_992 205
593 3300053109 Ga0500569_000051 Ga0500569_000051_15580_16206 205
594 3300053121 Ga0500607_023581 Ga0500607_023581_1842_2468 205
595 3300053122 Ga0500608_001705 Ga0500608_001705_6049_6669 205
596 3300053122 Ga0500608_139355 Ga0500608_139355_164_784 205
597 3300053125 Ga0500618_000006 Ga0500618_000006_178007_178627 205
598 3300053125 Ga0500618_033030 Ga0500618_033030_76_696 205
599 3300053134 Ga0500658_0004833 Ga0500658_0004833_1822_2448 205
600 3300053137 Ga0500561_0020371 Ga0500561_0020371_283_909 205
601 3300053142 Ga0500577_0000576 Ga0500577_0000576_7052_7678 205
602 3300053148 Ga0500590_013643 Ga0500590_013643_823_1449 205
603 3300053153 Ga0500616_0022449 Ga0500616_0022449_2190_2816 205
604 3300053156 Ga0500622_0000673 Ga0500622_0000673_16787_17404 205
605 3300053156 Ga0500622_0001513 Ga0500622_0001513_5960_6592 205
606 3300053157 Ga0500624_000567 Ga0500624_000567_4678_5298 205
607 3300053160 Ga0500633_0004242 Ga0500633_0004242_1109_1735 205
608 3300053161 Ga0500634_0116500 Ga0500634_0116500_427_1053 205
609 3300053177 Ga0500636_0011566 Ga0500636_0011566_1414_2040 205
610 iso_pu_bacteria 2852623160 2852626385 205
611 iso_pu_bacteria 2977232053 2977234643 205
612 2162886007 SwRhRL2b_contig_1677431 SwRhRL2b_0189.00007340 206
613 3300005289 Ga0065704_10079379 Ga0065704_100793792 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

58

199

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o17-assembly1.cif.gz_B abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.8607 1 185
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8547 1 199
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8534 3 186
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8514 3 186
7f04-assembly1.cif.gz_A cytochrome c-type biogenesis protein ccmabcd from e. coli in complex with heme and atp. 0.8512 2 200
ID Description Score Start End Superfamily
af_Q4CKA0_1_130_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8984 116 186 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8817 2 56 3.40.50.300
af_E9PWJ7_506_745_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8758 3 188 3.40.50.300
af_X2JG15_1642_1882_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8695 2 186 3.40.50.300
af_Q69XA0_568_896_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8683 3 201 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1T5PCN8-F1-model_v4 ABC-type multidrug transport system, ATPase component 0.9837 1 203 GO:0005524
GO:0016887
AF-A0A1T5PCN8-F1-model_v4 ABC-type multidrug transport system, ATPase component 0.9789 1 203 GO:0005524
GO:0016887
AF-A0A4Q3KY04-F1-model_v4 deleted 0.9702 57 203
AF-A0A3B8IG06-F1-model_v4 ABC transporter ATP-binding protein 0.9642 2 199 GO:0005524
GO:0016887
AF-A0A4Q3KY04-F1-model_v4 deleted 0.9511 57 203

Feature Viewer

pLDDT pTM Quality
96.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map