F469243

General Info

Members Datasets Scaffolds Average Seq Length
613 293 1226 215

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100334656|Ga0075431_1003346562
Length 254
Sequence MRQLYVGGLDVQLNNGRQPLARNARLATTAKAKGPDSNVAVMLTINEIFHSIQGESTHTGRPCVFVRLTACDLRCSWCDTPYAFHEGRKMTVEQVLAEVSAYDCRVVEITGGEPLLQADVYPLMEQLLERGHTVMLETGGHRSIASVPSGVIRIVDVKCPGSGEADKNDWSNLDLLTPTDEVKFVIRDRADYEFARRIVGERGLIERTAAVLFSPVHAVLPARDLAAWILEDRLAVRLQLQAHKYIWGANARGV

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
173 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
176 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
203 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
248 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 2.94
Rhizosphere 91.35
Stem 0
Stem Tuber 0
Unclassified 11.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100334656 3300006847 Bacteria 1524
2 MRS1b_contig_6959019 2162886011 Bacteria 1734
3 MBSR1b_contig_998937 2162886012 Bacteria 1250
4 JGI24751J29686_10041487 3300002459 Bacteria 952
5 Ga0065712_10021037 3300005290 Bacteria 2077
6 Ga0065712_10070801 3300005290 Bacteria 5695
7 Ga0065712_10082368 3300005290 Bacteria 2922
8 Ga0065715_10005187 3300005293 Bacteria 3265
9 Ga0065715_10601995 3300005293 Unclassified 707
10 Ga0065707_10226332 3300005295 Bacteria 1205
11 Ga0070658_10487437 3300005327 Bacteria 1064
12 Ga0070676_10532724 3300005328 Bacteria 838
13 Ga0070683_100001936 3300005329 Bacteria 16209
14 Ga0070690_100003042 3300005330 Bacteria 9103
15 Ga0070690_100570615 3300005330 Bacteria 855
16 Ga0070670_100001546 3300005331 Bacteria 18553
17 Ga0070670_100012086 3300005331 Bacteria 7383
18 Ga0070670_100015848 3300005331 Bacteria 6468
19 Ga0070670_100017012 3300005331 Bacteria 6241
20 Ga0070670_100023301 3300005331 Bacteria 5329
21 Ga0070670_100202584 3300005331 Bacteria 1725
22 Ga0070677_10136355 3300005333 Unclassified 1126
23 Ga0068869_100007830 3300005334 Bacteria 6855
24 Ga0068869_100243739 3300005334 Bacteria 1433
25 Ga0068869_100839770 3300005334 Bacteria 792
26 Ga0070666_10037652 3300005335 Bacteria 3217
27 Ga0070689_100070256 3300005340 Bacteria 2733
28 Ga0070687_100018621 3300005343 Bacteria 3216
29 Ga0070687_100039049 3300005343 Bacteria 2383
30 Ga0070661_100066537 3300005344 Bacteria 2648
31 Ga0070668_100324478 3300005347 Bacteria 1297
32 Ga0070669_100122140 3300005353 Bacteria 1988
33 Ga0070669_100542585 3300005353 Unclassified 969
34 Ga0070675_100212281 3300005354 Bacteria 1683
35 Ga0070675_100219792 3300005354 Bacteria 1654
36 Ga0070675_100589503 3300005354 Bacteria 1008
37 Ga0070671_100067528 3300005355 Bacteria 2981
38 Ga0070671_100176874 3300005355 Bacteria 1806
39 Ga0070671_100341334 3300005355 Bacteria 1278
40 Ga0070674_100037111 3300005356 Bacteria 3276
41 Ga0070674_100240764 3300005356 Unclassified 1416
42 Ga0070673_100058951 3300005364 Unclassified 3037
43 Ga0070673_100317091 3300005364 Bacteria 1376
44 Ga0070688_100109823 3300005365 Bacteria 1832
45 Ga0070659_100056591 3300005366 Bacteria 3092
46 Ga0070659_100245372 3300005366 Bacteria 1483
47 Ga0070667_100023343 3300005367 Bacteria 5130
48 Ga0070667_100179978 3300005367 Bacteria 1869
49 Ga0070709_10475513 3300005434 Unclassified 945
50 Ga0070705_100001782 3300005440 Bacteria 11136
51 Ga0070700_100039068 3300005441 Bacteria 2896
52 Ga0070700_100149996 3300005441 Bacteria 1594
53 Ga0070700_100476792 3300005441 Bacteria 955
54 Ga0070694_100000678 3300005444 Bacteria 18936
55 Ga0070694_100019131 3300005444 Bacteria 4354
56 Ga0070694_100120639 3300005444 Bacteria 1881
57 Ga0070663_100669060 3300005455 Unclassified 880
58 Ga0070678_100181788 3300005456 Bacteria 1722
59 Ga0070662_100116133 3300005457 Bacteria 2045
60 Ga0070662_100180517 3300005457 Bacteria 1663
61 Ga0070662_100245190 3300005457 Bacteria 1438
62 Ga0070662_100280964 3300005457 Bacteria 1347
63 Ga0070681_10004362 3300005458 Bacteria 13453
64 Ga0070681_10204321 3300005458 Bacteria 1893
65 Ga0068867_100048017 3300005459 Bacteria 3139
66 Ga0068867_100112563 3300005459 Bacteria 2093
67 Ga0068867_100327142 3300005459 Unclassified 1272
68 Ga0070685_10118909 3300005466 Unclassified 1638
69 Ga0070685_10344719 3300005466 Bacteria 1017
70 Ga0070707_100007479 3300005468 Bacteria 10140
71 Ga0070707_100057649 3300005468 Bacteria 3726
72 Ga0070707_100211738 3300005468 Bacteria 1889
73 Ga0070707_100844285 3300005468 Bacteria 880
74 Ga0070698_100002918 3300005471 Bacteria 18812
75 Ga0070698_100017714 3300005471 Bacteria 7503
76 Ga0070698_100527861 3300005471 Bacteria 1119
77 Ga0070699_100004180 3300005518 Bacteria 12774
78 Ga0070699_100042317 3300005518 Bacteria 3941
79 Ga0070699_100143612 3300005518 Bacteria 2108
80 Ga0070699_100290881 3300005518 Bacteria 1465
81 Ga0070684_100000291 3300005535 Bacteria 34899
82 Ga0070684_100149838 3300005535 Bacteria 2113
83 Ga0070684_100277491 3300005535 Bacteria 1535
84 Ga0070684_100329593 3300005535 Bacteria 1403
85 Ga0070697_100006127 3300005536 Bacteria 9304
86 Ga0070697_100083568 3300005536 Bacteria 2633
87 Ga0070697_100107167 3300005536 Unclassified 2325
88 Ga0070672_100023119 3300005543 Unclassified 4577
89 Ga0070672_100067478 3300005543 Bacteria 2834
90 Ga0070672_100158318 3300005543 Unclassified 1877
91 Ga0070672_100265356 3300005543 Unclassified 1449
92 Ga0070672_100639252 3300005543 Unclassified 929
93 Ga0070686_100000716 3300005544 Bacteria 19297
94 Ga0070695_100000153 3300005545 Bacteria 32488
95 Ga0070695_100034763 3300005545 Bacteria 3162
96 Ga0070695_100490317 3300005545 Bacteria 948
97 Ga0070696_100001125 3300005546 Bacteria 17305
98 Ga0070696_100020451 3300005546 Bacteria 4485
99 Ga0070693_100157638 3300005547 Bacteria 1443
100 Ga0070665_100143762 3300005548 Bacteria 2388
101 Ga0070704_100000097 3300005549 Bacteria 30350
102 Ga0070704_100552950 3300005549 Unclassified 1006
103 Ga0068855_100230186 3300005563 Bacteria 2076
104 Ga0068855_100571410 3300005563 Bacteria 1222
105 Ga0070664_100003002 3300005564 Bacteria 13648
106 Ga0070664_100095724 3300005564 Bacteria 2575
107 Ga0070664_100109182 3300005564 Bacteria 2413
108 Ga0068857_100036757 3300005577 Bacteria 4339
109 Ga0068857_100123639 3300005577 Bacteria 2331
110 Ga0068857_100253118 3300005577 Unclassified 1615
111 Ga0068854_100075985 3300005578 Bacteria 2467
112 Ga0068856_100025436 3300005614 Bacteria 5774
113 Ga0070702_100002183 3300005615 Bacteria 8337
114 Ga0068852_100217557 3300005616 Bacteria 1815
115 Ga0068852_100730943 3300005616 Bacteria 1001
116 Ga0068859_100259980 3300005617 Bacteria 1827
117 Ga0068859_100344365 3300005617 Unclassified 1585
118 Ga0068859_100605655 3300005617 Bacteria 1188
119 Ga0068859_101206919 3300005617 Bacteria 833
120 Ga0068864_100032634 3300005618 Bacteria 4425
121 Ga0068864_100440421 3300005618 Unclassified 1245
122 Ga0068864_100524955 3300005618 Bacteria 1142
123 Ga0068866_10026750 3300005718 Bacteria 2729
124 Ga0068861_100008289 3300005719 Bacteria 7149
125 Ga0068861_100083102 3300005719 Unclassified 2511
126 Ga0068863_100989053 3300005841 Bacteria 844
127 Ga0068858_100075598 3300005842 Bacteria 3129
128 Ga0068858_100231252 3300005842 Bacteria 1753
129 Ga0068858_100269045 3300005842 Bacteria 1621
130 Ga0068860_100050520 3300005843 Bacteria 3958
131 Ga0068860_100063825 3300005843 Bacteria 3498
132 Ga0068862_100022809 3300005844 Bacteria 5238
133 Ga0068862_100522326 3300005844 Bacteria 1130
134 Ga0068862_100623042 3300005844 Bacteria 1038
135 Ga0068862_100645390 3300005844 Bacteria 1021
136 Ga0081539_10000025 3300005985 Bacteria 340255
137 Ga0081539_10000134 3300005985 Bacteria 173625
138 Ga0075365_10219194 3300006038 Bacteria 1335
139 Ga0075368_10006957 3300006042 Bacteria 3978
140 Ga0075363_100423625 3300006048 Bacteria 784
141 Ga0075364_10004066 3300006051 Bacteria 8395
142 Ga0075364_10020286 3300006051 Bacteria 4180
143 Ga0070712_100196970 3300006175 Bacteria 1580
144 Ga0075362_10001904 3300006177 Bacteria 6851
145 Ga0075367_10002695 3300006178 Bacteria 8187
146 Ga0075367_10035148 3300006178 Bacteria 2899
147 Ga0075367_10057450 3300006178 Bacteria 2314
148 Ga0075367_10097894 3300006178 Bacteria 1790
149 Ga0075366_10002685 3300006195 Bacteria 9176
150 Ga0075366_10039508 3300006195 Bacteria 2789
151 Ga0075366_10066293 3300006195 Unclassified 2148
152 Ga0075366_10104887 3300006195 Bacteria 1699
153 Ga0097621_100017691 3300006237 Bacteria 5421
154 Ga0097621_100431656 3300006237 Bacteria 1184
155 Ga0075370_10018140 3300006353 Bacteria 3813
156 Ga0068871_100222891 3300006358 Bacteria 1634
157 Ga0068871_100504749 3300006358 Bacteria 1091
158 Ga0075428_100006404 3300006844 Bacteria 13099
159 Ga0075428_100006986 3300006844 Bacteria 12520
160 Ga0075428_100010821 3300006844 Bacteria 10139
161 Ga0075428_100015354 3300006844 Bacteria 8493
162 Ga0075428_100032689 3300006844 Bacteria 5746
163 Ga0075428_100204182 3300006844 Bacteria 2136
164 Ga0075428_101286749 3300006844 Bacteria 769
165 Ga0075430_100009444 3300006846 Bacteria 8239
166 Ga0075430_100036237 3300006846 Bacteria 4183
167 Ga0075430_100042740 3300006846 Bacteria 3832
168 Ga0075430_100043804 3300006846 Bacteria 3784
169 Ga0075430_100075580 3300006846 Bacteria 2824
170 Ga0075430_100213219 3300006846 Bacteria 1602
171 Ga0075430_100514102 3300006846 Bacteria 988
172 Ga0075431_100013212 3300006847 Bacteria 8342
173 Ga0075431_100014795 3300006847 Bacteria 7898
174 Ga0075431_100020924 3300006847 Bacteria 6684
175 Ga0075431_100074762 3300006847 Bacteria 3496
176 Ga0075431_100206963 3300006847 Bacteria 2006
177 Ga0075433_10012730 3300006852 Bacteria 6808
178 Ga0075433_10024820 3300006852 Bacteria 5064
179 Ga0075433_10067538 3300006852 Bacteria 3138
180 Ga0075433_10075613 3300006852 Bacteria 2964
181 Ga0075433_10547775 3300006852 Unclassified 1017
182 Ga0075434_100011789 3300006871 Bacteria 8259
183 Ga0075434_100053394 3300006871 Bacteria 4016
184 Ga0075434_100139158 3300006871 Bacteria 2447
185 Ga0075429_100000763 3300006880 Bacteria 25366
186 Ga0075429_100047526 3300006880 Bacteria 3734
187 Ga0075429_100123082 3300006880 Bacteria 2268
188 Ga0075429_100164340 3300006880 Bacteria 1944
189 Ga0068865_100159990 3300006881 Bacteria 1717
190 Ga0068865_100487275 3300006881 Bacteria 1026
191 Ga0075436_100205623 3300006914 Bacteria 1395
192 Ga0075436_100253295 3300006914 Unclassified 1254
193 Ga0097620_100259955 3300006931 Bacteria 1827
194 Ga0097620_100344385 3300006931 Unclassified 1585
195 Ga0097620_100479303 3300006931 Bacteria 1340
196 Ga0097620_100605682 3300006931 Bacteria 1188
197 Ga0097620_101207133 3300006931 Bacteria 833
198 Ga0075435_100049102 3300007076 Bacteria 3392
199 Ga0075435_100053728 3300007076 Bacteria 3250
200 Ga0111539_10000201 3300009094 Bacteria 70327
201 Ga0111539_10007363 3300009094 Bacteria 14101
202 Ga0111539_10026333 3300009094 Bacteria 7110
203 Ga0111539_10286587 3300009094 Bacteria 1917
204 Ga0111539_10456999 3300009094 Bacteria 1487
205 Ga0111539_11579547 3300009094 Bacteria 761
206 Ga0111539_11608329 3300009094 Bacteria 754
207 Ga0111539_11623845 3300009094 Bacteria 750
208 Ga0105245_10237875 3300009098 Bacteria 1764
209 Ga0114129_10002318 3300009147 Bacteria 26421
210 Ga0114129_10003005 3300009147 Bacteria 23633
211 Ga0114129_10004551 3300009147 Bacteria 19567
212 Ga0114129_10007251 3300009147 Bacteria 15783
213 Ga0114129_10038556 3300009147 Bacteria 6738
214 Ga0114129_10056885 3300009147 Bacteria 5475
215 Ga0114129_10119425 3300009147 Bacteria 3631
216 Ga0114129_10193358 3300009147 Bacteria 2761
217 Ga0114129_10342827 3300009147 Unclassified 1981
218 Ga0114129_10367974 3300009147 Bacteria 1901
219 Ga0114129_10929414 3300009147 Bacteria 1100
220 Ga0114129_11191249 3300009147 Unclassified 949
221 Ga0114129_11267072 3300009147 Bacteria 915
222 Ga0105243_10050773 3300009148 Bacteria 3278
223 Ga0105243_10115192 3300009148 Bacteria 2257
224 Ga0105243_10284118 3300009148 Bacteria 1492
225 Ga0105243_10550433 3300009148 Bacteria 1102
226 Ga0105243_10880738 3300009148 Unclassified 889
227 Ga0105241_10010377 3300009174 Bacteria 6836
228 Ga0105241_10026533 3300009174 Bacteria 4311
229 Ga0105242_10012101 3300009176 Bacteria 6638
230 Ga0105242_10292234 3300009176 Bacteria 1484
231 Ga0105248_10025848 3300009177 Bacteria 6530
232 Ga0105248_10085577 3300009177 Bacteria 3547
233 Ga0105248_10114231 3300009177 Bacteria 3045
234 Ga0105248_10411507 3300009177 Bacteria 1523
235 Ga0105248_10459399 3300009177 Bacteria 1435
236 Ga0105248_10825513 3300009177 Unclassified 1046
237 Ga0105248_11554349 3300009177 Bacteria 749
238 Ga0105237_10822421 3300009545 Bacteria 936
239 Ga0105249_10132133 3300009553 Bacteria 2384
240 Ga0105249_10149471 3300009553 Bacteria 2247
241 Ga0105249_10714067 3300009553 Bacteria 1063
242 Ga0105249_10834596 3300009553 Bacteria 987
243 Ga0105239_10061566 3300010375 Bacteria 4119
244 Ga0105239_10573097 3300010375 Bacteria 1286
245 Ga0105246_10400208 3300011119 Bacteria 1140
246 Ga0105246_10480140 3300011119 Bacteria 1051
247 Ga0157374_10542354 3300013296 Unclassified 1170
248 Ga0163162_10118997 3300013306 Unclassified 2744
249 Ga0163162_10152085 3300013306 Bacteria 2432
250 Ga0163162_10195860 3300013306 Unclassified 2149
251 Ga0163162_10323554 3300013306 Unclassified 1674
252 Ga0163162_10939032 3300013306 Bacteria 976
253 Ga0157372_10308221 3300013307 Bacteria 1842
254 Ga0157375_10103371 3300013308 Bacteria 2936
255 Ga0157375_10186991 3300013308 Bacteria 2225
256 Ga0157375_10759479 3300013308 Bacteria 1120
257 Ga0163163_10033009 3300014325 Bacteria 5004
258 Ga0163163_10148620 3300014325 Bacteria 2387
259 Ga0163163_10251779 3300014325 Bacteria 1817
260 Ga0157380_10153927 3300014326 Bacteria 1991
261 Ga0157379_10061244 3300014968 Bacteria 3365
262 Ga0157379_10174701 3300014968 Bacteria 1939
263 Ga0157379_10267887 3300014968 Bacteria 1553
264 Ga0157376_10070187 3300014969 Bacteria 2973
265 Ga0157376_10144692 3300014969 Bacteria 2137
266 Ga0157376_10795671 3300014969 Unclassified 958
267 Ga0163161_10002088 3300017792 Bacteria 14477
268 Ga0207697_10000772 3300025315 Bacteria 18141
269 Ga0207697_10009729 3300025315 Bacteria 4140
270 Ga0207682_10004062 3300025893 Bacteria 6218
271 Ga0207642_10040222 3300025899 Bacteria 2038
272 Ga0207688_10002773 3300025901 Bacteria 9498
273 Ga0207688_10008212 3300025901 Bacteria 5674
274 Ga0207688_10135950 3300025901 Bacteria 1444
275 Ga0207680_10359764 3300025903 Bacteria 1023
276 Ga0207647_10095922 3300025904 Bacteria 1765
277 Ga0207699_10041267 3300025906 Bacteria 2664
278 Ga0207643_10002961 3300025908 Bacteria 9163
279 Ga0207684_10006235 3300025910 Bacteria 10891
280 Ga0207695_10341077 3300025913 Bacteria 1386
281 Ga0207660_10078602 3300025917 Bacteria 2418
282 Ga0207662_10003122 3300025918 Bacteria 8460
283 Ga0207649_10111371 3300025920 Bacteria 1829
284 Ga0207646_10263313 3300025922 Bacteria 1558
285 Ga0207646_10664670 3300025922 Bacteria 933
286 Ga0207681_10450049 3300025923 Bacteria 1047
287 Ga0207681_10634301 3300025923 Unclassified 885
288 Ga0207650_10087621 3300025925 Bacteria 2372
289 Ga0207650_10099319 3300025925 Bacteria 2237
290 Ga0207659_10024721 3300025926 Bacteria 4029
291 Ga0207659_10220862 3300025926 Bacteria 1524
292 Ga0207659_10991514 3300025926 Bacteria 723
293 Ga0207700_10032146 3300025928 Bacteria 3739
294 Ga0207644_10328459 3300025931 Bacteria 1238
295 Ga0207690_10040605 3300025932 Bacteria 3043
296 Ga0207706_10072692 3300025933 Bacteria 3024
297 Ga0207706_10080835 3300025933 Bacteria 2857
298 Ga0207706_10189724 3300025933 Bacteria 1804
299 Ga0207706_10214461 3300025933 Bacteria 1686
300 Ga0207686_10066754 3300025934 Bacteria 2299
301 Ga0207686_10283457 3300025934 Bacteria 1224
302 Ga0207686_10306502 3300025934 Bacteria 1181
303 Ga0207709_10420520 3300025935 Bacteria 1026
304 Ga0207670_10164269 3300025936 Bacteria 1660
305 Ga0207670_10466686 3300025936 Unclassified 1020
306 Ga0207670_10621876 3300025936 Bacteria 888
307 Ga0207669_10038068 3300025937 Bacteria 2766
308 Ga0207704_10172688 3300025938 Bacteria 1552
309 Ga0207704_10176021 3300025938 Bacteria 1541
310 Ga0207704_10247899 3300025938 Bacteria 1335
311 Ga0207704_10412853 3300025938 Bacteria 1068
312 Ga0207691_10007836 3300025940 Bacteria 10290
313 Ga0207691_10015326 3300025940 Bacteria 7292
314 Ga0207691_10138992 3300025940 Bacteria 2141
315 Ga0207711_10068576 3300025941 Bacteria 3072
316 Ga0207711_10260991 3300025941 Bacteria 1592
317 Ga0207711_10376615 3300025941 Bacteria 1317
318 Ga0207711_10499131 3300025941 Bacteria 1134
319 Ga0207711_10519925 3300025941 Bacteria 1110
320 Ga0207689_10014901 3300025942 Bacteria 6596
321 Ga0207689_10045850 3300025942 Bacteria 3614
322 Ga0207689_10225366 3300025942 Unclassified 1549
323 Ga0207689_10524322 3300025942 Unclassified 994
324 Ga0207661_10001428 3300025944 Bacteria 16108
325 Ga0207661_10100901 3300025944 Bacteria 2423
326 Ga0207661_10615097 3300025944 Bacteria 998
327 Ga0207679_10002083 3300025945 Bacteria 12410
328 Ga0207679_10078115 3300025945 Bacteria 2520
329 Ga0207667_10375985 3300025949 Bacteria 1448
330 Ga0207651_10332733 3300025960 Bacteria 1273
331 Ga0207651_10422867 3300025960 Bacteria 1138
332 Ga0207712_10168270 3300025961 Unclassified 1711
333 Ga0207668_10452670 3300025972 Unclassified 1096
334 Ga0207640_10007581 3300025981 Bacteria 5992
335 Ga0207658_10020246 3300025986 Bacteria 4607
336 Ga0207658_10080581 3300025986 Bacteria 2494
337 Ga0207658_10080968 3300025986 Bacteria 2489
338 Ga0207658_10140720 3300025986 Bacteria 1952
339 Ga0207677_10204865 3300026023 Bacteria 1571
340 Ga0207677_10371148 3300026023 Bacteria 1205
341 Ga0207703_10048356 3300026035 Bacteria 3434
342 Ga0207703_10548416 3300026035 Unclassified 1090
343 Ga0207639_10352562 3300026041 Bacteria 1315
344 Ga0207678_10031909 3300026067 Bacteria 4593
345 Ga0207678_10311104 3300026067 Bacteria 1354
346 Ga0207708_10001093 3300026075 Bacteria 20328
347 Ga0207708_10022135 3300026075 Unclassified 4800
348 Ga0207708_10186257 3300026075 Bacteria 1650
349 Ga0207702_10174363 3300026078 Bacteria 1975
350 Ga0207641_10008261 3300026088 Bacteria 8602
351 Ga0207641_10172018 3300026088 Bacteria 1978
352 Ga0207641_10561763 3300026088 Unclassified 1114
353 Ga0207648_10004783 3300026089 Bacteria 13831
354 Ga0207648_10009844 3300026089 Bacteria 9119
355 Ga0207648_10020920 3300026089 Bacteria 5890
356 Ga0207648_10076538 3300026089 Bacteria 2917
357 Ga0207648_10085110 3300026089 Bacteria 2758
358 Ga0207648_10110981 3300026089 Bacteria 2408
359 Ga0207648_10285243 3300026089 Bacteria 1477
360 Ga0207648_10913894 3300026089 Unclassified 820
361 Ga0207676_10095395 3300026095 Bacteria 2453
362 Ga0207676_10173082 3300026095 Bacteria 1883
363 Ga0207676_10476245 3300026095 Unclassified 1181
364 Ga0207674_10149954 3300026116 Bacteria 2289
365 Ga0207674_10196344 3300026116 Bacteria 1967
366 Ga0207674_10226036 3300026116 Bacteria 1820
367 Ga0207674_10228336 3300026116 Bacteria 1809
368 Ga0207675_100001978 3300026118 Bacteria 20432
369 Ga0207675_100022063 3300026118 Bacteria 5927
370 Ga0207675_100048902 3300026118 Bacteria 3947
371 Ga0207675_100159253 3300026118 Bacteria 2153
372 Ga0207675_100495287 3300026118 Bacteria 1216
373 Ga0207683_10112332 3300026121 Bacteria 2440
374 Ga0207683_10210596 3300026121 Bacteria 1769
375 Ga0207698_10594584 3300026142 Bacteria 1090
376 Ga0209971_1009922 3300027682 Bacteria 2253
377 Ga0209813_10022099 3300027866 Bacteria 1795
378 Ga0207428_10014596 3300027907 Bacteria 6812
379 Ga0207428_10100366 3300027907 Bacteria 2237
380 Ga0268265_10168158 3300028380 Bacteria 1871
381 Ga0268265_10441264 3300028380 Bacteria 1213
382 Ga0268265_10542461 3300028380 Bacteria 1103
383 Ga0268265_10561895 3300028380 Unclassified 1085
384 Ga0268264_10059408 3300028381 Bacteria 3204
385 Ga0268264_10341953 3300028381 Bacteria 1422
386 Ga0307408_100086907 3300031548 Bacteria 2351
387 Ga0307405_10051626 3300031731 Unclassified 2552
388 Ga0307405_10078212 3300031731 Bacteria 2152
389 Ga0307405_10145717 3300031731 Bacteria 1658
390 Ga0307413_10246785 3300031824 Bacteria 1322
391 Ga0307413_10807477 3300031824 Bacteria 789
392 Ga0307410_10013691 3300031852 Bacteria 4743
393 Ga0307406_10010019 3300031901 Bacteria 5333
394 Ga0307406_10059726 3300031901 Bacteria 2456
395 Ga0307406_10074914 3300031901 Bacteria 2231
396 Ga0307407_10403330 3300031903 Bacteria 981
397 Ga0307412_10006308 3300031911 Bacteria 6698
398 Ga0307409_100001055 3300031995 Bacteria 12924
399 Ga0307409_100216298 3300031995 Bacteria 1726
400 Ga0307416_100001893 3300032002 Bacteria 11685
401 Ga0307416_100138657 3300032002 Bacteria 2206
402 Ga0307416_100172119 3300032002 Bacteria 2017
403 Ga0307414_10009184 3300032004 Bacteria 5664
404 Ga0307414_10296937 3300032004 Unclassified 1365
405 Ga0307415_100002310 3300032126 Bacteria 9458
406 Ga0307415_100940148 3300032126 Unclassified 799
407 Ga0373930_0003717 3300034816 Bacteria 2442
408 Ga0373948_0000840 3300034817 Bacteria 4066
409 Ga0373958_0002842 3300034819 Bacteria 2463
410 Ga0373959_0001139 3300034820 Bacteria 4303
411 Ga0373938_0002693 3300034957 Bacteria 2867
412 Ga0373929_0009555 3300035085 Bacteria 1799
413 Ga0373934_0004744 3300035086 Bacteria 5027
414 Ga0373940_0000155 3300035088 Bacteria 8962
415 Ga0373949_0001888 3300035090 Bacteria 5677
416 Ga0373951_0003635 3300035091 Bacteria 3719
417 Ga0373952_0001496 3300035092 Bacteria 4251
418 Ga0373932_0004636 3300035112 Bacteria 3248
419 Ga0373939_0001913 3300035114 Bacteria 4982
420 Ga0373941_0002760 3300035115 Bacteria 3898
421 Ga0373954_0038292 3300035118 Bacteria 2230
422 Ga0373956_0010775 3300035119 Bacteria 3754
423 Ga0373957_0003033 3300035120 Bacteria 4883
424 Ga0373960_0000892 3300035121 Bacteria 6336
425 Ga0373946_0041012 3300035171 Bacteria 1897
426 Ga0373946_0093186 3300035171 Bacteria 1338
427 Ga0373955_0001674 3300035172 Bacteria 9472
428 Ga0373942_0005534 3300035207 Bacteria 2927
429 Ga0373961_0000790 3300035241 Bacteria 10874
430 Ga0373962_0006319 3300035242 Bacteria 2868
431 Ga0373931_0009981 3300035691 Bacteria 4552
432 Ga0373933_0001147 3300035724 Bacteria 15724
433 Ga0373937_0000651 3300036401 Bacteria 30483
434 Ga0373937_0003352 3300036401 Bacteria 13445
435 Ga0395905_0707399 3300037471 Bacteria 910
436 Ga0395901_0329084 3300038443 Bacteria 1580
437 Ga0439439_0076636 3300041406 Unclassified 900
438 Ga0439431_0039350 3300041997 Bacteria 1199
439 Ga0439442_031378 3300042002 Bacteria 1110
440 Ga0439456_040986 3300042013 Bacteria 1003
441 Ga0439435_0072713 3300042436 Bacteria 1020
442 Ga0439435_0084976 3300042436 Bacteria 955
443 Ga0439464_0010651 3300042439 Bacteria 2428
444 Ga0439464_0113418 3300042439 Bacteria 831
445 Ga0453683_0181833 3300044673 Unclassified 1334
446 Ga0451576_0009151 3300045051 Bacteria 11509
447 Ga0451576_0009172 3300045051 Bacteria 11497
448 Ga0466967_0185753 3300045976 Bacteria 1963
449 Ga0495638_0151923 3300046460 Bacteria 1342
450 Ga0495651_0220986 3300046462 Bacteria 1311
451 Ga0495653_0247713 3300046463 Bacteria 1184
452 Ga0495664_0319837 3300046477 Bacteria 936
453 Ga0495584_0023241 3300046491 Bacteria 3143
454 Ga0495594_0008029 3300046499 Bacteria 5426
455 Ga0495608_0459089 3300046511 Bacteria 774
456 Ga0495618_0137828 3300046514 Bacteria 1561
457 Ga0495643_0004671 3300046522 Bacteria 9511
458 Ga0495663_0015283 3300046525 Bacteria 2161
459 Ga0495642_0006324 3300046528 Bacteria 4541
460 Ga0495587_0198764 3300046536 Bacteria 1134
461 Ga0495598_0072262 3300046537 Bacteria 1089
462 Ga0495609_0108741 3300046538 Bacteria 1198
463 Ga0495645_0113240 3300046543 Bacteria 1918
464 Ga0495656_0087058 3300046615 Bacteria 1422
465 Ga0495588_0023064 3300046674 Bacteria 3078
466 Ga0495599_0120735 3300046678 Bacteria 1629
467 Ga0495646_0284807 3300046680 Unclassified 877
468 Ga0495647_0287129 3300046681 Unclassified 739
469 Ga0495658_0090579 3300046683 Bacteria 1811
470 Ga0495669_0053361 3300046684 Bacteria 1818
471 Ga0495613_0097063 3300046689 Bacteria 2131
472 Ga0495636_0010938 3300047318 Bacteria 3592
473 Ga0495636_0069963 3300047318 Bacteria 1496
474 Ga0495680_0033290 3300047322 Bacteria 4174
475 Ga0495677_0140355 3300047445 Bacteria 928
476 Ga0495684_0130265 3300047471 Bacteria 1890
477 Ga0496100_0352545 3300048903 Unclassified 1112
478 Ga0496101_0155281 3300048904 Bacteria 1753
479 Ga0496101_0156520 3300048904 Unclassified 1746
480 Ga0496104_0000157 3300048907 Bacteria 61755
481 Ga0496106_0025970 3300048909 Bacteria 4358
482 Ga0496106_0420687 3300048909 Bacteria 1074
483 Ga0496107_0746930 3300048910 Bacteria 718
484 Ga0496108_0001048 3300048911 Bacteria 21536
485 Ga0496108_0028406 3300048911 Bacteria 4628
486 Ga0496109_0009585 3300048912 Bacteria 8258
487 Ga0496109_0308475 3300048912 Bacteria 1493
488 Ga0496109_0362810 3300048912 Bacteria 1369
489 Ga0496110_0001196 3300048913 Bacteria 18492
490 Ga0496112_0000148 3300048915 Bacteria 44089
491 Ga0496112_0261957 3300048915 Bacteria 1678
492 Ga0496113_0098901 3300048916 Unclassified 2259
493 Ga0496113_0304499 3300048916 Bacteria 1276
494 Ga0496114_0240313 3300048917 Bacteria 1592
495 Ga0501291_015717 3300049514 Bacteria 1147
496 Ga0501299_040573 3300049522 Bacteria 932
497 Ga0501031_0278720 3300049568 Unclassified 1085
498 Ga0501036_0111808 3300049572 Bacteria 2308
499 Ga0501039_0222891 3300049575 Bacteria 1482
500 Ga0501040_0072459 3300049576 Bacteria 2379
501 Ga0501040_0377541 3300049576 Bacteria 1017
502 Ga0501041_0037285 3300049577 Unclassified 2946
503 Ga0501041_0281891 3300049577 Bacteria 1046
504 Ga0501042_0005448 3300049578 Bacteria 8198
505 Ga0501046_0014259 3300049580 Bacteria 6713
506 Ga0501046_0580055 3300049580 Bacteria 797
507 Ga0501048_0096374 3300049582 Bacteria 2087
508 Ga0501048_0193108 3300049582 Bacteria 1443
509 Ga0501067_0025834 3300049583 Bacteria 3255
510 Ga0501071_0016629 3300049587 Bacteria 5061
511 Ga0501071_0052775 3300049587 Unclassified 2932
512 Ga0501072_0022336 3300049588 Bacteria 4908
513 Ga0501072_0405256 3300049588 Bacteria 1082
514 Ga0501074_0030330 3300049590 Unclassified 3919
515 Ga0501075_0177680 3300049591 Unclassified 1624
516 Ga0501075_0374427 3300049591 Bacteria 1085
517 Ga0501076_0005978 3300049592 Bacteria 8786
518 Ga0501076_0055199 3300049592 Unclassified 3150
519 Ga0501079_0065783 3300049741 Unclassified 2797
520 Ga0501081_0231888 3300049743 Bacteria 1345
521 Ga0501035_0178119 3300049822 Bacteria 1833
522 Ga0501045_0025211 3300049824 Bacteria 4273
523 Ga0501045_0237816 3300049824 Bacteria 1356
524 nmdc:mga03683_2786_c1 3300050489 Bacteria 5500
525 nmdc:mga03n38_248460_c1 3300050490 Bacteria 939
526 nmdc:mga00v17_1150_c1 3300050491 Bacteria 13901
527 nmdc:mga00v17_117604_c1 3300050491 Bacteria 1691
528 nmdc:mga00v17_248058_c1 3300050491 Bacteria 1154
529 nmdc:mga00v17_62562_c1 3300050491 Bacteria 2290
530 nmdc:mga0yw44_127287_c1 3300050492 Bacteria 1646
531 nmdc:mga0k408_102610_c1 3300050493 Bacteria 1687
532 nmdc:mga0k408_15807_c1 3300050493 Bacteria 2183
533 nmdc:mga0k408_263866_c1 3300050493 Bacteria 1028
534 nmdc:mga0k408_89482_c1 3300050493 Unclassified 1808
535 nmdc:mga06z11_159675_c1 3300050494 Unclassified 1288
536 nmdc:mga06z11_29457_c1 3300050494 Bacteria 2645
537 nmdc:mga04h51_133723_c1 3300050495 Bacteria 935
538 nmdc:mga04h51_26452_c1 3300050495 Bacteria 1794
539 nmdc:mga07m45_104632_c1 3300050496 Bacteria 1627
540 nmdc:mga07m45_16544_c1 3300050496 Bacteria 3948
541 nmdc:mga05p37_157031_c1 3300050507 Bacteria 2779
542 nmdc:mga05p37_172637_c1 3300050507 Bacteria 2636
543 nmdc:mga05p37_176774_c1 3300050507 Bacteria 2600
544 nmdc:mga05p37_218085_c1 3300050507 Bacteria 2304
545 nmdc:mga05p37_252621_c1 3300050507 Bacteria 2114
546 nmdc:mga05p37_254930_c1 3300050507 Bacteria 2103
547 nmdc:mga05p37_344855_c1 3300050507 Bacteria 1755
548 nmdc:mga05p37_4593_c1 3300050507 Bacteria 16146
549 nmdc:mga05p37_5874_c1 3300050507 Bacteria 14437
550 nmdc:mga05p37_656473_c1 3300050507 Bacteria 1173
551 nmdc:mga05p37_726101_c1 3300050507 Bacteria 1099
552 nmdc:mga05p37_87_c1 3300050507 Bacteria 81901
553 nmdc:mga09592_208102_c1 3300050508 Bacteria 1694
554 nmdc:mga09592_26115_c1 3300050508 Bacteria 4837
555 nmdc:mga09592_26994_c1 3300050508 Bacteria 4761
556 nmdc:mga09592_27388_c1 3300050508 Bacteria 4729
557 nmdc:mga09592_427896_c1 3300050508 Bacteria 1143
558 nmdc:mga09592_64261_c1 3300050508 Bacteria 3107
559 nmdc:mga09592_7208_c1 3300050508 Bacteria 9040
560 nmdc:mga0qj67_18631_c1 3300050509 Bacteria 5293
561 nmdc:mga0qj67_23501_c1 3300050509 Bacteria 4744
562 nmdc:mga0qj67_26447_c1 3300050509 Bacteria 4492
563 nmdc:mga0qj67_336933_c1 3300050509 Bacteria 1220
564 nmdc:mga0qj67_35792_c1 3300050509 Bacteria 3882
565 nmdc:mga0qj67_54369_c1 3300050509 Bacteria 3170
566 nmdc:mga0qj67_573604_c1 3300050509 Bacteria 904
567 nmdc:mga06r32_123418_c1 3300050510 Unclassified 2556
568 nmdc:mga06r32_12830_c1 3300050510 Bacteria 7575
569 nmdc:mga06r32_136527_c1 3300050510 Bacteria 2427
570 nmdc:mga06r32_151067_c1 3300050510 Bacteria 2301
571 nmdc:mga06r32_3403_c1 3300050510 Bacteria 14233
572 nmdc:mga06r32_438081_c1 3300050510 Bacteria 1287
573 nmdc:mga06r32_66298_c1 3300050510 Bacteria 3484
574 nmdc:mga06r32_788255_c1 3300050510 Bacteria 912
575 nmdc:mga08y16_1121392_c1 3300050511 Bacteria 761
576 nmdc:mga08y16_1203_c1 3300050511 Bacteria 25560
577 nmdc:mga08y16_13454_c1 3300050511 Bacteria 8610
578 nmdc:mga08y16_218191_c1 3300050511 Bacteria 1975
579 nmdc:mga08y16_645473_c1 3300050511 Archaea 1063
580 nmdc:mga08y16_83595_c1 3300050511 Bacteria 3327
581 nmdc:mga08y16_982637_c1 3300050511 Bacteria 825
582 nmdc:mga0n895_194706_c1 3300050512 Bacteria 2058
583 nmdc:mga0n895_3610_c1 3300050512 Bacteria 12510
584 nmdc:mga0n895_757393_c1 3300050512 Bacteria 964
585 nmdc:mga0n895_80076_c1 3300050512 Bacteria 3254
586 nmdc:mga0rr50_134488_c1 3300050513 Bacteria 1983
587 nmdc:mga0rr50_8919_c1 3300050513 Bacteria 6265
588 nmdc:mga08x19_150561_c1 3300050514 Bacteria 1575
589 nmdc:mga08x19_299587_c1 3300050514 Bacteria 1117
590 nmdc:mga0a205_111344_c1 3300050515 Bacteria 2637
591 nmdc:mga0a205_133404_c1 3300050515 Bacteria 2384
592 nmdc:mga0a205_280939_c1 3300050515 Unclassified 1540
593 nmdc:mga0a205_293091_c1 3300050515 Unclassified 1501
594 nmdc:mga0a205_381656_c1 3300050515 Bacteria 1274
595 nmdc:mga0a205_525343_c1 3300050515 Unclassified 1040
596 nmdc:mga0a205_56433_c1 3300050515 Bacteria 3792
597 nmdc:mga0a205_67873_c1 3300050515 Bacteria 3444
598 nmdc:mga0a205_75992_c1 3300050515 Unclassified 3245
599 Ga0495601_0271033 3300053077 Bacteria 1107
600 Ga0495619_0001225 3300053085 Bacteria 16804
601 Ga0495619_0098308 3300053085 Bacteria 1990
602 Ga0500593_046238 3300053117 Bacteria 1940
603 Ga0500568_0004145 3300053139 Bacteria 7831
604 Ga0501084_0029389 3300054114 Bacteria 4598
605 Ga0501084_0069942 3300054114 Unclassified 2939
606 Ga0590071_006280 3300059421 Bacteria 2829
607 Ga0590074_002730 3300059423 Bacteria 2908
608 Ga0590075_001386 3300059424 Bacteria 6073
609 Ga0590075_058803 3300059424 Bacteria 990
610 Ga0501082_0020112 3300060353 Bacteria 5753
611 Ga0501082_0581000 3300060353 Bacteria 980
612 Ga0501082_0631597 3300060353 Bacteria 937
613 Ga0530510_0004366 3300061734 Bacteria 9784
614 Ga0075431_100334656
615 MRS1b_contig_6959019
616 MBSR1b_contig_998937
617 JGI24751J29686_10041487
618 Ga0065712_10021037
619 Ga0065712_10070801
620 Ga0065712_10082368
621 Ga0065715_10005187
622 Ga0065715_10601995
623 Ga0065707_10226332
624 Ga0070658_10487437
625 Ga0070676_10532724
626 Ga0070683_100001936
627 Ga0070690_100003042
628 Ga0070690_100570615
629 Ga0070670_100001546
630 Ga0070670_100012086
631 Ga0070670_100015848
632 Ga0070670_100017012
633 Ga0070670_100023301
634 Ga0070670_100202584
635 Ga0070677_10136355
636 Ga0068869_100007830
637 Ga0068869_100243739
638 Ga0068869_100839770
639 Ga0070666_10037652
640 Ga0070689_100070256
641 Ga0070687_100018621
642 Ga0070687_100039049
643 Ga0070661_100066537
644 Ga0070668_100324478
645 Ga0070669_100122140
646 Ga0070669_100542585
647 Ga0070675_100212281
648 Ga0070675_100219792
649 Ga0070675_100589503
650 Ga0070671_100067528
651 Ga0070671_100176874
652 Ga0070671_100341334
653 Ga0070674_100037111
654 Ga0070674_100240764
655 Ga0070673_100058951
656 Ga0070673_100317091
657 Ga0070688_100109823
658 Ga0070659_100056591
659 Ga0070659_100245372
660 Ga0070667_100023343
661 Ga0070667_100179978
662 Ga0070709_10475513
663 Ga0070705_100001782
664 Ga0070700_100039068
665 Ga0070700_100149996
666 Ga0070700_100476792
667 Ga0070694_100000678
668 Ga0070694_100019131
669 Ga0070694_100120639
670 Ga0070663_100669060
671 Ga0070678_100181788
672 Ga0070662_100116133
673 Ga0070662_100180517
674 Ga0070662_100245190
675 Ga0070662_100280964
676 Ga0070681_10004362
677 Ga0070681_10204321
678 Ga0068867_100048017
679 Ga0068867_100112563
680 Ga0068867_100327142
681 Ga0070685_10118909
682 Ga0070685_10344719
683 Ga0070707_100007479
684 Ga0070707_100057649
685 Ga0070707_100211738
686 Ga0070707_100844285
687 Ga0070698_100002918
688 Ga0070698_100017714
689 Ga0070698_100527861
690 Ga0070699_100004180
691 Ga0070699_100042317
692 Ga0070699_100143612
693 Ga0070699_100290881
694 Ga0070684_100000291
695 Ga0070684_100149838
696 Ga0070684_100277491
697 Ga0070684_100329593
698 Ga0070697_100006127
699 Ga0070697_100083568
700 Ga0070697_100107167
701 Ga0070672_100023119
702 Ga0070672_100067478
703 Ga0070672_100158318
704 Ga0070672_100265356
705 Ga0070672_100639252
706 Ga0070686_100000716
707 Ga0070695_100000153
708 Ga0070695_100034763
709 Ga0070695_100490317
710 Ga0070696_100001125
711 Ga0070696_100020451
712 Ga0070693_100157638
713 Ga0070665_100143762
714 Ga0070704_100000097
715 Ga0070704_100552950
716 Ga0068855_100230186
717 Ga0068855_100571410
718 Ga0070664_100003002
719 Ga0070664_100095724
720 Ga0070664_100109182
721 Ga0068857_100036757
722 Ga0068857_100123639
723 Ga0068857_100253118
724 Ga0068854_100075985
725 Ga0068856_100025436
726 Ga0070702_100002183
727 Ga0068852_100217557
728 Ga0068852_100730943
729 Ga0068859_100259980
730 Ga0068859_100344365
731 Ga0068859_100605655
732 Ga0068859_101206919
733 Ga0068864_100032634
734 Ga0068864_100440421
735 Ga0068864_100524955
736 Ga0068866_10026750
737 Ga0068861_100008289
738 Ga0068861_100083102
739 Ga0068863_100989053
740 Ga0068858_100075598
741 Ga0068858_100231252
742 Ga0068858_100269045
743 Ga0068860_100050520
744 Ga0068860_100063825
745 Ga0068862_100022809
746 Ga0068862_100522326
747 Ga0068862_100623042
748 Ga0068862_100645390
749 Ga0081539_10000025
750 Ga0081539_10000134
751 Ga0075365_10219194
752 Ga0075368_10006957
753 Ga0075363_100423625
754 Ga0075364_10004066
755 Ga0075364_10020286
756 Ga0070712_100196970
757 Ga0075362_10001904
758 Ga0075367_10002695
759 Ga0075367_10035148
760 Ga0075367_10057450
761 Ga0075367_10097894
762 Ga0075366_10002685
763 Ga0075366_10039508
764 Ga0075366_10066293
765 Ga0075366_10104887
766 Ga0097621_100017691
767 Ga0097621_100431656
768 Ga0075370_10018140
769 Ga0068871_100222891
770 Ga0068871_100504749
771 Ga0075428_100006404
772 Ga0075428_100006986
773 Ga0075428_100010821
774 Ga0075428_100015354
775 Ga0075428_100032689
776 Ga0075428_100204182
777 Ga0075428_101286749
778 Ga0075430_100009444
779 Ga0075430_100036237
780 Ga0075430_100042740
781 Ga0075430_100043804
782 Ga0075430_100075580
783 Ga0075430_100213219
784 Ga0075430_100514102
785 Ga0075431_100013212
786 Ga0075431_100014795
787 Ga0075431_100020924
788 Ga0075431_100074762
789 Ga0075431_100206963
790 Ga0075433_10012730
791 Ga0075433_10024820
792 Ga0075433_10067538
793 Ga0075433_10075613
794 Ga0075433_10547775
795 Ga0075434_100011789
796 Ga0075434_100053394
797 Ga0075434_100139158
798 Ga0075429_100000763
799 Ga0075429_100047526
800 Ga0075429_100123082
801 Ga0075429_100164340
802 Ga0068865_100159990
803 Ga0068865_100487275
804 Ga0075436_100205623
805 Ga0075436_100253295
806 Ga0097620_100259955
807 Ga0097620_100344385
808 Ga0097620_100479303
809 Ga0097620_100605682
810 Ga0097620_101207133
811 Ga0075435_100049102
812 Ga0075435_100053728
813 Ga0111539_10000201
814 Ga0111539_10007363
815 Ga0111539_10026333
816 Ga0111539_10286587
817 Ga0111539_10456999
818 Ga0111539_11579547
819 Ga0111539_11608329
820 Ga0111539_11623845
821 Ga0105245_10237875
822 Ga0114129_10002318
823 Ga0114129_10003005
824 Ga0114129_10004551
825 Ga0114129_10007251
826 Ga0114129_10038556
827 Ga0114129_10056885
828 Ga0114129_10119425
829 Ga0114129_10193358
830 Ga0114129_10342827
831 Ga0114129_10367974
832 Ga0114129_10929414
833 Ga0114129_11191249
834 Ga0114129_11267072
835 Ga0105243_10050773
836 Ga0105243_10115192
837 Ga0105243_10284118
838 Ga0105243_10550433
839 Ga0105243_10880738
840 Ga0105241_10010377
841 Ga0105241_10026533
842 Ga0105242_10012101
843 Ga0105242_10292234
844 Ga0105248_10025848
845 Ga0105248_10085577
846 Ga0105248_10114231
847 Ga0105248_10411507
848 Ga0105248_10459399
849 Ga0105248_10825513
850 Ga0105248_11554349
851 Ga0105237_10822421
852 Ga0105249_10132133
853 Ga0105249_10149471
854 Ga0105249_10714067
855 Ga0105249_10834596
856 Ga0105239_10061566
857 Ga0105239_10573097
858 Ga0105246_10400208
859 Ga0105246_10480140
860 Ga0157374_10542354
861 Ga0163162_10118997
862 Ga0163162_10152085
863 Ga0163162_10195860
864 Ga0163162_10323554
865 Ga0163162_10939032
866 Ga0157372_10308221
867 Ga0157375_10103371
868 Ga0157375_10186991
869 Ga0157375_10759479
870 Ga0163163_10033009
871 Ga0163163_10148620
872 Ga0163163_10251779
873 Ga0157380_10153927
874 Ga0157379_10061244
875 Ga0157379_10174701
876 Ga0157379_10267887
877 Ga0157376_10070187
878 Ga0157376_10144692
879 Ga0157376_10795671
880 Ga0163161_10002088
881 Ga0207697_10000772
882 Ga0207697_10009729
883 Ga0207682_10004062
884 Ga0207642_10040222
885 Ga0207688_10002773
886 Ga0207688_10008212
887 Ga0207688_10135950
888 Ga0207680_10359764
889 Ga0207647_10095922
890 Ga0207699_10041267
891 Ga0207643_10002961
892 Ga0207684_10006235
893 Ga0207695_10341077
894 Ga0207660_10078602
895 Ga0207662_10003122
896 Ga0207649_10111371
897 Ga0207646_10263313
898 Ga0207646_10664670
899 Ga0207681_10450049
900 Ga0207681_10634301
901 Ga0207650_10087621
902 Ga0207650_10099319
903 Ga0207659_10024721
904 Ga0207659_10220862
905 Ga0207659_10991514
906 Ga0207700_10032146
907 Ga0207644_10328459
908 Ga0207690_10040605
909 Ga0207706_10072692
910 Ga0207706_10080835
911 Ga0207706_10189724
912 Ga0207706_10214461
913 Ga0207686_10066754
914 Ga0207686_10283457
915 Ga0207686_10306502
916 Ga0207709_10420520
917 Ga0207670_10164269
918 Ga0207670_10466686
919 Ga0207670_10621876
920 Ga0207669_10038068
921 Ga0207704_10172688
922 Ga0207704_10176021
923 Ga0207704_10247899
924 Ga0207704_10412853
925 Ga0207691_10007836
926 Ga0207691_10015326
927 Ga0207691_10138992
928 Ga0207711_10068576
929 Ga0207711_10260991
930 Ga0207711_10376615
931 Ga0207711_10499131
932 Ga0207711_10519925
933 Ga0207689_10014901
934 Ga0207689_10045850
935 Ga0207689_10225366
936 Ga0207689_10524322
937 Ga0207661_10001428
938 Ga0207661_10100901
939 Ga0207661_10615097
940 Ga0207679_10002083
941 Ga0207679_10078115
942 Ga0207667_10375985
943 Ga0207651_10332733
944 Ga0207651_10422867
945 Ga0207712_10168270
946 Ga0207668_10452670
947 Ga0207640_10007581
948 Ga0207658_10020246
949 Ga0207658_10080581
950 Ga0207658_10080968
951 Ga0207658_10140720
952 Ga0207677_10204865
953 Ga0207677_10371148
954 Ga0207703_10048356
955 Ga0207703_10548416
956 Ga0207639_10352562
957 Ga0207678_10031909
958 Ga0207678_10311104
959 Ga0207708_10001093
960 Ga0207708_10022135
961 Ga0207708_10186257
962 Ga0207702_10174363
963 Ga0207641_10008261
964 Ga0207641_10172018
965 Ga0207641_10561763
966 Ga0207648_10004783
967 Ga0207648_10009844
968 Ga0207648_10020920
969 Ga0207648_10076538
970 Ga0207648_10085110
971 Ga0207648_10110981
972 Ga0207648_10285243
973 Ga0207648_10913894
974 Ga0207676_10095395
975 Ga0207676_10173082
976 Ga0207676_10476245
977 Ga0207674_10149954
978 Ga0207674_10196344
979 Ga0207674_10226036
980 Ga0207674_10228336
981 Ga0207675_100001978
982 Ga0207675_100022063
983 Ga0207675_100048902
984 Ga0207675_100159253
985 Ga0207675_100495287
986 Ga0207683_10112332
987 Ga0207683_10210596
988 Ga0207698_10594584
989 Ga0209971_1009922
990 Ga0209813_10022099
991 Ga0207428_10014596
992 Ga0207428_10100366
993 Ga0268265_10168158
994 Ga0268265_10441264
995 Ga0268265_10542461
996 Ga0268265_10561895
997 Ga0268264_10059408
998 Ga0268264_10341953
999 Ga0307408_100086907
1000 Ga0307405_10051626
1001 Ga0307405_10078212
1002 Ga0307405_10145717
1003 Ga0307413_10246785
1004 Ga0307413_10807477
1005 Ga0307410_10013691
1006 Ga0307406_10010019
1007 Ga0307406_10059726
1008 Ga0307406_10074914
1009 Ga0307407_10403330
1010 Ga0307412_10006308
1011 Ga0307409_100001055
1012 Ga0307409_100216298
1013 Ga0307416_100001893
1014 Ga0307416_100138657
1015 Ga0307416_100172119
1016 Ga0307414_10009184
1017 Ga0307414_10296937
1018 Ga0307415_100002310
1019 Ga0307415_100940148
1020 Ga0373930_0003717
1021 Ga0373948_0000840
1022 Ga0373958_0002842
1023 Ga0373959_0001139
1024 Ga0373938_0002693
1025 Ga0373929_0009555
1026 Ga0373934_0004744
1027 Ga0373940_0000155
1028 Ga0373949_0001888
1029 Ga0373951_0003635
1030 Ga0373952_0001496
1031 Ga0373932_0004636
1032 Ga0373939_0001913
1033 Ga0373941_0002760
1034 Ga0373954_0038292
1035 Ga0373956_0010775
1036 Ga0373957_0003033
1037 Ga0373960_0000892
1038 Ga0373946_0041012
1039 Ga0373946_0093186
1040 Ga0373955_0001674
1041 Ga0373942_0005534
1042 Ga0373961_0000790
1043 Ga0373962_0006319
1044 Ga0373931_0009981
1045 Ga0373933_0001147
1046 Ga0373937_0000651
1047 Ga0373937_0003352
1048 Ga0395905_0707399
1049 Ga0395901_0329084
1050 Ga0439439_0076636
1051 Ga0439431_0039350
1052 Ga0439442_031378
1053 Ga0439456_040986
1054 Ga0439435_0072713
1055 Ga0439435_0084976
1056 Ga0439464_0010651
1057 Ga0439464_0113418
1058 Ga0453683_0181833
1059 Ga0451576_0009151
1060 Ga0451576_0009172
1061 Ga0466967_0185753
1062 Ga0495638_0151923
1063 Ga0495651_0220986
1064 Ga0495653_0247713
1065 Ga0495664_0319837
1066 Ga0495584_0023241
1067 Ga0495594_0008029
1068 Ga0495608_0459089
1069 Ga0495618_0137828
1070 Ga0495643_0004671
1071 Ga0495663_0015283
1072 Ga0495642_0006324
1073 Ga0495587_0198764
1074 Ga0495598_0072262
1075 Ga0495609_0108741
1076 Ga0495645_0113240
1077 Ga0495656_0087058
1078 Ga0495588_0023064
1079 Ga0495599_0120735
1080 Ga0495646_0284807
1081 Ga0495647_0287129
1082 Ga0495658_0090579
1083 Ga0495669_0053361
1084 Ga0495613_0097063
1085 Ga0495636_0010938
1086 Ga0495636_0069963
1087 Ga0495680_0033290
1088 Ga0495677_0140355
1089 Ga0495684_0130265
1090 Ga0496100_0352545
1091 Ga0496101_0155281
1092 Ga0496101_0156520
1093 Ga0496104_0000157
1094 Ga0496106_0025970
1095 Ga0496106_0420687
1096 Ga0496107_0746930
1097 Ga0496108_0001048
1098 Ga0496108_0028406
1099 Ga0496109_0009585
1100 Ga0496109_0308475
1101 Ga0496109_0362810
1102 Ga0496110_0001196
1103 Ga0496112_0000148
1104 Ga0496112_0261957
1105 Ga0496113_0098901
1106 Ga0496113_0304499
1107 Ga0496114_0240313
1108 Ga0501291_015717
1109 Ga0501299_040573
1110 Ga0501031_0278720
1111 Ga0501036_0111808
1112 Ga0501039_0222891
1113 Ga0501040_0072459
1114 Ga0501040_0377541
1115 Ga0501041_0037285
1116 Ga0501041_0281891
1117 Ga0501042_0005448
1118 Ga0501046_0014259
1119 Ga0501046_0580055
1120 Ga0501048_0096374
1121 Ga0501048_0193108
1122 Ga0501067_0025834
1123 Ga0501071_0016629
1124 Ga0501071_0052775
1125 Ga0501072_0022336
1126 Ga0501072_0405256
1127 Ga0501074_0030330
1128 Ga0501075_0177680
1129 Ga0501075_0374427
1130 Ga0501076_0005978
1131 Ga0501076_0055199
1132 Ga0501079_0065783
1133 Ga0501081_0231888
1134 Ga0501035_0178119
1135 Ga0501045_0025211
1136 Ga0501045_0237816
1137 nmdc:mga03683_2786_c1
1138 nmdc:mga03n38_248460_c1
1139 nmdc:mga00v17_1150_c1
1140 nmdc:mga00v17_117604_c1
1141 nmdc:mga00v17_248058_c1
1142 nmdc:mga00v17_62562_c1
1143 nmdc:mga0yw44_127287_c1
1144 nmdc:mga0k408_102610_c1
1145 nmdc:mga0k408_15807_c1
1146 nmdc:mga0k408_263866_c1
1147 nmdc:mga0k408_89482_c1
1148 nmdc:mga06z11_159675_c1
1149 nmdc:mga06z11_29457_c1
1150 nmdc:mga04h51_133723_c1
1151 nmdc:mga04h51_26452_c1
1152 nmdc:mga07m45_104632_c1
1153 nmdc:mga07m45_16544_c1
1154 nmdc:mga05p37_157031_c1
1155 nmdc:mga05p37_172637_c1
1156 nmdc:mga05p37_176774_c1
1157 nmdc:mga05p37_218085_c1
1158 nmdc:mga05p37_252621_c1
1159 nmdc:mga05p37_254930_c1
1160 nmdc:mga05p37_344855_c1
1161 nmdc:mga05p37_4593_c1
1162 nmdc:mga05p37_5874_c1
1163 nmdc:mga05p37_656473_c1
1164 nmdc:mga05p37_726101_c1
1165 nmdc:mga05p37_87_c1
1166 nmdc:mga09592_208102_c1
1167 nmdc:mga09592_26115_c1
1168 nmdc:mga09592_26994_c1
1169 nmdc:mga09592_27388_c1
1170 nmdc:mga09592_427896_c1
1171 nmdc:mga09592_64261_c1
1172 nmdc:mga09592_7208_c1
1173 nmdc:mga0qj67_18631_c1
1174 nmdc:mga0qj67_23501_c1
1175 nmdc:mga0qj67_26447_c1
1176 nmdc:mga0qj67_336933_c1
1177 nmdc:mga0qj67_35792_c1
1178 nmdc:mga0qj67_54369_c1
1179 nmdc:mga0qj67_573604_c1
1180 nmdc:mga06r32_123418_c1
1181 nmdc:mga06r32_12830_c1
1182 nmdc:mga06r32_136527_c1
1183 nmdc:mga06r32_151067_c1
1184 nmdc:mga06r32_3403_c1
1185 nmdc:mga06r32_438081_c1
1186 nmdc:mga06r32_66298_c1
1187 nmdc:mga06r32_788255_c1
1188 nmdc:mga08y16_1121392_c1
1189 nmdc:mga08y16_1203_c1
1190 nmdc:mga08y16_13454_c1
1191 nmdc:mga08y16_218191_c1
1192 nmdc:mga08y16_645473_c1
1193 nmdc:mga08y16_83595_c1
1194 nmdc:mga08y16_982637_c1
1195 nmdc:mga0n895_194706_c1
1196 nmdc:mga0n895_3610_c1
1197 nmdc:mga0n895_757393_c1
1198 nmdc:mga0n895_80076_c1
1199 nmdc:mga0rr50_134488_c1
1200 nmdc:mga0rr50_8919_c1
1201 nmdc:mga08x19_150561_c1
1202 nmdc:mga08x19_299587_c1
1203 nmdc:mga0a205_111344_c1
1204 nmdc:mga0a205_133404_c1
1205 nmdc:mga0a205_280939_c1
1206 nmdc:mga0a205_293091_c1
1207 nmdc:mga0a205_381656_c1
1208 nmdc:mga0a205_525343_c1
1209 nmdc:mga0a205_56433_c1
1210 nmdc:mga0a205_67873_c1
1211 nmdc:mga0a205_75992_c1
1212 Ga0495601_0271033
1213 Ga0495619_0001225
1214 Ga0495619_0098308
1215 Ga0500593_046238
1216 Ga0500568_0004145
1217 Ga0501084_0029389
1218 Ga0501084_0069942
1219 Ga0590071_006280
1220 Ga0590074_002730
1221 Ga0590075_001386
1222 Ga0590075_058803
1223 Ga0501082_0020112
1224 Ga0501082_0581000
1225 Ga0501082_0631597
1226 Ga0530510_0004366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

66

201

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.8064 4 203
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.7717 4 190
6nhl-assembly1.cif.gz_B-2 crystal structure of quee from escherichia coli 0.771 4 203
5tgs-assembly1.cif.gz_B crystal structure of quee from bacillus subtilis with methionine bound 0.7706 5 209
5th5-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound 0.7575 4 216
ID Description Score Start End Superfamily
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8562 5 209 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8116 5 209 3.20.20.70
af_Q59039_1_242_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8105 7 208 3.20.20.70
af_Q59026_29_239_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.791 26 175 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7705 5 208 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7V5PMP0-F1-model_v4 Radical SAM protein 0.9937 2 177 GO:0016829
GO:0046872
GO:0051539
AF-A0A7W0LCA8-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.992 69 216 GO:0051539
AF-A0A7V1LST0-F1-model_v4 Radical SAM protein 0.9918 5 206 GO:0016829
GO:0046872
GO:0051539
AF-A0A2V6K672-F1-model_v4 7-carboxy-7-deazaguanine synthase QueE 0.9915 2 194 GO:0016829
GO:0046872
GO:0051539
AF-A0A3N5NNX2-F1-model_v4 Radical SAM protein 0.9914 8 188 GO:0016829
GO:0046872
GO:0051539

Map