F469146

General Info

Members Datasets Scaffolds Average Seq Length
612 376 459 399

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10000237|Ga0182007_100002372
Length 422
Sequence MIHLLSRNPRLQHVCSTSACTHDCTCDGSLSRRDWLRLTALGGAALSPLLRAGDAMAQAVKADDPPVRIGYLPITDATPLLVAHNNGLFEAEGIKAERPVLLRSWAQVIEAFISGQVNVIHLLSPMTVWARYGSKVPAKVVAWNHVGGSGLTVAPGITDVKQLGGKSVAIPFWYSIHNVVVQQLFRDNGLTPVARAAGSVIAANEVNLIVLPPSDMPPALASQRIDGYIVAEPFNALAENLKVGRVQRFTGDVWRNHACCVVFMHEHDLANRPQWSQKVVNAIVKAQVWTRDNREEAVKLLSKDGPNRYTPHAEPVLSKVLAPAAGDRAAYLADGAIQHGNWDEHRIDFQPYPFPSYTEELVRRLKDTLIEGDKKFLADLDPAFVAKDLVDDRFVRNAIEAVGGMKTFGLPDGYERHEEISA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231024 Pseudomonas sp. GM84 Isolate Nodule
10 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
11 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
12 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
13 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
14 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
15 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
16 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
17 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
18 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
19 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
20 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
21 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
22 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
23 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
24 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
25 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
26 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
27 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
28 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
29 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
30 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
31 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
32 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
33 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
34 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
35 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
36 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
37 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
38 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
39 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
40 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
41 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
42 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
43 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
44 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
45 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
46 2636415599 Klebsiella variicola DX120E Isolate Unclassified
47 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
48 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
49 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
50 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
51 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
52 2721755523 Delftia sp. HK171 Isolate Unclassified
53 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
54 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
55 2738541297 Duganella sp. GV083 Isolate Unclassified
56 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
57 2738541357 Duganella sp. GV053 Isolate Unclassified
58 2738543003 Duganella sp. GV066 Isolate Unclassified
59 2738543012 Acidovorax sp. CF301 Isolate Unclassified
60 2738543026 Duganella sp. GV089 Isolate Unclassified
61 2738543029 Duganella sp. GV039 Isolate Unclassified
62 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
63 2765235841 Pseudomonas putida AA7 Isolate Unclassified
64 2773857673 Pseudomonas sp. 443 Isolate Unclassified
65 2784132063 Pseudomonas sp. 424 Isolate Unclassified
66 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
67 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
68 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
69 2816332133 Acidovorax radicis 2721A Isolate Unclassified
70 2818991452 Burkholderia cepacia 561 Isolate Unclassified
71 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
72 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
73 2821131069 Duganella sp. 1224 Isolate Unclassified
74 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
75 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
76 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
77 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
78 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
79 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
80 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
81 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
82 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
83 2857553236 Duganella sp. R-74557 Isolate Unclassified
84 2857564685 Duganella sp. R-74599 Isolate Unclassified
85 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
86 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
87 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
88 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
89 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
90 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
91 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
92 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
93 2899924645 Variovorax sp. 369 Isolate Unclassified
94 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
95 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
96 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
97 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
98 2904564687 Burkholderia sp. 571 Isolate Unclassified
99 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
100 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
101 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
102 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
103 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
104 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
105 2919476304 Duganella sp. 3397 Isolate Unclassified
106 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
107 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
108 2928051484 Variovorax sp. 1133 Isolate Unclassified
109 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
110 2928170801 Burkholderia sp. 572 Isolate Unclassified
111 2928536128 Burkholderia sola 565 Isolate Unclassified
112 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
113 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
114 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
115 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
116 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
117 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
118 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
119 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
120 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
121 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
122 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
123 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
124 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
125 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
126 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
127 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
128 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
129 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
130 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
131 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
132 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
133 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
134 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
135 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
136 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
137 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
138 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
139 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
140 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
141 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
142 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
143 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
144 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
145 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
146 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
147 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
148 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
149 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
150 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
151 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
152 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
153 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
154 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
155 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
156 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
157 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
158 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
159 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
160 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
161 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
162 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
163 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
164 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
165 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
166 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
167 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
168 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
169 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
170 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
171 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
172 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
173 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
176 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
179 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
180 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
181 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
182 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
183 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
184 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
185 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
186 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
195 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
197 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
200 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
201 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
207 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
226 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
227 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
229 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
230 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
231 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
232 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
243 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
244 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
245 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
246 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
247 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
248 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
251 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
252 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
310 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
311 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
312 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
317 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
318 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
336 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
341 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
346 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
347 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
351 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
352 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
353 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
354 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
355 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
356 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
357 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
358 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
359 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
360 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
361 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
362 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
363 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
364 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
365 8052494512 Pseudomonas putida LD6 Isolate Unclassified
366 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
367 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
368 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
369 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
370 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
371 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
372 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
373 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
374 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
375 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
376 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75
Metatranscriptomes 0
Isolates 25

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 11.44
Nodule 1.96
Rhizoplane 6.05
Rhizosphere 56.37
Stem 0
Stem Tuber 0
Unclassified 23.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2802055 2162886007 Bacteria 2741
2 SwRhRL2b_contig_3648037 2162886007 Bacteria 2722
3 JGI25162J39368_1000044 3300002737 Bacteria 172199
4 JGI25163J39215_1000014 3300002771 Bacteria 86265
5 JGI25164J39214_1000092 3300002772 Bacteria 90356
6 JGI25165J46597_1000084 3300003214 Bacteria 172199
7 rootL2_10052323 3300003322 Bacteria 3516
8 rootH1_10277025 3300003323 Bacteria 2981
9 JGI25160J50197_1000090 3300003354 Bacteria 90580
10 Ga0055538_1000007 3300003751 Bacteria 399715
11 Ga0055539_1000011 3300003752 Bacteria 399747
12 Ga0055533_1000014 3300003756 Bacteria 399747
13 Ga0055532_1000009 3300003758 Bacteria 399537
14 Ga0055532_1000290 3300003758 Bacteria 31802
15 Ga0055532_1000471 3300003758 Bacteria 18078
16 Ga0055525_1000016 3300003759 Bacteria 399724
17 Ga0055527_1001590 3300003760 Bacteria 4589
18 Ga0055535_1000559 3300003761 Bacteria 31802
19 Ga0055542_1000579 3300003762 Bacteria 31802
20 Ga0055529_1000550 3300003763 Bacteria 31802
21 Ga0055524_1000227 3300003775 Bacteria 59891
22 Ga0055536_1000005 3300003781 Bacteria 383598
23 Ga0055528_1005064 3300003790 Bacteria 6221
24 Ga0055530_10000001 3300003791 Bacteria 383067
25 Ga0055530_10001516 3300003791 Bacteria 16776
26 Ga0055540_1000112 3300003792 Bacteria 88200
27 Ga0055540_1000680 3300003792 Bacteria 23586
28 Ga0055531_10012295 3300003794 Bacteria 4039
29 Ga0055541_1000008 3300003841 Bacteria 399724
30 Ga0058692_1000003 3300003856 Bacteria 435295
31 Ga0065165_1000928 3300005262 Bacteria 37588
32 Ga0065704_10074132 3300005289 Bacteria 6506
33 Ga0065704_10083675 3300005289 Bacteria 3432
34 Ga0070661_100000053 3300005344 Bacteria 89030
35 Ga0070669_100002693 3300005353 Bacteria 12806
36 Ga0070664_100000030 3300005564 Bacteria 89030
37 Ga0068854_100072499 3300005578 Bacteria 2522
38 Ga0068851_10000279 3300005834 Bacteria 23569
39 Ga0068851_10000862 3300005834 Bacteria 13051
40 Ga0075363_100076286 3300006048 Bacteria 1827
41 Ga0099823_1000229 3300006944 Bacteria 32040
42 Ga0079104_1000167 3300006946 Bacteria 93750
43 Ga0079104_1018513 3300006946 Bacteria 1971
44 Ga0105251_10000199 3300009011 Bacteria 60845
45 Ga0105251_10000572 3300009011 Bacteria 34425
46 Ga0105251_10046318 3300009011 Bacteria 2093
47 Ga0105251_10080251 3300009011 Bacteria 1509
48 Ga0105244_10000229 3300009036 Bacteria 57809
49 Ga0105244_10002978 3300009036 Bacteria 12464
50 Ga0105244_10006522 3300009036 Bacteria 7528
51 Ga0105244_10007571 3300009036 Bacteria 6895
52 Ga0105244_10007941 3300009036 Bacteria 6684
53 Ga0105244_10052810 3300009036 Bacteria 2068
54 Ga0105250_10000058 3300009092 Bacteria 111233
55 Ga0105250_10000515 3300009092 Bacteria 27043
56 Ga0105250_10000700 3300009092 Bacteria 20825
57 Ga0105247_10000116 3300009101 Bacteria 78228
58 Ga0105243_10001444 3300009148 Bacteria 20896
59 Ga0105242_10004205 3300009176 Bacteria 11216
60 Ga0105237_10000596 3300009545 Bacteria 50456
61 Ga0105246_10000357 3300011119 Bacteria 24630
62 Ga0157373_10000193 3300013100 Bacteria 50206
63 Ga0157373_10004679 3300013100 Bacteria 10287
64 Ga0157373_10005138 3300013100 Bacteria 9837
65 Ga0157371_10000010 3300013102 Bacteria 384921
66 Ga0157371_10000375 3300013102 Bacteria 56505
67 Ga0157371_10076517 3300013102 Bacteria 2370
68 Ga0157369_10001402 3300013105 Bacteria 29596
69 Ga0157369_10002198 3300013105 Bacteria 23499
70 Ga0157369_10010386 3300013105 Bacteria 10612
71 Ga0163162_10007448 3300013306 Bacteria 10644
72 Ga0163162_10258965 3300013306 Bacteria 1871
73 Ga0157372_10010390 3300013307 Bacteria 9896
74 Ga0157375_10000729 3300013308 Bacteria 28973
75 Ga0182008_10000161 3300014497 Bacteria 52882
76 Ga0182008_10000164 3300014497 Bacteria 51668
77 Ga0182008_10000202 3300014497 Bacteria 46777
78 Ga0182008_10000621 3300014497 Bacteria 26047
79 Ga0182008_10000694 3300014497 Bacteria 24242
80 Ga0182008_10014735 3300014497 Bacteria 4089
81 Ga0182006_1000021 3300015261 Bacteria 280808
82 Ga0182006_1000046 3300015261 Bacteria 189544
83 Ga0182006_1063785 3300015261 Bacteria 1383
84 Ga0182007_10000044 3300015262 Bacteria 106301
85 Ga0182007_10000237 3300015262 Bacteria 37215
86 Ga0182007_10003152 3300015262 Bacteria 7914
87 Ga0182005_1000020 3300015265 Bacteria 278671
88 Ga0182005_1000032 3300015265 Bacteria 188517
89 Ga0163161_10000446 3300017792 Bacteria 34480
90 Ga0163161_10004784 3300017792 Bacteria 9427
91 Ga0163161_10004828 3300017792 Bacteria 9392
92 Ga0163161_10043683 3300017792 Bacteria 3227
93 Ga0163161_10066540 3300017792 Bacteria 2631
94 Ga0163161_10088544 3300017792 Bacteria 2288
95 Ga0163161_10209589 3300017792 Bacteria 1505
96 Ga0209760_100030 3300025207 Bacteria 142765
97 Ga0209784_100023 3300025224 Bacteria 399841
98 Ga0209566_100019 3300025225 Bacteria 414836
99 Ga0209566_100268 3300025225 Bacteria 48824
100 Ga0209674_100034 3300025226 Bacteria 414903
101 Ga0209674_102075 3300025226 Bacteria 4565
102 Ga0209672_100044 3300025228 Bacteria 270292
103 Ga0209147_100027 3300025229 Bacteria 414610
104 Ga0209147_100039 3300025229 Bacteria 311101
105 Ga0209147_100206 3300025229 Bacteria 64466
106 Ga0209563_100037 3300025230 Bacteria 414903
107 Ga0209563_101324 3300025230 Bacteria 6751
108 Ga0207427_100022 3300025231 Bacteria 469701
109 Ga0209437_100002 3300025233 Bacteria 1574801
110 Ga0209258_100062 3300025242 Bacteria 311101
111 Ga0209258_100520 3300025242 Bacteria 37049
112 Ga0209646_1000110 3300025246 Bacteria 156257
113 Ga0209677_100021 3300025253 Bacteria 414954
114 Ga0209148_1000075 3300025254 Bacteria 311101
115 Ga0209759_1013109 3300025256 Bacteria 2259
116 Ga0209233_1000004 3300025261 Bacteria 1574798
117 Ga0209565_1019687 3300025263 Bacteria 1436
118 Ga0209455_1000067 3300025272 Bacteria 311101
119 Ga0209673_1000044 3300025273 Bacteria 290647
120 Ga0209130_1003744 3300025284 Bacteria 6216
121 Ga0209676_1000003 3300025292 Bacteria 1454178
122 Ga0209676_1000647 3300025292 Bacteria 49978
123 Ga0209025_1000382 3300025294 Bacteria 91921
124 Ga0209564_1003004 3300025295 Bacteria 12091
125 Ga0209564_1016302 3300025295 Bacteria 2967
126 Ga0209050_1000004 3300025298 Bacteria 1600040
127 Ga0209050_1001187 3300025298 Bacteria 30613
128 Ga0209050_1014774 3300025298 Bacteria 3334
129 Ga0209256_1000011 3300025299 Bacteria 865309
130 Ga0207426_1000110 3300025302 Bacteria 235630
131 Ga0209051_1000006 3300025303 Bacteria 1015785
132 Ga0209051_1000016 3300025303 Bacteria 541891
133 Ga0209257_1000510 3300025304 Bacteria 67777
134 Ga0207656_10000456 3300025321 Bacteria 13659
135 Ga0207656_10001757 3300025321 Bacteria 7218
136 Ga0207696_1000017 3300025711 Bacteria 491130
137 Ga0207696_1000018 3300025711 Bacteria 478605
138 Ga0207696_1000376 3300025711 Bacteria 43744
139 Ga0207696_1007089 3300025711 Bacteria 4430
140 Ga0207696_1044232 3300025711 Bacteria 1292
141 Ga0207655_1000074 3300025728 Bacteria 232056
142 Ga0207655_1000143 3300025728 Bacteria 137102
143 Ga0207655_1000396 3300025728 Bacteria 60636
144 Ga0207655_1004488 3300025728 Bacteria 9880
145 Ga0207655_1004638 3300025728 Bacteria 9652
146 Ga0207655_1012403 3300025728 Bacteria 4983
147 Ga0207655_1022499 3300025728 Bacteria 3157
148 Ga0207713_1000213 3300025735 Bacteria 78634
149 Ga0207713_1000523 3300025735 Bacteria 38601
150 Ga0207713_1007190 3300025735 Bacteria 6634
151 Ga0207713_1013808 3300025735 Bacteria 4232
152 Ga0207713_1020553 3300025735 Bacteria 3194
153 Ga0207710_10000418 3300025900 Bacteria 28048
154 Ga0207671_10000995 3300025914 Bacteria 34876
155 Ga0207649_10000070 3300025920 Bacteria 89018
156 Ga0207681_10000430 3300025923 Bacteria 29298
157 Ga0207706_10032792 3300025933 Bacteria 4623
158 Ga0207686_10008012 3300025934 Bacteria 5698
159 Ga0207709_10000143 3300025935 Bacteria 99457
160 Ga0207709_10003974 3300025935 Bacteria 8625
161 Ga0207679_10000021 3300025945 Bacteria 221630
162 Ga0209281_1000017 3300027111 Bacteria 583251
163 Ga0209389_1000042 3300027296 Bacteria 123281
164 Ga0209371_1000006 3300027312 Bacteria 1055642
165 Ga0209371_1000310 3300027312 Bacteria 54149
166 Ga0209371_1000579 3300027312 Bacteria 32896
167 Ga0209371_1001217 3300027312 Bacteria 18554
168 Ga0209371_1003490 3300027312 Bacteria 7599
169 Ga0209371_1013746 3300027312 Bacteria 2252
170 Ga0265323_10004670 3300028653 Bacteria 5879
171 Ga0268256_1000007 3300030500 Bacteria 1055326
172 Ga0268256_1000267 3300030500 Bacteria 54149
173 Ga0268256_1000506 3300030500 Bacteria 32896
174 Ga0268256_1001046 3300030500 Bacteria 18554
175 Ga0268256_1002346 3300030500 Bacteria 9757
176 Ga0268256_1011984 3300030500 Bacteria 2708
177 Ga0316181_1238674 3300030744 Bacteria 2452
178 Ga0265332_10003407 3300031238 Bacteria 7688
179 Ga0265325_10002998 3300031241 Bacteria 11207
180 Ga0265331_10044471 3300031250 Bacteria 2147
181 Ga0265316_10025308 3300031344 Bacteria 4954
182 Ga0307405_10000024 3300031731 Bacteria 127508
183 Ga0307412_10000121 3300031911 Bacteria 59488
184 Ga0307412_10013261 3300031911 Bacteria 4826
185 Ga0307414_10012925 3300032004 Bacteria 4956
186 Ga0395900_0012316 3300037418 Bacteria 8749
187 Ga0395900_0083983 3300037418 Bacteria 3272
188 Ga0395898_0074362 3300037466 Bacteria 3282
189 Ga0395905_0000020 3300037471 Bacteria 337672
190 Ga0395901_0497101 3300038443 Bacteria 1242
191 Ga0237819_00717 3300038705 Bacteria 10704
192 Ga0439432_003842 3300042006 Bacteria 5538
193 Ga0439456_000047 3300042013 Bacteria 43836
194 Ga0439463_000216 3300042016 Bacteria 15707
195 Ga0450902_000369 3300042137 Bacteria 5506
196 Ga0450905_000494 3300042142 Bacteria 4809
197 Ga0450901_000089 3300042533 Bacteria 9576
198 Ga0450901_000307 3300042533 Bacteria 5995
199 Ga0451577_0024350 3300042876 Bacteria 5508
200 Ga0451577_0084699 3300042876 Bacteria 2828
201 Ga0466969_0012443 3300044656 Bacteria 4487
202 Ga0466972_0060808 3300044658 Bacteria 1812
203 Ga0466977_0000276 3300044666 Bacteria 14801
204 Ga0466961_0004687 3300044693 Bacteria 8592
205 Ga0466961_0008236 3300044693 Bacteria 6637
206 Ga0453684_0053801 3300044712 Bacteria 5251
207 Ga0453684_0199129 3300044712 Bacteria 2336
208 Ga0453684_0288702 3300044712 Bacteria 1868
209 Ga0466957_0045153 3300044842 Bacteria 2672
210 Ga0466960_0000669 3300044901 Bacteria 11899
211 Ga0451576_0032129 3300045051 Bacteria 5593
212 Ga0451576_0085121 3300045051 Bacteria 3289
213 Ga0495617_000006 3300046452 Bacteria 398279
214 Ga0495617_002574 3300046452 Bacteria 7141
215 Ga0495627_000005 3300046453 Bacteria 630805
216 Ga0495627_000314 3300046453 Bacteria 47603
217 Ga0495627_003518 3300046453 Bacteria 6866
218 Ga0495627_011429 3300046453 Bacteria 3186
219 Ga0495592_0007023 3300046454 Bacteria 8418
220 Ga0495603_0068288 3300046455 Bacteria 2091
221 Ga0495590_0004324 3300046457 Bacteria 5741
222 Ga0495629_0066002 3300046459 Bacteria 2526
223 Ga0495638_0021091 3300046460 Bacteria 4297
224 Ga0495653_0000158 3300046463 Bacteria 56295
225 Ga0495653_0003660 3300046463 Bacteria 12413
226 Ga0495653_0005352 3300046463 Bacteria 10443
227 Ga0495650_0000339 3300046471 Bacteria 83278
228 Ga0495650_0000401 3300046471 Bacteria 72284
229 Ga0495650_0006089 3300046471 Bacteria 7607
230 Ga0495580_0000782 3300046472 Bacteria 27410
231 Ga0495580_0006730 3300046472 Bacteria 9331
232 Ga0495605_0000349 3300046474 Bacteria 45126
233 Ga0495605_0002938 3300046474 Bacteria 10317
234 Ga0495605_0021417 3300046474 Bacteria 3424
235 Ga0495664_0002580 3300046477 Bacteria 9743
236 Ga0495584_0000590 3300046491 Bacteria 24432
237 Ga0495585_0000129 3300046492 Bacteria 81888
238 Ga0495585_0000714 3300046492 Bacteria 29831
239 Ga0495596_0000039 3300046500 Bacteria 94926
240 Ga0495607_0000078 3300046501 Bacteria 99139
241 Ga0495607_0001430 3300046501 Bacteria 21274
242 Ga0495607_0037681 3300046501 Bacteria 2902
243 Ga0495607_0054122 3300046501 Bacteria 2313
244 Ga0495583_0000131 3300046506 Bacteria 125393
245 Ga0495583_0001341 3300046506 Bacteria 25516
246 Ga0495583_0006561 3300046506 Bacteria 7575
247 Ga0495606_0000104 3300046507 Bacteria 143973
248 Ga0495606_0000522 3300046507 Bacteria 62126
249 Ga0495606_0000724 3300046507 Bacteria 51037
250 Ga0495606_0012519 3300046507 Bacteria 6795
251 Ga0495606_0136214 3300046507 Bacteria 1454
252 Ga0495610_0000004 3300046512 Bacteria 1006135
253 Ga0495620_0000049 3300046515 Bacteria 106184
254 Ga0495620_0001200 3300046515 Bacteria 15851
255 Ga0495628_0000084 3300046516 Bacteria 73340
256 Ga0495630_0002174 3300046517 Bacteria 13657
257 Ga0495632_0000258 3300046519 Bacteria 52760
258 Ga0495632_0000292 3300046519 Bacteria 48501
259 Ga0495632_0000320 3300046519 Bacteria 46293
260 Ga0495632_0005548 3300046519 Bacteria 8315
261 Ga0495632_0017387 3300046519 Bacteria 3971
262 Ga0495637_0000106 3300046520 Bacteria 62204
263 Ga0495637_0001231 3300046520 Bacteria 15514
264 Ga0495637_0005118 3300046520 Bacteria 6727
265 Ga0495643_0000579 3300046522 Bacteria 44728
266 Ga0495643_0001028 3300046522 Bacteria 28446
267 Ga0495643_0001308 3300046522 Bacteria 23656
268 Ga0495648_0000085 3300046524 Bacteria 119901
269 Ga0495648_0000201 3300046524 Bacteria 69119
270 Ga0495648_0003750 3300046524 Bacteria 13231
271 Ga0495648_0018814 3300046524 Bacteria 4875
272 Ga0495666_0003145 3300046526 Bacteria 8304
273 Ga0495642_0000121 3300046528 Bacteria 44959
274 Ga0495652_0000753 3300046529 Bacteria 37287
275 Ga0495654_0000035 3300046530 Bacteria 192768
276 Ga0495654_0000059 3300046530 Bacteria 137056
277 Ga0495654_0002883 3300046530 Bacteria 10791
278 Ga0495654_0007511 3300046530 Bacteria 6086
279 Ga0495654_0011757 3300046530 Bacteria 4727
280 Ga0495654_0031957 3300046530 Bacteria 2670
281 Ga0495665_0000315 3300046531 Bacteria 24616
282 Ga0495609_0000111 3300046538 Bacteria 94808
283 Ga0495609_0000330 3300046538 Bacteria 41760
284 Ga0495597_0000092 3300046542 Bacteria 79435
285 Ga0495645_0001298 3300046543 Bacteria 17020
286 Ga0495645_0028341 3300046543 Bacteria 4069
287 Ga0495622_0021220 3300046557 Bacteria 3025
288 Ga0495633_0000980 3300046558 Bacteria 23443
289 Ga0495633_0001345 3300046558 Bacteria 19254
290 Ga0495633_0012883 3300046558 Bacteria 4426
291 Ga0495668_0000734 3300046616 Bacteria 39253
292 Ga0495634_0008934 3300046642 Bacteria 7419
293 Ga0495611_0000306 3300046648 Bacteria 33215
294 Ga0495625_0213608 3300046660 Bacteria 1267
295 Ga0495635_0017049 3300046663 Bacteria 5072
296 Ga0495661_0000168 3300046665 Bacteria 77948
297 Ga0495661_0000313 3300046665 Bacteria 54614
298 Ga0495661_0062213 3300046665 Bacteria 2212
299 Ga0495623_0000513 3300046679 Bacteria 25631
300 Ga0495646_0002012 3300046680 Bacteria 12301
301 Ga0495646_0014722 3300046680 Bacteria 4971
302 Ga0495646_0127782 3300046680 Bacteria 1433
303 Ga0495613_0004762 3300046689 Bacteria 10183
304 Ga0495613_0008224 3300046689 Bacteria 7747
305 Ga0495624_0000190 3300046690 Bacteria 46541
306 Ga0495624_0000477 3300046690 Bacteria 31306
307 Ga0495671_0000001 3300046692 Bacteria 1169494
308 Ga0495671_0002104 3300046692 Bacteria 12719
309 Ga0495671_0034944 3300046692 Bacteria 2554
310 Ga0495671_0048589 3300046692 Bacteria 2116
311 Ga0495649_0000091 3300046694 Bacteria 77817
312 Ga0495600_0019346 3300046809 Bacteria 4348
313 Ga0495600_0041353 3300046809 Bacteria 3003
314 Ga0495660_0000126 3300046810 Bacteria 84046
315 Ga0495660_0002330 3300046810 Bacteria 12173
316 Ga0495660_0014621 3300046810 Bacteria 4539
317 Ga0495660_0097000 3300046810 Bacteria 1523
318 Ga0495604_0001572 3300047317 Bacteria 18799
319 Ga0495604_0033642 3300047317 Bacteria 4056
320 Ga0495636_0000065 3300047318 Bacteria 45689
321 Ga0495674_0000053 3300047319 Bacteria 76346
322 Ga0495672_0000174 3300047320 Bacteria 93615
323 Ga0495672_0000781 3300047320 Bacteria 34504
324 Ga0495672_0001832 3300047320 Bacteria 20334
325 Ga0495672_0062243 3300047320 Bacteria 2147
326 Ga0495676_0013725 3300047321 Bacteria 7269
327 Ga0495680_0068173 3300047322 Bacteria 2718
328 Ga0495687_000539 3300047443 Bacteria 45138
329 Ga0495687_019597 3300047443 Bacteria 3314
330 Ga0495675_0005525 3300047444 Bacteria 7711
331 Ga0495679_000193 3300047446 Bacteria 54057
332 Ga0495679_006183 3300047446 Bacteria 5199
333 Ga0495673_0000006 3300047469 Bacteria 908691
334 Ga0495673_0000024 3300047469 Bacteria 521349
335 Ga0495673_0000118 3300047469 Bacteria 147670
336 Ga0495673_0000141 3300047469 Bacteria 128600
337 Ga0495673_0000469 3300047469 Bacteria 43875
338 Ga0495673_0061925 3300047469 Bacteria 1600
339 Ga0495681_0020743 3300047470 Bacteria 3556
340 Ga0495684_0005723 3300047471 Bacteria 9668
341 Ga0495686_0000044 3300047472 Bacteria 288079
342 Ga0495686_0000760 3300047472 Bacteria 42551
343 Ga0495593_0000004 3300047673 Bacteria 112755
344 Ga0495593_0010175 3300047673 Bacteria 5439
345 Ga0495602_0000061 3300048088 Bacteria 105566
346 Ga0495602_0001831 3300048088 Bacteria 21263
347 Ga0495602_0023644 3300048088 Bacteria 5984
348 Ga0495626_0000398 3300048091 Bacteria 44775
349 Ga0496100_0054136 3300048903 Bacteria 2616
350 Ga0496106_0008929 3300048909 Bacteria 7408
351 Ga0496110_0028130 3300048913 Bacteria 4825
352 Ga0496111_0034323 3300048914 Bacteria 3622
353 Ga0496114_0010360 3300048917 Bacteria 7417
354 Ga0496114_0012022 3300048917 Bacteria 6924
355 Ga0496114_0015129 3300048917 Bacteria 6204
356 Ga0496116_0000010 3300048919 Bacteria 665608
357 Ga0496116_0001980 3300048919 Bacteria 22060
358 Ga0496116_0005921 3300048919 Bacteria 11212
359 Ga0496116_0018182 3300048919 Bacteria 5429
360 Ga0496116_0024463 3300048919 Bacteria 4467
361 Ga0496116_0057022 3300048919 Bacteria 2556
362 Ga0496116_0113055 3300048919 Bacteria 1589
363 Ga0496117_0000010 3300048920 Bacteria 611954
364 Ga0496117_0000158 3300048920 Bacteria 144464
365 Ga0496117_0002828 3300048920 Bacteria 21120
366 Ga0496117_0003915 3300048920 Bacteria 16862
367 Ga0496117_0004549 3300048920 Bacteria 15207
368 Ga0496117_0004640 3300048920 Bacteria 14960
369 Ga0496117_0011804 3300048920 Bacteria 7780
370 Ga0496117_0033841 3300048920 Bacteria 3859
371 Ga0496117_0038160 3300048920 Bacteria 3567
372 Ga0496118_0000009 3300048921 Bacteria 611954
373 Ga0496118_0003447 3300048921 Bacteria 19915
374 Ga0496118_0003884 3300048921 Bacteria 18342
375 Ga0496118_0014349 3300048921 Bacteria 7425
376 Ga0496118_0022661 3300048921 Bacteria 5481
377 Ga0496118_0047764 3300048921 Bacteria 3314
378 Ga0496118_0069969 3300048921 Bacteria 2537
379 Ga0496118_0080446 3300048921 Bacteria 2293
380 Ga0496119_0000189 3300048922 Bacteria 87262
381 Ga0496119_0004370 3300048922 Bacteria 14107
382 Ga0496119_0020272 3300048922 Bacteria 4856
383 Ga0496119_0047905 3300048922 Bacteria 2654
384 Ga0496119_0101285 3300048922 Bacteria 1617
385 Ga0496120_0003521 3300048923 Bacteria 14180
386 Ga0496120_0031232 3300048923 Bacteria 3228
387 Ga0496121_0000149 3300048924 Bacteria 153667
388 Ga0496121_0000249 3300048924 Bacteria 114260
389 Ga0496121_0008746 3300048924 Bacteria 11814
390 Ga0496121_0010815 3300048924 Bacteria 10218
391 Ga0496121_0014571 3300048924 Bacteria 8329
392 Ga0496121_0019869 3300048924 Bacteria 6690
393 Ga0496121_0023146 3300048924 Bacteria 5997
394 Ga0496121_0041674 3300048924 Bacteria 4009
395 Ga0496121_0046265 3300048924 Bacteria 3727
396 Ga0496121_0144208 3300048924 Bacteria 1762
397 Ga0496121_0176431 3300048924 Bacteria 1546
398 Ga0496122_0000017 3300048925 Bacteria 439553
399 Ga0496122_0000260 3300048925 Bacteria 118852
400 Ga0496122_0000636 3300048925 Bacteria 71408
401 Ga0496122_0001244 3300048925 Bacteria 42816
402 Ga0496122_0002400 3300048925 Bacteria 26732
403 Ga0496122_0023826 3300048925 Bacteria 5378
404 Ga0496122_0028710 3300048925 Bacteria 4711
405 Ga0496123_0000033 3300048926 Bacteria 274961
406 Ga0496123_0000037 3300048926 Bacteria 262238
407 Ga0496123_0000256 3300048926 Bacteria 107665
408 Ga0496123_0000375 3300048926 Bacteria 83909
409 Ga0496123_0004021 3300048926 Bacteria 15891
410 Ga0496123_0007530 3300048926 Bacteria 10209
411 Ga0496123_0012030 3300048926 Bacteria 7421
412 Ga0496123_0012621 3300048926 Bacteria 7180
413 Ga0496123_0013453 3300048926 Bacteria 6865
414 Ga0496123_0064249 3300048926 Bacteria 2340
415 Ga0496124_0003763 3300048927 Bacteria 18246
416 Ga0496124_0006381 3300048927 Bacteria 12861
417 Ga0496124_0008998 3300048927 Bacteria 10331
418 Ga0496124_0071653 3300048927 Bacteria 2871
419 Ga0496124_0079685 3300048927 Bacteria 2696
420 Ga0496124_0089608 3300048927 Bacteria 2511
421 Ga0496124_0106422 3300048927 Bacteria 2264
422 Ga0496124_0133858 3300048927 Bacteria 1965
423 Ga0496125_0000116 3300048928 Bacteria 180492
424 Ga0496125_0000274 3300048928 Bacteria 104123
425 Ga0496125_0002914 3300048928 Bacteria 21523
426 Ga0496125_0005203 3300048928 Bacteria 14597
427 Ga0496125_0005585 3300048928 Bacteria 13901
428 Ga0496125_0008614 3300048928 Bacteria 10646
429 Ga0496125_0012961 3300048928 Bacteria 8230
430 Ga0496125_0023980 3300048928 Bacteria 5620
431 Ga0496125_0047701 3300048928 Bacteria 3578
432 Ga0496125_0048091 3300048928 Bacteria 3560
433 Ga0496126_0014716 3300048929 Bacteria 7894
434 Ga0496126_0017489 3300048929 Bacteria 7140
435 Ga0496126_0027245 3300048929 Bacteria 5462
436 Ga0496126_0190025 3300048929 Bacteria 1740
437 Ga0496126_0210079 3300048929 Bacteria 1639
438 Ga0495678_000016 3300049459 Bacteria 303426
439 Ga0495678_000119 3300049459 Bacteria 92516
440 Ga0495678_000381 3300049459 Bacteria 45016
441 Ga0495678_010094 3300049459 Bacteria 4610
442 Ga0495678_070331 3300049459 Bacteria 1285
443 Ga0495682_0000316 3300049460 Bacteria 35909
444 Ga0495682_0015242 3300049460 Bacteria 2913
445 Ga0501034_0000334 3300049571 Bacteria 82414
446 Ga0501038_0071360 3300049574 Bacteria 2946
447 Ga0501047_0015110 3300049581 Bacteria 7350
448 Ga0501269_000162 3300049766 Bacteria 20542
449 Ga0501280_001202 3300049776 Bacteria 5068
450 Ga0501282_000758 3300049778 Bacteria 3699
451 Ga0501035_0011932 3300049822 Bacteria 8042
452 Ga0501044_0002363 3300049823 Bacteria 21502
453 nmdc:mga03n38_103199_c1 3300050490 Bacteria 1378
454 Ga0500594_0001036 3300053118 Bacteria 5948
455 Ga0500618_000625 3300053125 Bacteria 21405
456 Ga0500618_008705 3300053125 Bacteria 2812
457 Ga0500659_0000406 3300053135 Bacteria 27750
458 Ga0500586_002411 3300053145 Bacteria 4214
459 Ga0500634_0000091 3300053161 Bacteria 34955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031241 Ga0265325_10002998 Ga0265325_100029988 355
2 3300053125 Ga0500618_008705 Ga0500618_008705_1735_2802 355
3 3300027312 Ga0209371_1000579 Ga0209371_10005792 372
4 3300030500 Ga0268256_1000506 Ga0268256_100050629 372
5 3300037418 Ga0395900_0083983 Ga0395900_0083983_917_2098 374
6 3300038443 Ga0395901_0497101 Ga0395901_0497101_38_1174 374
7 3300048924 Ga0496121_0023146 Ga0496121_0023146_175_1320 381
8 3300045051 Ga0451576_0085121 Ga0451576_0085121_1203_2375 385
9 iso_pu_bacteria 2861691609 2861695133 386
10 iso_pu_bacteria 2863421361 2863422926 387
11 iso_pu_bacteria 2887375801 2887379241 387
12 iso_pu_bacteria 2928170801 2928174392 387
13 iso_pu_bacteria 8002060224 8002063450 387
14 3300015261 Ga0182006_1000021 Ga0182006_100002176 390
15 3300015265 Ga0182005_1000020 Ga0182005_100002094 390
16 3300046452 Ga0495617_000006 Ga0495617_000006_117937_119118 390
17 3300046453 Ga0495627_011429 Ga0495627_011429_1156_2337 390
18 3300046460 Ga0495638_0021091 Ga0495638_0021091_2938_4119 390
19 3300046471 Ga0495650_0000339 Ga0495650_0000339_25557_26738 390
20 3300046471 Ga0495650_0006089 Ga0495650_0006089_3767_4948 390
21 3300046492 Ga0495585_0000714 Ga0495585_0000714_27159_28340 390
22 3300046507 Ga0495606_0000522 Ga0495606_0000522_60155_61336 390
23 3300046512 Ga0495610_0000004 Ga0495610_0000004_75175_76356 390
24 3300046524 Ga0495648_0003750 Ga0495648_0003750_4151_5332 390
25 3300046524 Ga0495648_0018814 Ga0495648_0018814_1536_2717 390
26 3300046530 Ga0495654_0002883 Ga0495654_0002883_3676_4857 390
27 3300046538 Ga0495609_0000330 Ga0495609_0000330_12175_13356 390
28 3300046558 Ga0495633_0012883 Ga0495633_0012883_822_2003 390
29 3300046616 Ga0495668_0000734 Ga0495668_0000734_8572_9753 390
30 3300046660 Ga0495625_0213608 Ga0495625_0213608_53_1234 390
31 3300046665 Ga0495661_0062213 Ga0495661_0062213_488_1669 390
32 3300046692 Ga0495671_0000001 Ga0495671_0000001_725283_726464 390
33 3300046692 Ga0495671_0048589 Ga0495671_0048589_762_1943 390
34 3300046810 Ga0495660_0000126 Ga0495660_0000126_25712_26893 390
35 3300046810 Ga0495660_0097000 Ga0495660_0097000_171_1352 390
36 3300047446 Ga0495679_006183 Ga0495679_006183_3307_4488 390
37 3300047469 Ga0495673_0000141 Ga0495673_0000141_32171_33352 390
38 3300048914 Ga0496111_0034323 Ga0496111_0034323_32_1213 390
39 3300048924 Ga0496121_0144208 Ga0496121_0144208_54_1235 390
40 3300048925 Ga0496122_0023826 Ga0496122_0023826_596_1777 390
41 3300048926 Ga0496123_0007530 Ga0496123_0007530_8045_9226 390
42 3300049459 Ga0495678_000016 Ga0495678_000016_228063_229244 390
43 iso_pu_bacteria 2636415599 2637226893 390
44 iso_pu_bacteria 2984595703 2984599054 390
45 3300013306 Ga0163162_10007448 Ga0163162_100074487 391
46 3300037471 Ga0395905_0000020 Ga0395905_0000020_79734_80909 391
47 3300042006 Ga0439432_003842 Ga0439432_003842_3541_4743 391
48 3300046455 Ga0495603_0068288 Ga0495603_0068288_789_1964 391
49 3300046459 Ga0495629_0066002 Ga0495629_0066002_1336_2511 391
50 3300046463 Ga0495653_0000158 Ga0495653_0000158_45168_46343 391
51 3300046472 Ga0495580_0000782 Ga0495580_0000782_16507_17682 391
52 3300046472 Ga0495580_0006730 Ga0495580_0006730_7505_8680 391
53 3300046474 Ga0495605_0021417 Ga0495605_0021417_2001_3176 391
54 3300046477 Ga0495664_0002580 Ga0495664_0002580_419_1594 391
55 3300046506 Ga0495583_0006561 Ga0495583_0006561_3328_4503 391
56 3300046516 Ga0495628_0000084 Ga0495628_0000084_44427_45602 391
57 3300046517 Ga0495630_0002174 Ga0495630_0002174_403_1578 391
58 3300046529 Ga0495652_0000753 Ga0495652_0000753_7483_8658 391
59 3300046531 Ga0495665_0000315 Ga0495665_0000315_8194_9369 391
60 3300046543 Ga0495645_0001298 Ga0495645_0001298_4810_5985 391
61 3300046663 Ga0495635_0017049 Ga0495635_0017049_2174_3349 391
62 3300046679 Ga0495623_0000513 Ga0495623_0000513_20010_21185 391
63 3300046680 Ga0495646_0002012 Ga0495646_0002012_9187_10362 391
64 3300046680 Ga0495646_0127782 Ga0495646_0127782_170_1345 391
65 3300046690 Ga0495624_0000190 Ga0495624_0000190_35340_36515 391
66 3300046809 Ga0495600_0019346 Ga0495600_0019346_413_1588 391
67 3300047317 Ga0495604_0001572 Ga0495604_0001572_432_1607 391
68 3300047319 Ga0495674_0000053 Ga0495674_0000053_40000_41175 391
69 3300047320 Ga0495672_0001832 Ga0495672_0001832_2597_3772 391
70 3300047320 Ga0495672_0062243 Ga0495672_0062243_277_1452 391
71 3300047443 Ga0495687_019597 Ga0495687_019597_1938_3113 391
72 3300047444 Ga0495675_0005525 Ga0495675_0005525_1507_2682 391
73 3300047472 Ga0495686_0000044 Ga0495686_0000044_251932_253107 391
74 3300047673 Ga0495593_0000004 Ga0495593_0000004_54507_55682 391
75 3300048088 Ga0495602_0000061 Ga0495602_0000061_45376_46551 391
76 3300048088 Ga0495602_0023644 Ga0495602_0023644_4407_5582 391
77 3300048928 Ga0496125_0000116 Ga0496125_0000116_175683_176858 391
78 3300049459 Ga0495678_070331 Ga0495678_070331_88_1263 391
79 3300028653 Ga0265323_10004670 Ga0265323_100046702 392
80 3300031344 Ga0265316_10025308 Ga0265316_100253082 392
81 3300042876 Ga0451577_0084699 Ga0451577_0084699_1434_2636 392
82 3300044666 Ga0466977_0000276 Ga0466977_0000276_9027_10211 392
83 3300044712 Ga0453684_0053801 Ga0453684_0053801_1827_3029 392
84 3300044712 Ga0453684_0199129 Ga0453684_0199129_700_1914 392
85 3300044712 Ga0453684_0288702 Ga0453684_0288702_116_1315 392
86 3300045051 Ga0451576_0032129 Ga0451576_0032129_2078_3280 392
87 iso_pu_bacteria 2501025502 2501081234 392
88 iso_pu_bacteria 2501025504 2501409282 392
89 iso_pu_bacteria 2510917013 2511094310 392
90 iso_pu_bacteria 2510917014 2511098842 392
91 iso_pu_bacteria 2510917015 2511109064 392
92 iso_pu_bacteria 2515154122 2515682330 392
93 iso_pu_bacteria 2526164512 2526210795 392
94 iso_pu_bacteria 2599185239 2599740932 392
95 iso_pu_bacteria 2818991452 2819630621 392
96 iso_pu_bacteria 2856287931 2856289603 392
97 iso_pu_bacteria 2857357740 2857358952 392
98 iso_pu_bacteria 2883087390 2883094395 392
99 iso_pu_bacteria 2902682994 2902690696 392
100 iso_pu_bacteria 2904434214 2904437064 392
101 iso_pu_bacteria 2904564687 2904566486 392
102 iso_pu_bacteria 2904571731 2904573531 392
103 iso_pu_bacteria 2928536128 2928539629 392
104 iso_pu_bacteria 2941479691 2941481292 392
105 iso_pu_bacteria 8003400568 8003404176 392
106 iso_pu_bacteria 8018845410 8018851302 392
107 iso_pu_bacteria 8021120328 8021120847 392
108 iso_pu_bacteria 8055225921 8055225973 392
109 3300003322 rootL2_10052323 rootL2_100523233 393
110 3300003323 rootH1_10277025 rootH1_102770252 393
111 3300003354 JGI25160J50197_1000090 JGI25160J50197_100009069 393
112 3300003758 Ga0055532_1000290 Ga0055532_100029022 393
113 3300003758 Ga0055532_1000471 Ga0055532_10004714 393
114 3300003760 Ga0055527_1001590 Ga0055527_10015905 393
115 3300003761 Ga0055535_1000559 Ga0055535_100055922 393
116 3300003762 Ga0055542_1000579 Ga0055542_100057922 393
117 3300003763 Ga0055529_1000550 Ga0055529_100055022 393
118 3300003790 Ga0055528_1005064 Ga0055528_10050646 393
119 3300005262 Ga0065165_1000928 Ga0065165_100092821 393
120 3300015262 Ga0182007_10003152 Ga0182007_100031527 393
121 3300025225 Ga0209566_100268 Ga0209566_10026847 393
122 3300025226 Ga0209674_102075 Ga0209674_1020754 393
123 3300025228 Ga0209672_100044 Ga0209672_100044145 393
124 3300025229 Ga0209147_100039 Ga0209147_100039145 393
125 3300025229 Ga0209147_100206 Ga0209147_10020657 393
126 3300025242 Ga0209258_100062 Ga0209258_100062145 393
127 3300025254 Ga0209148_1000075 Ga0209148_1000075145 393
128 3300025272 Ga0209455_1000067 Ga0209455_1000067145 393
129 3300025273 Ga0209673_1000044 Ga0209673_1000044248 393
130 3300025284 Ga0209130_1003744 Ga0209130_10037443 393
131 3300025295 Ga0209564_1003004 Ga0209564_100300410 393
132 3300025295 Ga0209564_1016302 Ga0209564_10163022 393
133 3300025302 Ga0207426_1000110 Ga0207426_100011060 393
134 3300027312 Ga0209371_1001217 Ga0209371_100121711 393
135 3300027312 Ga0209371_1013746 Ga0209371_10137462 393
136 3300030500 Ga0268256_1001046 Ga0268256_100104611 393
137 3300030500 Ga0268256_1011984 Ga0268256_10119842 393
138 3300031911 Ga0307412_10000121 Ga0307412_1000012163 393
139 3300044656 Ga0466969_0012443 Ga0466969_0012443_147_1337 393
140 3300044658 Ga0466972_0060808 Ga0466972_0060808_604_1794 393
141 3300044693 Ga0466961_0004687 Ga0466961_0004687_381_1571 393
142 3300044693 Ga0466961_0008236 Ga0466961_0008236_4305_5495 393
143 3300044842 Ga0466957_0045153 Ga0466957_0045153_888_2078 393
144 3300044901 Ga0466960_0000669 Ga0466960_0000669_8106_9296 393
145 3300048919 Ga0496116_0001980 Ga0496116_0001980_9570_10760 393
146 3300048919 Ga0496116_0057022 Ga0496116_0057022_793_1983 393
147 3300048920 Ga0496117_0004640 Ga0496117_0004640_8408_9598 393
148 3300048921 Ga0496118_0080446 Ga0496118_0080446_575_1765 393
149 3300048922 Ga0496119_0020272 Ga0496119_0020272_2902_4092 393
150 3300048922 Ga0496119_0101285 Ga0496119_0101285_354_1544 393
151 3300048924 Ga0496121_0000249 Ga0496121_0000249_61703_62893 393
152 3300048924 Ga0496121_0019869 Ga0496121_0019869_4256_5446 393
153 3300048925 Ga0496122_0000017 Ga0496122_0000017_175868_177058 393
154 3300048926 Ga0496123_0000033 Ga0496123_0000033_261375_262565 393
155 3300048926 Ga0496123_0013453 Ga0496123_0013453_5475_6665 393
156 3300048927 Ga0496124_0071653 Ga0496124_0071653_1068_2258 393
157 3300048928 Ga0496125_0012961 Ga0496125_0012961_223_1413 393
158 3300048929 Ga0496126_0014716 Ga0496126_0014716_395_1585 393
159 3300048929 Ga0496126_0210079 Ga0496126_0210079_320_1510 393
160 3300049581 Ga0501047_0015110 Ga0501047_0015110_2042_3232 393
161 3300049822 Ga0501035_0011932 Ga0501035_0011932_6494_7684 393
162 3300049823 Ga0501044_0002363 Ga0501044_0002363_19791_20981 393
163 iso_pu_bacteria 8002392321 8002396120 394
164 3300003775 Ga0055524_1000227 Ga0055524_100022726 395
165 3300003791 Ga0055530_10001516 Ga0055530_100015164 395
166 3300003792 Ga0055540_1000112 Ga0055540_100011247 395
167 3300003794 Ga0055531_10012295 Ga0055531_100122953 395
168 3300003856 Ga0058692_1000003 Ga0058692_1000003387 395
169 3300009101 Ga0105247_10000116 Ga0105247_1000011610 395
170 3300017792 Ga0163161_10000446 Ga0163161_1000044618 395
171 3300025263 Ga0209565_1019687 Ga0209565_10196871 395
172 3300025298 Ga0209050_1001187 Ga0209050_100118716 395
173 3300025298 Ga0209050_1014774 Ga0209050_10147742 395
174 3300025299 Ga0209256_1000011 Ga0209256_1000011310 395
175 3300025303 Ga0209051_1000016 Ga0209051_100001627 395
176 3300025304 Ga0209257_1000510 Ga0209257_100051033 395
177 3300025900 Ga0207710_10000418 Ga0207710_100004189 395
178 3300027312 Ga0209371_1000006 Ga0209371_1000006118 395
179 3300030500 Ga0268256_1000007 Ga0268256_1000007118 395
180 3300048917 Ga0496114_0015129 Ga0496114_0015129_4631_5854 395
181 3300048928 Ga0496125_0005203 Ga0496125_0005203_1481_2713 395
182 iso_pu_bacteria 2511231006 2511267215 395
183 iso_pu_bacteria 2511231011 2511296844 395
184 iso_pu_bacteria 2512047018 2512326111 395
185 iso_pu_bacteria 2554235341 2555670155 395
186 iso_pu_bacteria 2582580891 2583792662 395
187 iso_pu_bacteria 2597489887 2597858305 395
188 iso_pu_bacteria 2597489888 2597864168 395
189 iso_pu_bacteria 2597489889 2597869689 395
190 iso_pu_bacteria 2599185160 2599352812 395
191 iso_pu_bacteria 2599185161 2599359157 395
192 iso_pu_bacteria 2599185162 2599365322 395
193 iso_pu_bacteria 2599185163 2599371851 395
194 iso_pu_bacteria 2599185164 2599377920 395
195 iso_pu_bacteria 2599185165 2599384703 395
196 iso_pu_bacteria 2599185166 2599390709 395
197 iso_pu_bacteria 2599185167 2599398480 395
198 iso_pu_bacteria 2599185168 2599402894 395
199 iso_pu_bacteria 2599185179 2599450529 395
200 iso_pu_bacteria 2599185181 2599459646 395
201 iso_pu_bacteria 2599185182 2599466015 395
202 iso_pu_bacteria 2599185185 2599486286 395
203 iso_pu_bacteria 2599185186 2599488667 395
204 iso_pu_bacteria 2599185189 2599507193 395
205 iso_pu_bacteria 2599185190 2599512966 395
206 iso_pu_bacteria 2599185191 2599521666 395
207 iso_pu_bacteria 2599185257 2599802910 395
208 iso_pu_bacteria 2599185288 2599880428 395
209 iso_pu_bacteria 2599185290 2599891643 395
210 iso_pu_bacteria 2599185303 2599946888 395
211 iso_pu_bacteria 2599185356 2600212251 395
212 iso_pu_bacteria 2600255296 2601692005 395
213 iso_pu_bacteria 2600255313 2601772419 395
214 iso_pu_bacteria 2606217733 2608384438 395
215 iso_pu_bacteria 2643221571 2643873921 395
216 iso_pu_bacteria 2643221713 2644620392 395
217 iso_pu_bacteria 2667528171 2671095611 395
218 iso_pu_bacteria 2671180172 2671769468 395
219 iso_pu_bacteria 2675903420 2677896242 395
220 iso_pu_bacteria 2721755607 2723248870 395
221 iso_pu_bacteria 2738541294 2738806651 395
222 iso_pu_bacteria 2738541309 2738894011 395
223 iso_pu_bacteria 2740892503 2743737778 395
224 iso_pu_bacteria 2773857673 2774138350 395
225 iso_pu_bacteria 2784132063 2784264897 395
226 iso_pu_bacteria 2811994881 2812366392 395
227 iso_pu_bacteria 2818991456 2819656894 395
228 iso_pu_bacteria 2818991464 2819700910 395
229 iso_pu_bacteria 2834028612 2834033632 395
230 iso_pu_bacteria 2842826826 2842827074 395
231 iso_pu_bacteria 2842837860 2842839137 395
232 iso_pu_bacteria 2844665904 2844670464 395
233 iso_pu_bacteria 2852657418 2852662178 395
234 iso_pu_bacteria 2860867994 2860870748 395
235 iso_pu_bacteria 2880230671 2880233069 395
236 iso_pu_bacteria 2904518522 2904523450 395
237 iso_pu_bacteria 2908446538 2908449497 395
238 iso_pu_bacteria 2912963787 2912965966 395
239 iso_pu_bacteria 2917070673 2917073977 395
240 iso_pu_bacteria 2919125081 2919125871 395
241 iso_pu_bacteria 2923153595 2923156823 395
242 iso_pu_bacteria 2923519811 2923520416 395
243 iso_pu_bacteria 2931390751 2931393788 395
244 iso_pu_bacteria 2935353572 2935355956 395
245 iso_pu_bacteria 2935638405 2935647788 395
246 iso_pu_bacteria 2935665750 2935666837 395
247 iso_pu_bacteria 2935827899 2935837272 395
248 iso_pu_bacteria 2939651529 2939656900 395
249 iso_pu_bacteria 2945961074 2945963217 395
250 iso_pu_bacteria 2946006987 2946009541 395
251 iso_pu_bacteria 2946027586 2946030782 395
252 iso_pu_bacteria 2947233263 2947237965 395
253 iso_pu_bacteria 2984286254 2984289268 395
254 iso_pu_bacteria 2984504281 2984509044 395
255 iso_pu_bacteria 3007395558 3007396228 395
256 iso_pu_bacteria 3007419365 3007423975 395
257 iso_pu_bacteria 637000220 637320521 395
258 iso_pu_bacteria 8015687852 8015691069 395
259 iso_pu_bacteria 8016728285 8016728641 395
260 iso_pu_bacteria 8019769354 8019771973 395
261 iso_pu_bacteria 8054347763 8054352409 395
262 iso_pu_bacteria 8055770955 8055774209 395
263 iso_pu_bacteria 8055817908 8055821254 395
264 iso_pu_bacteria 8055878733 8055882064 395
265 iso_pu_bacteria 8056148874 8056150772 395
266 iso_pu_bacteria 8057798959 8057800257 395
267 3300015262 Ga0182007_10000237 Ga0182007_100002372 396
268 3300031238 Ga0265332_10003407 Ga0265332_100034073 396
269 3300037418 Ga0395900_0012316 Ga0395900_0012316_6992_8188 396
270 3300037466 Ga0395898_0074362 Ga0395898_0074362_166_1362 396
271 3300046507 Ga0495606_0000104 Ga0495606_0000104_19249_20493 396
272 3300046542 Ga0495597_0000092 Ga0495597_0000092_39426_40667 396
273 iso_pu_bacteria 2974320154 2974320919 396
274 3300002737 JGI25162J39368_1000044 JGI25162J39368_100004441 397
275 3300002771 JGI25163J39215_1000014 JGI25163J39215_100001451 397
276 3300002772 JGI25164J39214_1000092 JGI25164J39214_100009244 397
277 3300003214 JGI25165J46597_1000084 JGI25165J46597_100008499 397
278 3300003751 Ga0055538_1000007 Ga0055538_1000007301 397
279 3300003752 Ga0055539_1000011 Ga0055539_1000011301 397
280 3300003756 Ga0055533_1000014 Ga0055533_1000014301 397
281 3300003758 Ga0055532_1000009 Ga0055532_1000009301 397
282 3300003759 Ga0055525_1000016 Ga0055525_1000016301 397
283 3300003781 Ga0055536_1000005 Ga0055536_1000005175 397
284 3300003791 Ga0055530_10000001 Ga0055530_10000001157 397
285 3300003792 Ga0055540_1000680 Ga0055540_100068017 397
286 3300003841 Ga0055541_1000008 Ga0055541_1000008301 397
287 3300005344 Ga0070661_100000053 Ga0070661_1000000533 397
288 3300005353 Ga0070669_100002693 Ga0070669_1000026936 397
289 3300005564 Ga0070664_100000030 Ga0070664_1000000303 397
290 3300005578 Ga0068854_100072499 Ga0068854_1000724992 397
291 3300005834 Ga0068851_10000279 Ga0068851_1000027912 397
292 3300005834 Ga0068851_10000862 Ga0068851_100008626 397
293 3300006048 Ga0075363_100076286 Ga0075363_1000762862 397
294 3300006946 Ga0079104_1000167 Ga0079104_100016749 397
295 3300006946 Ga0079104_1018513 Ga0079104_10185132 397
296 3300009011 Ga0105251_10000199 Ga0105251_1000019954 397
297 3300009011 Ga0105251_10000572 Ga0105251_100005729 397
298 3300009011 Ga0105251_10046318 Ga0105251_100463182 397
299 3300009036 Ga0105244_10002978 Ga0105244_100029788 397
300 3300009036 Ga0105244_10007571 Ga0105244_100075712 397
301 3300009036 Ga0105244_10052810 Ga0105244_100528102 397
302 3300009092 Ga0105250_10000058 Ga0105250_1000005836 397
303 3300009092 Ga0105250_10000515 Ga0105250_1000051526 397
304 3300009092 Ga0105250_10000700 Ga0105250_100007009 397
305 3300009148 Ga0105243_10001444 Ga0105243_1000144417 397
306 3300009176 Ga0105242_10004205 Ga0105242_100042059 397
307 3300009545 Ga0105237_10000596 Ga0105237_1000059622 397
308 3300011119 Ga0105246_10000357 Ga0105246_100003577 397
309 3300013100 Ga0157373_10000193 Ga0157373_1000019314 397
310 3300013100 Ga0157373_10004679 Ga0157373_100046797 397
311 3300013100 Ga0157373_10005138 Ga0157373_100051388 397
312 3300013102 Ga0157371_10000010 Ga0157371_10000010316 397
313 3300013102 Ga0157371_10000375 Ga0157371_100003755 397
314 3300013102 Ga0157371_10076517 Ga0157371_100765172 397
315 3300013105 Ga0157369_10001402 Ga0157369_1000140226 397
316 3300013105 Ga0157369_10002198 Ga0157369_1000219815 397
317 3300013105 Ga0157369_10010386 Ga0157369_100103867 397
318 3300013306 Ga0163162_10258965 Ga0163162_102589652 397
319 3300013308 Ga0157375_10000729 Ga0157375_1000072921 397
320 3300014497 Ga0182008_10000161 Ga0182008_1000016127 397
321 3300014497 Ga0182008_10000164 Ga0182008_1000016421 397
322 3300014497 Ga0182008_10000202 Ga0182008_1000020215 397
323 3300014497 Ga0182008_10000621 Ga0182008_100006213 397
324 3300014497 Ga0182008_10000694 Ga0182008_1000069413 397
325 3300014497 Ga0182008_10014735 Ga0182008_100147353 397
326 3300015261 Ga0182006_1000046 Ga0182006_100004651 397
327 3300015261 Ga0182006_1063785 Ga0182006_10637851 397
328 3300015262 Ga0182007_10000044 Ga0182007_1000004451 397
329 3300015265 Ga0182005_1000032 Ga0182005_100003250 397
330 3300017792 Ga0163161_10004784 Ga0163161_100047846 397
331 3300017792 Ga0163161_10004828 Ga0163161_100048286 397
332 3300017792 Ga0163161_10043683 Ga0163161_100436832 397
333 3300017792 Ga0163161_10066540 Ga0163161_100665402 397
334 3300017792 Ga0163161_10088544 Ga0163161_100885442 397
335 3300017792 Ga0163161_10209589 Ga0163161_102095892 397
336 3300025207 Ga0209760_100030 Ga0209760_10003072 397
337 3300025224 Ga0209784_100023 Ga0209784_100023296 397
338 3300025225 Ga0209566_100019 Ga0209566_100019309 397
339 3300025226 Ga0209674_100034 Ga0209674_100034309 397
340 3300025229 Ga0209147_100027 Ga0209147_100027311 397
341 3300025230 Ga0209563_100037 Ga0209563_100037309 397
342 3300025230 Ga0209563_101324 Ga0209563_1013243 397
343 3300025231 Ga0207427_100022 Ga0207427_10002241 397
344 3300025233 Ga0209437_100002 Ga0209437_1000021053 397
345 3300025242 Ga0209258_100520 Ga0209258_10052023 397
346 3300025246 Ga0209646_1000110 Ga0209646_1000110125 397
347 3300025253 Ga0209677_100021 Ga0209677_100021309 397
348 3300025256 Ga0209759_1013109 Ga0209759_10131093 397
349 3300025261 Ga0209233_1000004 Ga0209233_1000004372 397
350 3300025292 Ga0209676_1000003 Ga0209676_1000003387 397
351 3300025294 Ga0209025_1000382 Ga0209025_100038236 397
352 3300025298 Ga0209050_1000004 Ga0209050_1000004369 397
353 3300025303 Ga0209051_1000006 Ga0209051_1000006605 397
354 3300025321 Ga0207656_10000456 Ga0207656_1000045611 397
355 3300025321 Ga0207656_10001757 Ga0207656_100017574 397
356 3300025711 Ga0207696_1000017 Ga0207696_1000017402 397
357 3300025711 Ga0207696_1000376 Ga0207696_100037626 397
358 3300025711 Ga0207696_1044232 Ga0207696_10442321 397
359 3300025728 Ga0207655_1000074 Ga0207655_1000074167 397
360 3300025728 Ga0207655_1004488 Ga0207655_10044882 397
361 3300025728 Ga0207655_1004638 Ga0207655_10046386 397
362 3300025728 Ga0207655_1012403 Ga0207655_10124034 397
363 3300025735 Ga0207713_1000213 Ga0207713_100021350 397
364 3300025735 Ga0207713_1000523 Ga0207713_100052330 397
365 3300025735 Ga0207713_1013808 Ga0207713_10138085 397
366 3300025735 Ga0207713_1020553 Ga0207713_10205532 397
367 3300025914 Ga0207671_10000995 Ga0207671_1000099513 397
368 3300025920 Ga0207649_10000070 Ga0207649_1000007075 397
369 3300025923 Ga0207681_10000430 Ga0207681_100004304 397
370 3300025933 Ga0207706_10032792 Ga0207706_100327925 397
371 3300025934 Ga0207686_10008012 Ga0207686_100080123 397
372 3300025935 Ga0207709_10000143 Ga0207709_1000014330 397
373 3300025935 Ga0207709_10003974 Ga0207709_100039743 397
374 3300025945 Ga0207679_10000021 Ga0207679_100000213 397
375 3300027111 Ga0209281_1000017 Ga0209281_1000017331 397
376 3300027312 Ga0209371_1000310 Ga0209371_100031035 397
377 3300030500 Ga0268256_1000267 Ga0268256_100026735 397
378 3300030744 Ga0316181_1238674 Ga0316181_12386742 397
379 3300031250 Ga0265331_10044471 Ga0265331_100444712 397
380 3300031731 Ga0307405_10000024 Ga0307405_1000002492 397
381 3300031911 Ga0307412_10013261 Ga0307412_100132612 397
382 3300032004 Ga0307414_10012925 Ga0307414_100129254 397
383 3300038705 Ga0237819_00717 Ga0237819_00717_3397_4596 397
384 3300042013 Ga0439456_000047 Ga0439456_000047_26850_28049 397
385 3300042016 Ga0439463_000216 Ga0439463_000216_10577_11776 397
386 3300042533 Ga0450901_000307 Ga0450901_000307_1147_2346 397
387 3300042876 Ga0451577_0024350 Ga0451577_0024350_2573_3781 397
388 3300046452 Ga0495617_002574 Ga0495617_002574_2418_3617 397
389 3300046453 Ga0495627_000005 Ga0495627_000005_253440_254678 397
390 3300046453 Ga0495627_000314 Ga0495627_000314_21034_22233 397
391 3300046453 Ga0495627_003518 Ga0495627_003518_4960_6165 397
392 3300046454 Ga0495592_0007023 Ga0495592_0007023_6221_7420 397
393 3300046457 Ga0495590_0004324 Ga0495590_0004324_2353_3552 397
394 3300046463 Ga0495653_0003660 Ga0495653_0003660_3311_4540 397
395 3300046463 Ga0495653_0005352 Ga0495653_0005352_3918_5117 397
396 3300046471 Ga0495650_0000401 Ga0495650_0000401_19265_20464 397
397 3300046474 Ga0495605_0000349 Ga0495605_0000349_15425_16624 397
398 3300046474 Ga0495605_0002938 Ga0495605_0002938_3038_4237 397
399 3300046491 Ga0495584_0000590 Ga0495584_0000590_15589_16788 397
400 3300046492 Ga0495585_0000129 Ga0495585_0000129_44295_45494 397
401 3300046500 Ga0495596_0000039 Ga0495596_0000039_52097_53296 397
402 3300046501 Ga0495607_0000078 Ga0495607_0000078_39325_40530 397
403 3300046501 Ga0495607_0001430 Ga0495607_0001430_3948_5153 397
404 3300046501 Ga0495607_0037681 Ga0495607_0037681_442_1641 397
405 3300046501 Ga0495607_0054122 Ga0495607_0054122_715_1914 397
406 3300046506 Ga0495583_0000131 Ga0495583_0000131_59192_60391 397
407 3300046506 Ga0495583_0001341 Ga0495583_0001341_19820_21019 397
408 3300046507 Ga0495606_0000724 Ga0495606_0000724_5896_7095 397
409 3300046507 Ga0495606_0012519 Ga0495606_0012519_2101_3300 397
410 3300046507 Ga0495606_0136214 Ga0495606_0136214_46_1284 397
411 3300046515 Ga0495620_0001200 Ga0495620_0001200_6588_7793 397
412 3300046519 Ga0495632_0000258 Ga0495632_0000258_10449_11648 397
413 3300046519 Ga0495632_0000320 Ga0495632_0000320_15584_16783 397
414 3300046519 Ga0495632_0005548 Ga0495632_0005548_442_1641 397
415 3300046519 Ga0495632_0017387 Ga0495632_0017387_2384_3583 397
416 3300046520 Ga0495637_0000106 Ga0495637_0000106_58292_59521 397
417 3300046520 Ga0495637_0001231 Ga0495637_0001231_11623_12861 397
418 3300046520 Ga0495637_0005118 Ga0495637_0005118_2712_3911 397
419 3300046522 Ga0495643_0000579 Ga0495643_0000579_28545_29744 397
420 3300046524 Ga0495648_0000085 Ga0495648_0000085_14306_15505 397
421 3300046526 Ga0495666_0003145 Ga0495666_0003145_6483_7682 397
422 3300046528 Ga0495642_0000121 Ga0495642_0000121_15427_16626 397
423 3300046530 Ga0495654_0000035 Ga0495654_0000035_66852_68081 397
424 3300046530 Ga0495654_0000059 Ga0495654_0000059_89183_90382 397
425 3300046530 Ga0495654_0007511 Ga0495654_0007511_224_1423 397
426 3300046530 Ga0495654_0011757 Ga0495654_0011757_1473_2672 397
427 3300046530 Ga0495654_0031957 Ga0495654_0031957_1011_2255 397
428 3300046538 Ga0495609_0000111 Ga0495609_0000111_32199_33398 397
429 3300046543 Ga0495645_0028341 Ga0495645_0028341_1311_2510 397
430 3300046557 Ga0495622_0021220 Ga0495622_0021220_327_1571 397
431 3300046558 Ga0495633_0000980 Ga0495633_0000980_19061_20299 397
432 3300046558 Ga0495633_0001345 Ga0495633_0001345_5758_7002 397
433 3300046642 Ga0495634_0008934 Ga0495634_0008934_947_2146 397
434 3300046648 Ga0495611_0000306 Ga0495611_0000306_28588_29787 397
435 3300046665 Ga0495661_0000168 Ga0495661_0000168_49697_50896 397
436 3300046665 Ga0495661_0000313 Ga0495661_0000313_16581_17780 397
437 3300046680 Ga0495646_0014722 Ga0495646_0014722_1605_2804 397
438 3300046689 Ga0495613_0004762 Ga0495613_0004762_8034_9233 397
439 3300046689 Ga0495613_0008224 Ga0495613_0008224_2683_3882 397
440 3300046690 Ga0495624_0000477 Ga0495624_0000477_19266_20465 397
441 3300046692 Ga0495671_0002104 Ga0495671_0002104_1800_2999 397
442 3300046692 Ga0495671_0034944 Ga0495671_0034944_136_1374 397
443 3300046694 Ga0495649_0000091 Ga0495649_0000091_44539_45738 397
444 3300046809 Ga0495600_0041353 Ga0495600_0041353_32_1231 397
445 3300046810 Ga0495660_0002330 Ga0495660_0002330_675_1874 397
446 3300046810 Ga0495660_0014621 Ga0495660_0014621_1942_3180 397
447 3300047317 Ga0495604_0033642 Ga0495604_0033642_920_2119 397
448 3300047318 Ga0495636_0000065 Ga0495636_0000065_14974_16173 397
449 3300047320 Ga0495672_0000174 Ga0495672_0000174_73100_74299 397
450 3300047320 Ga0495672_0000781 Ga0495672_0000781_15587_16786 397
451 3300047321 Ga0495676_0013725 Ga0495676_0013725_5136_6335 397
452 3300047322 Ga0495680_0068173 Ga0495680_0068173_1102_2301 397
453 3300047443 Ga0495687_000539 Ga0495687_000539_28543_29742 397
454 3300047446 Ga0495679_000193 Ga0495679_000193_6065_7258 397
455 3300047469 Ga0495673_0000006 Ga0495673_0000006_402269_403498 397
456 3300047469 Ga0495673_0000024 Ga0495673_0000024_20431_21669 397
457 3300047469 Ga0495673_0000118 Ga0495673_0000118_100606_101811 397
458 3300047469 Ga0495673_0000469 Ga0495673_0000469_33074_34273 397
459 3300047469 Ga0495673_0061925 Ga0495673_0061925_176_1375 397
460 3300047470 Ga0495681_0020743 Ga0495681_0020743_20_1258 397
461 3300047471 Ga0495684_0005723 Ga0495684_0005723_7498_8697 397
462 3300047472 Ga0495686_0000760 Ga0495686_0000760_37710_38936 397
463 3300047673 Ga0495593_0010175 Ga0495593_0010175_849_2048 397
464 3300048088 Ga0495602_0001831 Ga0495602_0001831_7814_9013 397
465 3300048091 Ga0495626_0000398 Ga0495626_0000398_28459_29658 397
466 3300048903 Ga0496100_0054136 Ga0496100_0054136_912_2111 397
467 3300048909 Ga0496106_0008929 Ga0496106_0008929_861_2060 397
468 3300048919 Ga0496116_0000010 Ga0496116_0000010_616873_618072 397
469 3300048919 Ga0496116_0005921 Ga0496116_0005921_1181_2380 397
470 3300048919 Ga0496116_0024463 Ga0496116_0024463_1676_2920 397
471 3300048919 Ga0496116_0113055 Ga0496116_0113055_307_1545 397
472 3300048920 Ga0496117_0000010 Ga0496117_0000010_50312_51556 397
473 3300048920 Ga0496117_0000158 Ga0496117_0000158_45092_46291 397
474 3300048920 Ga0496117_0004549 Ga0496117_0004549_7440_8639 397
475 3300048920 Ga0496117_0033841 Ga0496117_0033841_1473_2672 397
476 3300048920 Ga0496117_0038160 Ga0496117_0038160_1181_2380 397
477 3300048921 Ga0496118_0000009 Ga0496118_0000009_560399_561643 397
478 3300048921 Ga0496118_0014349 Ga0496118_0014349_5613_6812 397
479 3300048921 Ga0496118_0022661 Ga0496118_0022661_3936_5141 397
480 3300048921 Ga0496118_0047764 Ga0496118_0047764_665_1864 397
481 3300048921 Ga0496118_0069969 Ga0496118_0069969_13_1212 397
482 3300048922 Ga0496119_0004370 Ga0496119_0004370_7574_8773 397
483 3300048922 Ga0496119_0047905 Ga0496119_0047905_169_1368 397
484 3300048923 Ga0496120_0003521 Ga0496120_0003521_7650_8849 397
485 3300048924 Ga0496121_0000149 Ga0496121_0000149_69040_70239 397
486 3300048924 Ga0496121_0008746 Ga0496121_0008746_853_2058 397
487 3300048924 Ga0496121_0010815 Ga0496121_0010815_7477_8676 397
488 3300048924 Ga0496121_0014571 Ga0496121_0014571_5927_7126 397
489 3300048924 Ga0496121_0041674 Ga0496121_0041674_977_2221 397
490 3300048925 Ga0496122_0000260 Ga0496122_0000260_70754_71959 397
491 3300048925 Ga0496122_0001244 Ga0496122_0001244_28220_29419 397
492 3300048925 Ga0496122_0002400 Ga0496122_0002400_22176_23420 397
493 3300048926 Ga0496123_0000037 Ga0496123_0000037_72069_73274 397
494 3300048926 Ga0496123_0000256 Ga0496123_0000256_24120_25319 397
495 3300048926 Ga0496123_0004021 Ga0496123_0004021_3441_4685 397
496 3300048926 Ga0496123_0012030 Ga0496123_0012030_1464_2663 397
497 3300048926 Ga0496123_0012621 Ga0496123_0012621_5462_6661 397
498 3300048927 Ga0496124_0008998 Ga0496124_0008998_4052_5251 397
499 3300048927 Ga0496124_0079685 Ga0496124_0079685_1095_2294 397
500 3300048927 Ga0496124_0089608 Ga0496124_0089608_1193_2437 397
501 3300048927 Ga0496124_0106422 Ga0496124_0106422_927_2165 397
502 3300048927 Ga0496124_0133858 Ga0496124_0133858_653_1879 397
503 3300048928 Ga0496125_0000274 Ga0496125_0000274_75052_76251 397
504 3300048928 Ga0496125_0002914 Ga0496125_0002914_15891_17132 397
505 3300048928 Ga0496125_0005585 Ga0496125_0005585_7539_8738 397
506 3300048928 Ga0496125_0047701 Ga0496125_0047701_376_1620 397
507 3300048929 Ga0496126_0017489 Ga0496126_0017489_380_1579 397
508 3300048929 Ga0496126_0190025 Ga0496126_0190025_19_1260 397
509 3300049459 Ga0495678_000119 Ga0495678_000119_80189_81388 397
510 3300049459 Ga0495678_000381 Ga0495678_000381_28622_29821 397
511 3300049459 Ga0495678_010094 Ga0495678_010094_903_2129 397
512 3300049460 Ga0495682_0000316 Ga0495682_0000316_15101_16300 397
513 3300049460 Ga0495682_0015242 Ga0495682_0015242_1152_2396 397
514 3300049574 Ga0501038_0071360 Ga0501038_0071360_1166_2365 397
515 3300049766 Ga0501269_000162 Ga0501269_000162_4997_6229 397
516 3300049776 Ga0501280_001202 Ga0501280_001202_1331_2563 397
517 3300049778 Ga0501282_000758 Ga0501282_000758_2263_3495 397
518 3300050490 nmdc:mga03n38_103199_c1 nmdc:mga03n38_103199_c1_76_1308 397
519 3300053118 Ga0500594_0001036 Ga0500594_0001036_376_1614 397
520 3300053125 Ga0500618_000625 Ga0500618_000625_19264_20493 397
521 3300053145 Ga0500586_002411 Ga0500586_002411_507_1745 397
522 3300053161 Ga0500634_0000091 Ga0500634_0000091_27863_29062 397
523 iso_pu_bacteria 2511231024 2511376045 397
524 iso_pu_bacteria 2554235231 2555249121 397
525 iso_pu_bacteria 2600255292 2601670578 397
526 iso_pu_bacteria 2721755523 2722881627 397
527 iso_pu_bacteria 2738541297 2738824900 397
528 iso_pu_bacteria 2738541357 2739148697 397
529 iso_pu_bacteria 2738543003 2739190616 397
530 iso_pu_bacteria 2738543012 2739242924 397
531 iso_pu_bacteria 2738543026 2739317093 397
532 iso_pu_bacteria 2738543029 2739335334 397
533 iso_pu_bacteria 2765235841 2765583370 397
534 iso_pu_bacteria 2806310737 2807407840 397
535 iso_pu_bacteria 2806310745 2807456143 397
536 iso_pu_bacteria 2816332133 2816475919 397
537 iso_pu_bacteria 2821131069 2821133512 397
538 iso_pu_bacteria 2839138175 2839139097 397
539 iso_pu_bacteria 2857547612 2857548078 397
540 iso_pu_bacteria 2857553236 2857553642 397
541 iso_pu_bacteria 2857564685 2857565305 397
542 iso_pu_bacteria 2885080285 2885084178 397
543 iso_pu_bacteria 2891633521 2891633699 397
544 iso_pu_bacteria 2899924645 2899931507 397
545 iso_pu_bacteria 2904541872 2904547803 397
546 iso_pu_bacteria 2919155634 2919159054 397
547 iso_pu_bacteria 2919476304 2919481148 397
548 iso_pu_bacteria 2928051484 2928056505 397
549 iso_pu_bacteria 2928064002 2928069026 397
550 iso_pu_bacteria 2929160207 2929166953 397
551 iso_pu_bacteria 2932410948 2932412668 397
552 iso_pu_bacteria 2932416698 2932420183 397
553 iso_pu_bacteria 3007803356 3007806679 397
554 iso_pu_bacteria 3007872151 3007872947 397
555 iso_pu_bacteria 8052494512 8052497878 397
556 iso_pu_bacteria 8054929484 8054931773 397
557 iso_pu_bacteria 8056115690 8056119300 397
558 iso_pu_bacteria 8056120720 8056123958 397
559 iso_pu_bacteria 8056137416 8056140561 397
560 2162886007 SwRhRL2b_contig_2802055 SwRhRL2b_0922.00006460 399
561 2162886007 SwRhRL2b_contig_3648037 SwRhRL2b_0159.00001630 399
562 3300005289 Ga0065704_10074132 Ga0065704_100741323 399
563 3300005289 Ga0065704_10083675 Ga0065704_100836753 399
564 3300006944 Ga0099823_1000229 Ga0099823_100022918 399
565 3300009011 Ga0105251_10080251 Ga0105251_100802512 399
566 3300009036 Ga0105244_10000229 Ga0105244_1000022912 399
567 3300009036 Ga0105244_10006522 Ga0105244_100065227 399
568 3300009036 Ga0105244_10007941 Ga0105244_100079411 399
569 3300013307 Ga0157372_10010390 Ga0157372_100103901 399
570 3300025292 Ga0209676_1000647 Ga0209676_100064727 399
571 3300025711 Ga0207696_1000018 Ga0207696_10000188 399
572 3300025711 Ga0207696_1007089 Ga0207696_10070893 399
573 3300025728 Ga0207655_1000143 Ga0207655_1000143107 399
574 3300025728 Ga0207655_1000396 Ga0207655_100039643 399
575 3300025728 Ga0207655_1022499 Ga0207655_10224992 399
576 3300025735 Ga0207713_1007190 Ga0207713_10071902 399
577 3300027296 Ga0209389_1000042 Ga0209389_100004219 399
578 3300027312 Ga0209371_1003490 Ga0209371_10034906 399
579 3300030500 Ga0268256_1002346 Ga0268256_10023466 399
580 3300042137 Ga0450902_000369 Ga0450902_000369_3621_4820 399
581 3300042142 Ga0450905_000494 Ga0450905_000494_1287_2486 399
582 3300042533 Ga0450901_000089 Ga0450901_000089_3536_4735 399
583 3300046515 Ga0495620_0000049 Ga0495620_0000049_31329_32528 399
584 3300046519 Ga0495632_0000292 Ga0495632_0000292_17460_18659 399
585 3300046522 Ga0495643_0001028 Ga0495643_0001028_19987_21186 399
586 3300046522 Ga0495643_0001308 Ga0495643_0001308_5628_6827 399
587 3300046524 Ga0495648_0000201 Ga0495648_0000201_17646_18845 399
588 3300048913 Ga0496110_0028130 Ga0496110_0028130_1178_2377 399
589 3300048917 Ga0496114_0010360 Ga0496114_0010360_3595_4794 399
590 3300048917 Ga0496114_0012022 Ga0496114_0012022_5663_6862 399
591 3300048919 Ga0496116_0018182 Ga0496116_0018182_3751_4950 399
592 3300048920 Ga0496117_0002828 Ga0496117_0002828_5698_6897 399
593 3300048920 Ga0496117_0003915 Ga0496117_0003915_10147_11346 399
594 3300048920 Ga0496117_0011804 Ga0496117_0011804_2958_4157 399
595 3300048921 Ga0496118_0003447 Ga0496118_0003447_5117_6316 399
596 3300048921 Ga0496118_0003884 Ga0496118_0003884_7770_8969 399
597 3300048922 Ga0496119_0000189 Ga0496119_0000189_22570_23769 399
598 3300048923 Ga0496120_0031232 Ga0496120_0031232_235_1434 399
599 3300048924 Ga0496121_0046265 Ga0496121_0046265_240_1439 399
600 3300048924 Ga0496121_0176431 Ga0496121_0176431_289_1488 399
601 3300048925 Ga0496122_0000636 Ga0496122_0000636_12532_13731 399
602 3300048925 Ga0496122_0028710 Ga0496122_0028710_2559_3758 399
603 3300048926 Ga0496123_0000375 Ga0496123_0000375_9031_10230 399
604 3300048926 Ga0496123_0064249 Ga0496123_0064249_299_1498 399
605 3300048927 Ga0496124_0003763 Ga0496124_0003763_5137_6336 399
606 3300048927 Ga0496124_0006381 Ga0496124_0006381_2757_3956 399
607 3300048928 Ga0496125_0008614 Ga0496125_0008614_5537_6736 399
608 3300048928 Ga0496125_0023980 Ga0496125_0023980_867_2066 399
609 3300048928 Ga0496125_0048091 Ga0496125_0048091_1501_2700 399
610 3300048929 Ga0496126_0027245 Ga0496126_0027245_2242_3441 399
611 3300049571 Ga0501034_0000334 Ga0501034_0000334_26045_27244 399
612 3300053135 Ga0500659_0000406 Ga0500659_0000406_10315_11514 399

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

60

302

0.94

PF09084

NMT1

NMT1/THI5 like

74

297

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8517 44 375
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8322 44 375
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7959 44 343
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.7883 44 397
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.766 44 344
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8359 123 227 3.40.190.10
3un6A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.827 44 375 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8193 125 229 3.40.190.10
3un6A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.801 125 229 3.40.190.10
1xs5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8009 44 124 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7Y8RM67-F1-model_v4 ABC transporter substrate-binding protein 0.9966 27 399 GO:0005886
GO:0012505
AF-A0A7X8D626-F1-model_v4 ABC transporter substrate-binding protein 0.992 44 346 GO:0005886
GO:0012505
AF-A0A7Y8RM67-F1-model_v4 ABC transporter substrate-binding protein 0.9913 27 399 GO:0005886
GO:0012505
AF-A0A7W1WDR7-F1-model_v4 ABC transporter substrate-binding protein 0.9895 152 399
AF-D4TTN1-F1-model_v4 deleted 0.9871 41 399

Feature Viewer

pLDDT pTM Quality
93.56 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map