F469057

General Info

Members Datasets Scaffolds Average Seq Length
611 308 611 119

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10019026|Ga0105245_100190262
Length 131
Sequence LVLDIFLYRYMISGMARAATTADAFNAVAEPRRRLILDVLAGGERPVNDLVRELGLGQPQVSKHLRVLREVGAVEVRDHGRQRLYRLNGPALKPIHDWVKSYESLWSERFDQLDVVLDELKQKEEGDGSDE

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
208 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
282 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
283 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
284 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
285 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
291 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 6.55
Rhizosphere 89.36
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10012886 3300002077 Bacteria 1689
2 JGI24033J26618_1011010 3300002155 Bacteria 1073
3 JGI24742J22300_10016937 3300002244 Bacteria 1231
4 JGI24751J29686_10014242 3300002459 Bacteria 1642
5 JGI25406J46586_10008116 3300003203 Bacteria 4766
6 JGI25406J46586_10009455 3300003203 Bacteria 4365
7 rootH1_10190481 3300003323 Bacteria 2054
8 JGI25407J50210_10004549 3300003373 Bacteria 3376
9 Ga0070658_10044365 3300005327 Bacteria 3594
10 Ga0070683_101366247 3300005329 Bacteria 681
11 Ga0070690_100024361 3300005330 Bacteria 3721
12 Ga0070690_100392131 3300005330 Bacteria 1017
13 Ga0070670_100019042 3300005331 Bacteria 5886
14 Ga0070677_10198061 3300005333 Bacteria 967
15 Ga0070680_100101887 3300005336 Bacteria 2384
16 Ga0070680_100142244 3300005336 Bacteria 2012
17 Ga0070682_100006239 3300005337 Bacteria 6685
18 Ga0070682_100109914 3300005337 Bacteria 1835
19 Ga0068868_100028178 3300005338 Bacteria 4292
20 Ga0068868_101411800 3300005338 Bacteria 650
21 Ga0070660_100025013 3300005339 Bacteria 4435
22 Ga0070660_100079968 3300005339 Bacteria 2564
23 Ga0070689_100033963 3300005340 Bacteria 3890
24 Ga0070689_100106019 3300005340 Bacteria 2229
25 Ga0070689_100429410 3300005340 Bacteria 1121
26 Ga0070691_10064422 3300005341 Bacteria 1769
27 Ga0070661_101169298 3300005344 Unclassified 643
28 Ga0070692_10056496 3300005345 Bacteria 2055
29 Ga0070668_100492240 3300005347 Bacteria 1060
30 Ga0070675_100289112 3300005354 Bacteria 1442
31 Ga0070671_100032574 3300005355 Bacteria 4308
32 Ga0070671_100133610 3300005355 Bacteria 2091
33 Ga0070674_100068560 3300005356 Bacteria 2499
34 Ga0070673_100243709 3300005364 Bacteria 1564
35 Ga0070673_101376941 3300005364 Bacteria 664
36 Ga0070688_100003853 3300005365 Bacteria 7778
37 Ga0070659_100064082 3300005366 Bacteria 2908
38 Ga0070667_100150411 3300005367 Bacteria 2045
39 Ga0070703_10058086 3300005406 Unclassified 1258
40 Ga0070709_10155272 3300005434 Bacteria 1586
41 Ga0070709_10175870 3300005434 Bacteria 1499
42 Ga0070714_100659514 3300005435 Bacteria 1008
43 Ga0070714_101306624 3300005435 Unclassified 708
44 Ga0070710_10047971 3300005437 Bacteria 2384
45 Ga0070701_10000911 3300005438 Bacteria 10702
46 Ga0070701_10512761 3300005438 Unclassified 781
47 Ga0070701_10823337 3300005438 Bacteria 635
48 Ga0070711_100003577 3300005439 Bacteria 9064
49 Ga0070711_100097858 3300005439 Bacteria 2129
50 Ga0070711_100121618 3300005439 Bacteria 1932
51 Ga0070705_101125286 3300005440 Bacteria 643
52 Ga0070705_101709909 3300005440 Bacteria 532
53 Ga0070700_100001973 3300005441 Bacteria 10413
54 Ga0070700_101974727 3300005441 Bacteria 506
55 Ga0070694_100364091 3300005444 Bacteria 1124
56 Ga0070694_100622624 3300005444 Bacteria 871
57 Ga0070663_100001959 3300005455 Bacteria 11500
58 Ga0070663_101205913 3300005455 Bacteria 665
59 Ga0070678_100000298 3300005456 Bacteria 23008
60 Ga0070681_10105938 3300005458 Bacteria 2753
61 Ga0070681_11111122 3300005458 Bacteria 711
62 Ga0070681_11272816 3300005458 Unclassified 658
63 Ga0068867_100002281 3300005459 Bacteria 13492
64 Ga0068867_100575674 3300005459 Unclassified 979
65 Ga0070685_10045060 3300005466 Bacteria 2527
66 Ga0070685_10259135 3300005466 Bacteria 1156
67 Ga0070706_100905568 3300005467 Bacteria 815
68 Ga0070707_100145063 3300005468 Bacteria 2311
69 Ga0070707_100562202 3300005468 Bacteria 1103
70 Ga0070699_100371783 3300005518 Bacteria 1290
71 Ga0070699_100866036 3300005518 Bacteria 827
72 Ga0070679_100453820 3300005530 Bacteria 1226
73 Ga0070684_100520279 3300005535 Bacteria 1103
74 Ga0070684_100637232 3300005535 Bacteria 992
75 Ga0068853_100085008 3300005539 Bacteria 2773
76 Ga0070672_101165162 3300005543 Bacteria 686
77 Ga0070686_100007440 3300005544 Bacteria 6112
78 Ga0070686_100517855 3300005544 Bacteria 928
79 Ga0070686_101847964 3300005544 Bacteria 515
80 Ga0070696_100033756 3300005546 Bacteria 3518
81 Ga0070696_100454910 3300005546 Bacteria 1011
82 Ga0070693_100023513 3300005547 Bacteria 3295
83 Ga0070693_100127431 3300005547 Bacteria 1587
84 Ga0070693_100231632 3300005547 Bacteria 1216
85 Ga0070704_100159925 3300005549 Bacteria 1780
86 Ga0068855_100360924 3300005563 Bacteria 1598
87 Ga0068855_100577021 3300005563 Bacteria 1215
88 Ga0068855_100868110 3300005563 Bacteria 955
89 Ga0070664_102375906 3300005564 Bacteria 503
90 Ga0068857_100048398 3300005577 Bacteria 3775
91 Ga0068857_101082183 3300005577 Unclassified 774
92 Ga0068856_100003239 3300005614 Bacteria 16573
93 Ga0068856_100064387 3300005614 Bacteria 3622
94 Ga0070702_100023431 3300005615 Bacteria 3280
95 Ga0068852_100002120 3300005616 Bacteria 13586
96 Ga0068852_102517537 3300005616 Bacteria 535
97 Ga0068859_100042556 3300005617 Bacteria 4563
98 Ga0068859_100061676 3300005617 Bacteria 3779
99 Ga0068859_100104270 3300005617 Archaea 2895
100 Ga0068864_100100815 3300005618 Bacteria 2560
101 Ga0068864_100449674 3300005618 Bacteria 1232
102 Ga0068864_100838530 3300005618 Bacteria 905
103 Ga0068866_10014980 3300005718 Bacteria 3436
104 Ga0068861_100574388 3300005719 Bacteria 1031
105 Ga0068851_10082842 3300005834 Bacteria 1678
106 Ga0068870_10013058 3300005840 Bacteria 3893
107 Ga0068870_10189885 3300005840 Unclassified 1239
108 Ga0068858_100013790 3300005842 Bacteria 7629
109 Ga0068858_101074521 3300005842 Unclassified 790
110 Ga0068860_100761269 3300005843 Bacteria 980
111 Ga0068862_102124526 3300005844 Bacteria 573
112 Ga0081455_10010177 3300005937 Bacteria 9574
113 Ga0081455_10017821 3300005937 Bacteria 6790
114 Ga0081538_10000669 3300005981 Bacteria 37700
115 Ga0081538_10000902 3300005981 Bacteria 32102
116 Ga0081538_10018916 3300005981 Bacteria 5147
117 Ga0081538_10071257 3300005981 Bacteria 1913
118 Ga0081538_10338541 3300005981 Bacteria 546
119 Ga0081540_1053311 3300005983 Bacteria 1984
120 Ga0081539_10000182 3300005985 Bacteria 148133
121 Ga0081539_10044037 3300005985 Bacteria 2580
122 Ga0070717_10321991 3300006028 Bacteria 1378
123 Ga0070717_10557221 3300006028 Bacteria 1038
124 Ga0075365_10576044 3300006038 Bacteria 796
125 Ga0075363_100115916 3300006048 Archaea 1492
126 Ga0075363_100667823 3300006048 Bacteria 626
127 Ga0075363_100864244 3300006048 Unclassified 552
128 Ga0075432_10295522 3300006058 Bacteria 671
129 Ga0070715_10030275 3300006163 Bacteria 2186
130 Ga0070716_100155765 3300006173 Bacteria 1475
131 Ga0070712_100019749 3300006175 Bacteria 4400
132 Ga0075367_10409214 3300006178 Bacteria 858
133 Ga0097621_100035448 3300006237 Bacteria 3987
134 Ga0068871_100607464 3300006358 Bacteria 995
135 Ga0075428_100031225 3300006844 Bacteria 5891
136 Ga0075428_100037399 3300006844 Bacteria 5344
137 Ga0075428_101031814 3300006844 Bacteria 870
138 Ga0075428_102584971 3300006844 Bacteria 519
139 Ga0075430_100010106 3300006846 Bacteria 7986
140 Ga0075430_100012632 3300006846 Bacteria 7192
141 Ga0075430_100995234 3300006846 Bacteria 691
142 Ga0075431_101198696 3300006847 Unclassified 722
143 Ga0075431_101652827 3300006847 Bacteria 598
144 Ga0075433_10039711 3300006852 Bacteria 4071
145 Ga0075433_10271070 3300006852 Bacteria 1504
146 Ga0075433_10971637 3300006852 Bacteria 740
147 Ga0075434_100032531 3300006871 Bacteria 5143
148 Ga0075434_100095193 3300006871 Bacteria 2984
149 Ga0075434_102155128 3300006871 Bacteria 562
150 Ga0075429_100007437 3300006880 Bacteria 9505
151 Ga0075429_100082653 3300006880 Bacteria 2799
152 Ga0075429_100764991 3300006880 Bacteria 846
153 Ga0068865_100031672 3300006881 Bacteria 3527
154 Ga0068865_100171974 3300006881 Bacteria 1662
155 Ga0068865_100513869 3300006881 Bacteria 1001
156 Ga0075436_100436374 3300006914 Bacteria 952
157 Ga0075436_100632416 3300006914 Bacteria 790
158 Ga0097620_100042556 3300006931 Bacteria 4563
159 Ga0097620_100061679 3300006931 Bacteria 3779
160 Ga0097620_100104273 3300006931 Archaea 2895
161 Ga0075435_100000686 3300007076 Bacteria 20987
162 Ga0111539_10032821 3300009094 Bacteria 6304
163 Ga0111539_10051458 3300009094 Bacteria 4905
164 Ga0111539_11227807 3300009094 Bacteria 870
165 Ga0105245_10019026 3300009098 Bacteria 6011
166 Ga0105245_10050490 3300009098 Bacteria 3728
167 Ga0105245_10549756 3300009098 Bacteria 1176
168 Ga0114129_10003650 3300009147 Bacteria 21650
169 Ga0114129_10029537 3300009147 Bacteria 7763
170 Ga0114129_10112507 3300009147 Bacteria 3754
171 Ga0114129_10132970 3300009147 Bacteria 3415
172 Ga0114129_10213403 3300009147 Bacteria 2608
173 Ga0114129_10228966 3300009147 Bacteria 2504
174 Ga0114129_10411171 3300009147 Bacteria 1781
175 Ga0105243_10002101 3300009148 Bacteria 16849
176 Ga0105243_10120018 3300009148 Archaea 2215
177 Ga0105243_10435665 3300009148 Bacteria 1226
178 Ga0105241_10019097 3300009174 Bacteria 5055
179 Ga0105241_10480392 3300009174 Bacteria 1104
180 Ga0105242_10003124 3300009176 Bacteria 12921
181 Ga0105242_10178362 3300009176 Unclassified 1872
182 Ga0105242_10510983 3300009176 Bacteria 1144
183 Ga0105242_11148627 3300009176 Bacteria 793
184 Ga0105248_10021005 3300009177 Bacteria 7235
185 Ga0105248_10089177 3300009177 Bacteria 3471
186 Ga0105248_10899672 3300009177 Bacteria 999
187 Ga0105237_10476973 3300009545 Bacteria 1254
188 Ga0105237_10736885 3300009545 Bacteria 992
189 Ga0105238_10020762 3300009551 Bacteria 6688
190 Ga0105249_10002268 3300009553 Bacteria 16680
191 Ga0105249_10267466 3300009553 Bacteria 1702
192 Ga0105249_11841946 3300009553 Bacteria 678
193 Ga0099796_10327983 3300010159 Bacteria 655
194 Ga0105239_10061108 3300010375 Bacteria 4135
195 Ga0105239_10457207 3300010375 Bacteria 1449
196 Ga0105239_12089734 3300010375 Bacteria 658
197 Ga0157371_10203491 3300013102 Bacteria 1420
198 Ga0157370_10499069 3300013104 Bacteria 1118
199 Ga0157370_11642959 3300013104 Unclassified 577
200 Ga0157369_10432933 3300013105 Bacteria 1363
201 Ga0157369_10949951 3300013105 Unclassified 881
202 Ga0157374_10001932 3300013296 Bacteria 17377
203 Ga0157374_10884536 3300013296 Bacteria 911
204 Ga0157374_11441534 3300013296 Bacteria 712
205 Ga0157378_10002234 3300013297 Bacteria 17171
206 Ga0157378_10119289 3300013297 Bacteria 2429
207 Ga0163162_10021305 3300013306 Bacteria 6381
208 Ga0163162_12408500 3300013306 Unclassified 605
209 Ga0157372_11304122 3300013307 Bacteria 838
210 Ga0157372_11380449 3300013307 Bacteria 812
211 Ga0157375_10058096 3300013308 Bacteria 3826
212 Ga0157375_10081823 3300013308 Bacteria 3270
213 Ga0163163_11628181 3300014325 Bacteria 706
214 Ga0157380_10017866 3300014326 Bacteria 5257
215 Ga0157380_10344463 3300014326 Bacteria 1392
216 Ga0157377_10001693 3300014745 Bacteria 9609
217 Ga0157379_10232720 3300014968 Bacteria 1670
218 Ga0157376_10005356 3300014969 Bacteria 8964
219 Ga0157376_10311674 3300014969 Bacteria 1493
220 Ga0213873_10061746 3300021358 Bacteria 1016
221 Ga0213873_10158630 3300021358 Bacteria 684
222 Ga0213874_10318892 3300021377 Bacteria 589
223 Ga0213876_10001139 3300021384 Bacteria 16937
224 Ga0213875_10038849 3300021388 Bacteria 2243
225 Ga0207656_10153290 3300025321 Bacteria 1093
226 Ga0207653_10030985 3300025885 Bacteria 1727
227 Ga0207653_10230058 3300025885 Bacteria 706
228 Ga0207682_10109060 3300025893 Bacteria 1217
229 Ga0207692_10142735 3300025898 Bacteria 1363
230 Ga0207642_10054953 3300025899 Bacteria 1818
231 Ga0207710_10366555 3300025900 Bacteria 736
232 Ga0207688_10140322 3300025901 Bacteria 1422
233 Ga0207680_10023379 3300025903 Bacteria 3374
234 Ga0207699_10046025 3300025906 Bacteria 2549
235 Ga0207699_10062124 3300025906 Bacteria 2251
236 Ga0207643_10013602 3300025908 Bacteria 4409
237 Ga0207643_10038160 3300025908 Bacteria 2698
238 Ga0207654_10107294 3300025911 Bacteria 1731
239 Ga0207654_10290826 3300025911 Bacteria 1108
240 Ga0207707_10243454 3300025912 Unclassified 1563
241 Ga0207693_10007175 3300025915 Bacteria 9179
242 Ga0207663_10033549 3300025916 Bacteria 3059
243 Ga0207663_10836654 3300025916 Bacteria 734
244 Ga0207662_10015041 3300025918 Bacteria 4347
245 Ga0207662_10074295 3300025918 Bacteria 2063
246 Ga0207662_10409815 3300025918 Bacteria 921
247 Ga0207657_10004070 3300025919 Bacteria 15518
248 Ga0207657_10042720 3300025919 Bacteria 3997
249 Ga0207657_10527901 3300025919 Bacteria 923
250 Ga0207652_10100193 3300025921 Bacteria 2557
251 Ga0207652_10198458 3300025921 Bacteria 1806
252 Ga0207646_10397036 3300025922 Bacteria 1246
253 Ga0207694_10767491 3300025924 Bacteria 814
254 Ga0207650_10001896 3300025925 Bacteria 14752
255 Ga0207659_10451226 3300025926 Bacteria 1083
256 Ga0207659_10841809 3300025926 Bacteria 788
257 Ga0207687_10139571 3300025927 Bacteria 1837
258 Ga0207687_10187839 3300025927 Bacteria 1606
259 Ga0207664_10344571 3300025929 Unclassified 1318
260 Ga0207644_10237493 3300025931 Bacteria 1450
261 Ga0207644_10394456 3300025931 Bacteria 1130
262 Ga0207706_10478987 3300025933 Bacteria 1075
263 Ga0207706_10784245 3300025933 Bacteria 810
264 Ga0207686_10014856 3300025934 Bacteria 4346
265 Ga0207686_10126001 3300025934 Bacteria 1750
266 Ga0207709_10246390 3300025935 Bacteria 1303
267 Ga0207670_10147928 3300025936 Bacteria 1739
268 Ga0207670_10194797 3300025936 Bacteria 1536
269 Ga0207670_10327379 3300025936 Bacteria 1207
270 Ga0207669_10192844 3300025937 Bacteria 1471
271 Ga0207704_10089184 3300025938 Bacteria 2020
272 Ga0207665_10070580 3300025939 Bacteria 2384
273 Ga0207665_10269231 3300025939 Bacteria 1264
274 Ga0207665_10609547 3300025939 Bacteria 853
275 Ga0207691_10081295 3300025940 Bacteria 2913
276 Ga0207691_10214397 3300025940 Bacteria 1671
277 Ga0207711_10027079 3300025941 Bacteria 4813
278 Ga0207711_10112790 3300025941 Archaea 2420
279 Ga0207661_11253079 3300025944 Bacteria 682
280 Ga0207679_11204156 3300025945 Bacteria 695
281 Ga0207679_11214763 3300025945 Bacteria 692
282 Ga0207667_10429702 3300025949 Bacteria 1343
283 Ga0207667_10819849 3300025949 Bacteria 926
284 Ga0207651_10257702 3300025960 Bacteria 1430
285 Ga0207651_10340993 3300025960 Bacteria 1259
286 Ga0207712_10047091 3300025961 Bacteria 2992
287 Ga0207712_10102053 3300025961 Bacteria 2135
288 Ga0207668_10002697 3300025972 Bacteria 10384
289 Ga0207668_12130873 3300025972 Bacteria 505
290 Ga0207658_10165417 3300025986 Bacteria 1817
291 Ga0207677_10183916 3300026023 Unclassified 1646
292 Ga0207677_10424595 3300026023 Bacteria 1133
293 Ga0207677_10672395 3300026023 Bacteria 916
294 Ga0207703_10027981 3300026035 Bacteria 4439
295 Ga0207639_10382465 3300026041 Bacteria 1264
296 Ga0207678_10007751 3300026067 Bacteria 9486
297 Ga0207678_10583610 3300026067 Bacteria 979
298 Ga0207678_11466751 3300026067 Bacteria 603
299 Ga0207708_10000352 3300026075 Bacteria 36059
300 Ga0207708_10019855 3300026075 Bacteria 5066
301 Ga0207702_10179997 3300026078 Bacteria 1946
302 Ga0207648_10033696 3300026089 Bacteria 4517
303 Ga0207648_10042164 3300026089 Bacteria 4007
304 Ga0207648_10239663 3300026089 Bacteria 1615
305 Ga0207676_10446478 3300026095 Archaea 1218
306 Ga0207676_10787101 3300026095 Bacteria 927
307 Ga0207674_10056049 3300026116 Bacteria 4004
308 Ga0207674_10391228 3300026116 Bacteria 1344
309 Ga0207675_100015239 3300026118 Bacteria 7171
310 Ga0207683_10000598 3300026121 Bacteria 33267
311 Ga0207683_10019625 3300026121 Bacteria 5776
312 Ga0207428_10115786 3300027907 Bacteria 2059
313 Ga0207428_10271472 3300027907 Bacteria 1261
314 Ga0268266_10027679 3300028379 Bacteria 4820
315 Ga0268266_10100293 3300028379 Bacteria 2551
316 Ga0307408_100011866 3300031548 Bacteria 5765
317 Ga0307408_100117574 3300031548 Bacteria 2054
318 Ga0307405_10038900 3300031731 Bacteria 2871
319 Ga0307405_10145617 3300031731 Bacteria 1659
320 Ga0307405_10171833 3300031731 Bacteria 1547
321 Ga0307405_10298643 3300031731 Bacteria 1221
322 Ga0307413_10298435 3300031824 Bacteria 1221
323 Ga0307410_10193576 3300031852 Bacteria 1548
324 Ga0307410_10689919 3300031852 Bacteria 860
325 Ga0307406_10059659 3300031901 Bacteria 2457
326 Ga0307406_10126140 3300031901 Bacteria 1789
327 Ga0307406_10928400 3300031901 Bacteria 743
328 Ga0307407_10049644 3300031903 Bacteria 2396
329 Ga0307407_10178165 3300031903 Bacteria 1406
330 Ga0307407_10675217 3300031903 Bacteria 776
331 Ga0307412_10062126 3300031911 Bacteria 2514
332 Ga0307412_10234836 3300031911 Bacteria 1414
333 Ga0307409_100093471 3300031995 Bacteria 2471
334 Ga0307409_100289504 3300031995 Bacteria 1518
335 Ga0307409_100399488 3300031995 Bacteria 1312
336 Ga0307416_100030108 3300032002 Bacteria 4069
337 Ga0307416_100044284 3300032002 Bacteria 3493
338 Ga0307416_100078507 3300032002 Unclassified 2778
339 Ga0307416_100213536 3300032002 Bacteria 1843
340 Ga0307416_100550000 3300032002 Bacteria 1227
341 Ga0307414_10170193 3300032004 Bacteria 1741
342 Ga0307411_10061143 3300032005 Bacteria 2506
343 Ga0307411_10683032 3300032005 Bacteria 892
344 Ga0307415_100000180 3300032126 Bacteria 28325
345 Ga0307415_100166071 3300032126 Bacteria 1716
346 Ga0307415_101692482 3300032126 Bacteria 610
347 Ga0373959_0128829 3300034820 Bacteria 625
348 Ga0373941_0257234 3300035115 Bacteria 684
349 Ga0373945_0122829 3300035116 Bacteria 1034
350 Ga0373946_0041328 3300035171 Bacteria 1891
351 Ga0373935_0417321 3300035692 Bacteria 966
352 Ga0373925_0195437 3300037068 Bacteria 1607
353 Ga0395899_0002792 3300037312 Bacteria 14071
354 Ga0395899_0059451 3300037312 Bacteria 2818
355 Ga0395899_0349808 3300037312 Bacteria 989
356 Ga0395899_1014631 3300037312 Bacteria 500
357 Ga0395900_0015059 3300037418 Bacteria 7883
358 Ga0395900_0016596 3300037418 Bacteria 7510
359 Ga0395900_0094308 3300037418 Bacteria 3074
360 Ga0395900_0867582 3300037418 Bacteria 827
361 Ga0395898_0004598 3300037466 Bacteria 15063
362 Ga0395898_0062093 3300037466 Bacteria 3629
363 Ga0395898_0178271 3300037466 Bacteria 2031
364 Ga0395898_1129148 3300037466 Bacteria 716
365 Ga0395898_1198031 3300037466 Bacteria 691
366 Ga0395905_0011277 3300037471 Bacteria 8638
367 Ga0395905_0038521 3300037471 Bacteria 4487
368 Ga0395905_0326925 3300037471 Bacteria 1423
369 Ga0395905_0404774 3300037471 Bacteria 1260
370 Ga0395905_0640437 3300037471 Bacteria 965
371 Ga0436364_0707398 3300037853 Bacteria 771
372 Ga0436364_0752322 3300037853 Bacteria 1250
373 Ga0436364_1016261 3300037853 Bacteria 7562
374 Ga0436364_1038598 3300037853 Bacteria 1861
375 Ga0395901_0007686 3300038443 Bacteria 10875
376 Ga0395901_0029263 3300038443 Bacteria 5669
377 Ga0395901_0062654 3300038443 Bacteria 3870
378 Ga0395901_0169160 3300038443 Bacteria 2293
379 Ga0395901_0592852 3300038443 Bacteria 1118
380 Ga0436365_0714445 3300039437 Bacteria 7977
381 Ga0436365_1125982 3300039437 Bacteria 14552
382 Ga0436363_0699357 3300039450 Bacteria 591
383 Ga0436363_1098434 3300039450 Bacteria 1388
384 Ga0436363_1141298 3300039450 Bacteria 601
385 Ga0436363_1468400 3300039450 Bacteria 658
386 Ga0436362_0098660 3300039453 Bacteria 3230
387 Ga0436362_0391771 3300039453 Bacteria 674
388 Ga0436362_0857944 3300039453 Bacteria 1366
389 Ga0439453_0132568 3300041408 Bacteria 580
390 Ga0451800_0330475 3300041459 Bacteria 819
391 Ga0451807_2426203 3300041486 Bacteria 972
392 Ga0451833_0406180 3300041491 Bacteria 672
393 Ga0451853_1776019 3300041512 Bacteria 651
394 Ga0451853_1922546 3300041512 Bacteria 1608
395 Ga0439449_0058991 3300042007 Bacteria 1417
396 Ga0439454_002002 3300042011 Bacteria 2073
397 Ga0439434_0034967 3300042435 Bacteria 1535
398 Ga0466969_0126163 3300044656 Bacteria 1189
399 Ga0466968_0033282 3300044735 Bacteria 2148
400 Ga0466968_0303634 3300044735 Bacteria 768
401 Ga0466970_0378978 3300044765 Bacteria 805
402 Ga0466960_0000058 3300044901 Bacteria 36894
403 Ga0466967_0010170 3300045976 Bacteria 7037
404 Ga0466967_0184865 3300045976 Bacteria 1968
405 Ga0466967_0336047 3300045976 Bacteria 1460
406 Ga0495603_0037073 3300046455 Bacteria 2925
407 Ga0495629_0288218 3300046459 Unclassified 1126
408 Ga0495580_0074948 3300046472 Bacteria 2362
409 Ga0495582_0078774 3300046473 Bacteria 1828
410 Ga0495582_0404966 3300046473 Bacteria 787
411 Ga0495605_0121934 3300046474 Unclassified 1181
412 Ga0495639_0028748 3300046475 Bacteria 2463
413 Ga0495584_0045009 3300046491 Bacteria 2226
414 Ga0495584_0224995 3300046491 Bacteria 954
415 Ga0495594_0071871 3300046499 Bacteria 1924
416 Ga0495596_0167217 3300046500 Bacteria 855
417 Ga0495620_0242523 3300046515 Bacteria 688
418 Ga0495644_0096346 3300046523 Bacteria 1118
419 Ga0495663_0181088 3300046525 Bacteria 730
420 Ga0495652_0507906 3300046529 Bacteria 835
421 Ga0495665_0077748 3300046531 Bacteria 1746
422 Ga0495656_0095125 3300046615 Unclassified 1369
423 Ga0495656_0141376 3300046615 Bacteria 1155
424 Ga0495656_0253544 3300046615 Bacteria 890
425 Ga0495668_0044275 3300046616 Bacteria 2474
426 Ga0495611_0166379 3300046648 Bacteria 1031
427 Ga0495588_0251173 3300046674 Bacteria 932
428 Ga0495647_0297117 3300046681 Bacteria 727
429 Ga0495658_0310073 3300046683 Bacteria 999
430 Ga0495624_0846973 3300046690 Unclassified 539
431 Ga0495670_0185005 3300046691 Bacteria 1101
432 Ga0495670_0798809 3300046691 Bacteria 515
433 Ga0495671_0590823 3300046692 Unclassified 528
434 Ga0495589_0037555 3300046794 Bacteria 2427
435 Ga0495589_0070056 3300046794 Bacteria 1715
436 Ga0495581_0001162 3300047315 Bacteria 14417
437 Ga0495581_0009944 3300047315 Bacteria 5503
438 Ga0495636_0235667 3300047318 Bacteria 843
439 Ga0496100_0007236 3300048903 Bacteria 6104
440 Ga0496100_0561904 3300048903 Bacteria 883
441 Ga0496101_0005203 3300048904 Bacteria 8275
442 Ga0496101_0356154 3300048904 Bacteria 1150
443 Ga0496102_0032594 3300048905 Bacteria 4680
444 Ga0496102_0402672 3300048905 Bacteria 1286
445 Ga0496102_0698350 3300048905 Bacteria 937
446 Ga0496102_0848508 3300048905 Bacteria 836
447 Ga0496103_0002529 3300048906 Bacteria 11459
448 Ga0496103_0415977 3300048906 Bacteria 863
449 Ga0496103_0525948 3300048906 Bacteria 756
450 Ga0496104_0009729 3300048907 Bacteria 8570
451 Ga0496104_0076446 3300048907 Bacteria 3189
452 Ga0496105_0034204 3300048908 Bacteria 4179
453 Ga0496105_0038149 3300048908 Bacteria 3958
454 Ga0496106_0000909 3300048909 Bacteria 21550
455 Ga0496106_0160880 3300048909 Bacteria 1775
456 Ga0496107_0004852 3300048910 Bacteria 9134
457 Ga0496107_0085855 3300048910 Unclassified 2296
458 Ga0496107_0379209 3300048910 Bacteria 1052
459 Ga0496108_0119825 3300048911 Bacteria 2256
460 Ga0496109_0018035 3300048912 Bacteria 6195
461 Ga0496109_0093771 3300048912 Bacteria 2778
462 Ga0496109_0434985 3300048912 Bacteria 1239
463 Ga0496110_0104320 3300048913 Bacteria 2543
464 Ga0496110_0725224 3300048913 Bacteria 896
465 Ga0496111_0163642 3300048914 Bacteria 1652
466 Ga0496112_0013931 3300048915 Bacteria 7439
467 Ga0496112_0019479 3300048915 Bacteria 6406
468 Ga0496112_0039644 3300048915 Bacteria 4604
469 Ga0496113_0022294 3300048916 Bacteria 4477
470 Ga0496113_0241243 3300048916 Bacteria 1442
471 Ga0496113_0650853 3300048916 Bacteria 843
472 Ga0496114_0087925 3300048917 Bacteria 2635
473 Ga0496114_0146915 3300048917 Bacteria 2044
474 Ga0496115_0020181 3300048918 Bacteria 5137
475 Ga0496115_0032095 3300048918 Bacteria 4142
476 Ga0496115_0175650 3300048918 Archaea 1771
477 Ga0501031_0001473 3300049568 Bacteria 14623
478 Ga0501031_0208117 3300049568 Bacteria 1275
479 Ga0501031_0262173 3300049568 Bacteria 1123
480 Ga0501031_0531750 3300049568 Bacteria 758
481 Ga0501032_0044805 3300049569 Unclassified 2993
482 Ga0501032_0185424 3300049569 Bacteria 1361
483 Ga0501032_0521684 3300049569 Bacteria 758
484 Ga0501033_0015102 3300049570 Bacteria 5860
485 Ga0501033_0747400 3300049570 Bacteria 663
486 Ga0501034_0240224 3300049571 Bacteria 1758
487 Ga0501036_0012918 3300049572 Bacteria 6934
488 Ga0501036_0138340 3300049572 Bacteria 2055
489 Ga0501036_0522247 3300049572 Bacteria 987
490 Ga0501036_0578452 3300049572 Bacteria 932
491 Ga0501037_0036644 3300049573 Bacteria 3614
492 Ga0501038_0275907 3300049574 Bacteria 1324
493 Ga0501038_0414590 3300049574 Bacteria 1040
494 Ga0501039_0007983 3300049575 Bacteria 8064
495 Ga0501039_0016098 3300049575 Bacteria 5727
496 Ga0501039_0223241 3300049575 Bacteria 1481
497 Ga0501040_0054526 3300049576 Bacteria 2740
498 Ga0501040_0136175 3300049576 Bacteria 1729
499 Ga0501040_0323348 3300049576 Bacteria 1103
500 Ga0501041_0057263 3300049577 Bacteria 2383
501 Ga0501041_0137131 3300049577 Bacteria 1525
502 Ga0501042_0003275 3300049578 Bacteria 10133
503 Ga0501042_0053139 3300049578 Bacteria 2890
504 Ga0501042_0138830 3300049578 Bacteria 1752
505 Ga0501042_0270395 3300049578 Bacteria 1227
506 Ga0501042_0380820 3300049578 Bacteria 1021
507 Ga0501042_0427616 3300049578 Bacteria 960
508 Ga0501043_0028360 3300049579 Unclassified 4395
509 Ga0501043_1288493 3300049579 Bacteria 510
510 Ga0501046_0024599 3300049580 Bacteria 4938
511 Ga0501046_0134918 3300049580 Bacteria 1870
512 Ga0501048_0007617 3300049582 Bacteria 8206
513 Ga0501048_0040007 3300049582 Bacteria 3361
514 Ga0501048_0300875 3300049582 Bacteria 1141
515 Ga0501048_0438931 3300049582 Bacteria 934
516 Ga0501068_0000766 3300049584 Bacteria 16539
517 Ga0501069_0045868 3300049585 Bacteria 2422
518 Ga0501069_0175159 3300049585 Bacteria 1239
519 Ga0501069_0182271 3300049585 Bacteria 1214
520 Ga0501069_0869665 3300049585 Bacteria 548
521 Ga0501070_0274146 3300049586 Bacteria 1377
522 Ga0501070_0925048 3300049586 Bacteria 679
523 Ga0501071_0004551 3300049587 Bacteria 8800
524 Ga0501071_0007395 3300049587 Bacteria 7207
525 Ga0501071_0055963 3300049587 Bacteria 2848
526 Ga0501071_0660044 3300049587 Bacteria 805
527 Ga0501072_0030449 3300049588 Bacteria 4220
528 Ga0501072_0412256 3300049588 Bacteria 1071
529 Ga0501072_0978159 3300049588 Bacteria 660
530 Ga0501072_1313517 3300049588 Bacteria 560
531 Ga0501073_0105968 3300049589 Bacteria 1951
532 Ga0501074_0013240 3300049590 Bacteria 5997
533 Ga0501074_0170064 3300049590 Bacteria 1556
534 Ga0501075_0056996 3300049591 Bacteria 2941
535 Ga0501075_0099895 3300049591 Bacteria 2204
536 Ga0501075_0528637 3300049591 Bacteria 900
537 Ga0501076_0004230 3300049592 Bacteria 10157
538 Ga0501076_0033773 3300049592 Bacteria 3995
539 Ga0501076_0092938 3300049592 Bacteria 2427
540 Ga0501076_0545158 3300049592 Bacteria 956
541 Ga0501077_0020161 3300049593 Bacteria 4220
542 Ga0501077_0044358 3300049593 Bacteria 2825
543 Ga0501077_0336629 3300049593 Bacteria 962
544 Ga0501202_171630 3300049652 Bacteria 580
545 Ga0501223_071229 3300049663 Bacteria 687
546 Ga0501235_234708 3300049669 Bacteria 508
547 Ga0501257_065815 3300049686 Bacteria 921
548 Ga0501259_107939 3300049688 Bacteria 647
549 Ga0501079_0029292 3300049741 Bacteria 4227
550 Ga0501079_0208528 3300049741 Bacteria 1526
551 Ga0501079_0263073 3300049741 Bacteria 1348
552 Ga0501080_0016052 3300049742 Bacteria 6911
553 Ga0501080_0558963 3300049742 Bacteria 1019
554 Ga0501081_0001718 3300049743 Bacteria 13595
555 Ga0501081_0684424 3300049743 Bacteria 770
556 Ga0501081_1203661 3300049743 Bacteria 574
557 Ga0501083_0040859 3300049744 Bacteria 3147
558 Ga0501083_0989550 3300049744 Bacteria 547
559 Ga0501266_045054 3300049763 Bacteria 667
560 Ga0501276_040570 3300049773 Bacteria 517
561 Ga0501035_0172327 3300049822 Bacteria 1869
562 Ga0501044_0372235 3300049823 Bacteria 1345
563 Ga0501045_0002214 3300049824 Bacteria 13191
564 Ga0501045_0149719 3300049824 Bacteria 1736
565 Ga0501045_0276664 3300049824 Bacteria 1250
566 Ga0501045_0527821 3300049824 Bacteria 876
567 Ga0501045_0916836 3300049824 Bacteria 643
568 nmdc:mga00v17_207819_c1 3300050491 Bacteria 1266
569 nmdc:mga0yw44_371230_c1 3300050492 Bacteria 965
570 nmdc:mga0yw44_666724_c1 3300050492 Bacteria 707
571 nmdc:mga05p37_198700_c2 3300050507 Bacteria 1521
572 nmdc:mga05p37_19939_c1 3300050507 Bacteria 8113
573 nmdc:mga05p37_60531_c1 3300050507 Bacteria 4662
574 nmdc:mga05p37_906041_c1 3300050507 Bacteria 950
575 nmdc:mga09592_1625518_c1 3300050508 Bacteria 523
576 nmdc:mga09592_23642_c1 3300050508 Bacteria 5076
577 nmdc:mga09592_312603_c1 3300050508 Bacteria 1361
578 nmdc:mga09592_56633_c1 3300050508 Bacteria 3312
579 nmdc:mga09592_842321_c1 3300050508 Bacteria 774
580 nmdc:mga0qj67_17946_c1 3300050509 Bacteria 5388
581 nmdc:mga0qj67_281586_c1 3300050509 Bacteria 1348
582 nmdc:mga0qj67_819529_c1 3300050509 Bacteria 736
583 nmdc:mga06r32_101792_c1 3300050510 Bacteria 2819
584 nmdc:mga06r32_1488457_c1 3300050510 Bacteria 617
585 nmdc:mga06r32_513974_c1 3300050510 Bacteria 1174
586 nmdc:mga06r32_641850_c1 3300050510 Bacteria 1030
587 nmdc:mga08y16_117964_c1 3300050511 Bacteria 2762
588 nmdc:mga08y16_268118_c1 3300050511 Bacteria 1763
589 nmdc:mga08y16_506112_c1 3300050511 Bacteria 1226
590 nmdc:mga0n895_51209_c1 3300050512 Bacteria 4050
591 nmdc:mga0rr50_2139_c1 3300050513 Bacteria 11044
592 nmdc:mga0rr50_391137_c1 3300050513 Bacteria 1173
593 nmdc:mga08x19_325701_c1 3300050514 Bacteria 1070
594 nmdc:mga08x19_874641_c1 3300050514 Unclassified 638
595 nmdc:mga0a205_327430_c1 3300050515 Bacteria 1402
596 nmdc:mga0a205_403075_c1 3300050515 Bacteria 763
597 nmdc:mga0a205_85373_c1 3300050515 Bacteria 3048
598 Ga0501084_0067216 3300054114 Bacteria 3000
599 Ga0501084_0073618 3300054114 Bacteria 2861
600 Ga0501084_0226242 3300054114 Bacteria 1578
601 Ga0501084_0253537 3300054114 Bacteria 1485
602 Ga0501084_0444688 3300054114 Bacteria 1096
603 Ga0501082_0019758 3300060353 Bacteria 5810
604 Ga0501082_0030877 3300060353 Bacteria 4619
605 Ga0501082_0043028 3300060353 Bacteria 3893
606 Ga0501082_0194534 3300060353 Bacteria 1764
607 Ga0530510_0009763 3300061734 Bacteria 6735
608 Ga0530510_0177109 3300061734 Bacteria 1581
609 Ga0530510_0735265 3300061734 Bacteria 752
610 Ga0530510_0996351 3300061734 Bacteria 641
611 Ga0530510_1468568 3300061734 Bacteria 523

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10190481 rootH1_101904813 108
2 3300005458 Ga0070681_11272816 Ga0070681_112728161 108
3 3300013105 Ga0157369_10949951 Ga0157369_109499512 108
4 3300025885 Ga0207653_10230058 Ga0207653_102300582 108
5 3300005329 Ga0070683_101366247 Ga0070683_1013662471 110
6 3300006846 Ga0075430_100010106 Ga0075430_1000101062 110
7 3300006847 Ga0075431_101652827 Ga0075431_1016528272 110
8 3300006871 Ga0075434_102155128 Ga0075434_1021551281 110
9 3300006880 Ga0075429_100082653 Ga0075429_1000826532 110
10 3300009147 Ga0114129_10003650 Ga0114129_1000365015 110
11 3300025945 Ga0207679_11204156 Ga0207679_112041562 110
12 3300046515 Ga0495620_0242523 Ga0495620_0242523_228_560 110
13 3300046615 Ga0495656_0253544 Ga0495656_0253544_44_376 110
14 3300048916 Ga0496113_0650853 Ga0496113_0650853_152_484 110
15 3300049585 Ga0501069_0869665 Ga0501069_0869665_162_494 110
16 3300050492 nmdc:mga0yw44_371230_c1 nmdc:mga0yw44_371230_c1_312_644 110
17 3300003203 JGI25406J46586_10009455 JGI25406J46586_100094555 111
18 3300005439 Ga0070711_100121618 Ga0070711_1001216182 111
19 3300005985 Ga0081539_10000182 Ga0081539_1000018248 111
20 3300006048 Ga0075363_100864244 Ga0075363_1008642442 111
21 3300013296 Ga0157374_10884536 Ga0157374_108845362 111
22 3300039453 Ga0436362_0391771 Ga0436362_0391771_102_437 111
23 3300044656 Ga0466969_0126163 Ga0466969_0126163_540_875 111
24 3300050507 nmdc:mga05p37_60531_c1 nmdc:mga05p37_60531_c1_174_530 111
25 3300050508 nmdc:mga09592_56633_c1 nmdc:mga09592_56633_c1_1166_1522 111
26 3300050509 nmdc:mga0qj67_281586_c1 nmdc:mga0qj67_281586_c1_753_1109 111
27 3300050510 nmdc:mga06r32_1488457_c1 nmdc:mga06r32_1488457_c1_122_478 111
28 3300005435 Ga0070714_100659514 Ga0070714_1006595142 113
29 3300005719 Ga0068861_100574388 Ga0068861_1005743882 113
30 3300006028 Ga0070717_10321991 Ga0070717_103219913 113
31 3300006058 Ga0075432_10295522 Ga0075432_102955221 113
32 3300014326 Ga0157380_10344463 Ga0157380_103444632 113
33 3300025935 Ga0207709_10246390 Ga0207709_102463903 113
34 3300026067 Ga0207678_11466751 Ga0207678_114667512 113
35 3300027907 Ga0207428_10271472 Ga0207428_102714723 113
36 3300050491 nmdc:mga00v17_207819_c1 nmdc:mga00v17_207819_c1_227_577 113
37 3300005564 Ga0070664_102375906 Ga0070664_1023759062 114
38 3300005616 Ga0068852_102517537 Ga0068852_1025175371 114
39 3300006852 Ga0075433_10271070 Ga0075433_102710702 114
40 3300006871 Ga0075434_100095193 Ga0075434_1000951933 114
41 3300009148 Ga0105243_10435665 Ga0105243_104356653 114
42 3300009176 Ga0105242_10510983 Ga0105242_105109833 114
43 3300013296 Ga0157374_11441534 Ga0157374_114415342 114
44 3300014325 Ga0163163_11628181 Ga0163163_116281812 114
45 3300025918 Ga0207662_10409815 Ga0207662_104098152 114
46 3300025939 Ga0207665_10269231 Ga0207665_102692312 114
47 3300025972 Ga0207668_10002697 Ga0207668_1000269712 114
48 3300037466 Ga0395898_0178271 Ga0395898_0178271_383_733 114
49 3300037471 Ga0395905_0640437 Ga0395905_0640437_218_568 114
50 3300048906 Ga0496103_0525948 Ga0496103_0525948_327_671 114
51 3300048913 Ga0496110_0725224 Ga0496110_0725224_29_373 114
52 3300050511 nmdc:mga08y16_506112_c1 nmdc:mga08y16_506112_c1_153_497 114
53 3300005441 Ga0070700_101974727 Ga0070700_1019747271 115
54 3300005467 Ga0070706_100905568 Ga0070706_1009055682 115
55 3300005544 Ga0070686_100517855 Ga0070686_1005178552 115
56 3300005937 Ga0081455_10010177 Ga0081455_100101772 115
57 3300037312 Ga0395899_1014631 Ga0395899_1014631_75_422 115
58 3300037471 Ga0395905_0404774 Ga0395905_0404774_632_979 115
59 3300045976 Ga0466967_0184865 Ga0466967_0184865_902_1249 115
60 3300048905 Ga0496102_0848508 Ga0496102_0848508_299_652 115
61 3300050508 nmdc:mga09592_842321_c1 nmdc:mga09592_842321_c1_11_358 115
62 3300061734 Ga0530510_0996351 Ga0530510_0996351_179_526 115
63 3300005983 Ga0081540_1053311 Ga0081540_10533113 116
64 3300006852 Ga0075433_10971637 Ga0075433_109716372 116
65 3300009094 Ga0111539_10051458 Ga0111539_100514582 116
66 3300009098 Ga0105245_10549756 Ga0105245_105497562 116
67 3300009147 Ga0114129_10411171 Ga0114129_104111712 116
68 3300027907 Ga0207428_10115786 Ga0207428_101157864 116
69 3300031995 Ga0307409_100289504 Ga0307409_1002895043 116
70 3300035115 Ga0373941_0257234 Ga0373941_0257234_293_649 116
71 3300038443 Ga0395901_0062654 Ga0395901_0062654_3489_3839 116
72 3300044901 Ga0466960_0000058 Ga0466960_0000058_29813_30163 116
73 3300050507 nmdc:mga05p37_906041_c1 nmdc:mga05p37_906041_c1_93_443 116
74 3300050510 nmdc:mga06r32_641850_c1 nmdc:mga06r32_641850_c1_239_589 116
75 3300050511 nmdc:mga08y16_268118_c1 nmdc:mga08y16_268118_c1_1036_1386 116
76 3300050515 nmdc:mga0a205_403075_c1 nmdc:mga0a205_403075_c1_156_506 116
77 3300002155 JGI24033J26618_1011010 JGI24033J26618_10110102 117
78 3300002459 JGI24751J29686_10014242 JGI24751J29686_100142422 117
79 3300003373 JGI25407J50210_10004549 JGI25407J50210_100045491 117
80 3300005327 Ga0070658_10044365 Ga0070658_100443652 117
81 3300005330 Ga0070690_100392131 Ga0070690_1003921312 117
82 3300005331 Ga0070670_100019042 Ga0070670_1000190427 117
83 3300005336 Ga0070680_100142244 Ga0070680_1001422442 117
84 3300005337 Ga0070682_100109914 Ga0070682_1001099143 117
85 3300005338 Ga0068868_101411800 Ga0068868_1014118002 117
86 3300005339 Ga0070660_100025013 Ga0070660_1000250133 117
87 3300005340 Ga0070689_100106019 Ga0070689_1001060194 117
88 3300005340 Ga0070689_100429410 Ga0070689_1004294102 117
89 3300005344 Ga0070661_101169298 Ga0070661_1011692982 117
90 3300005355 Ga0070671_100032574 Ga0070671_1000325743 117
91 3300005364 Ga0070673_100243709 Ga0070673_1002437092 117
92 3300005364 Ga0070673_101376941 Ga0070673_1013769411 117
93 3300005434 Ga0070709_10175870 Ga0070709_101758703 117
94 3300005438 Ga0070701_10512761 Ga0070701_105127612 117
95 3300005438 Ga0070701_10823337 Ga0070701_108233371 117
96 3300005439 Ga0070711_100097858 Ga0070711_1000978583 117
97 3300005440 Ga0070705_101709909 Ga0070705_1017099092 117
98 3300005444 Ga0070694_100622624 Ga0070694_1006226242 117
99 3300005455 Ga0070663_101205913 Ga0070663_1012059131 117
100 3300005458 Ga0070681_10105938 Ga0070681_101059383 117
101 3300005458 Ga0070681_11111122 Ga0070681_111111222 117
102 3300005459 Ga0068867_100575674 Ga0068867_1005756742 117
103 3300005466 Ga0070685_10259135 Ga0070685_102591352 117
104 3300005468 Ga0070707_100145063 Ga0070707_1001450633 117
105 3300005468 Ga0070707_100562202 Ga0070707_1005622022 117
106 3300005518 Ga0070699_100866036 Ga0070699_1008660361 117
107 3300005535 Ga0070684_100520279 Ga0070684_1005202792 117
108 3300005543 Ga0070672_101165162 Ga0070672_1011651621 117
109 3300005544 Ga0070686_101847964 Ga0070686_1018479641 117
110 3300005546 Ga0070696_100454910 Ga0070696_1004549102 117
111 3300005547 Ga0070693_100127431 Ga0070693_1001274312 117
112 3300005547 Ga0070693_100231632 Ga0070693_1002316322 117
113 3300005563 Ga0068855_100360924 Ga0068855_1003609243 117
114 3300005563 Ga0068855_100577021 Ga0068855_1005770212 117
115 3300005577 Ga0068857_100048398 Ga0068857_1000483981 117
116 3300005614 Ga0068856_100003239 Ga0068856_10000323922 117
117 3300005617 Ga0068859_100042556 Ga0068859_1000425564 117
118 3300005617 Ga0068859_100104270 Ga0068859_1001042705 117
119 3300005618 Ga0068864_100100815 Ga0068864_1001008153 117
120 3300005618 Ga0068864_100449674 Ga0068864_1004496741 117
121 3300005618 Ga0068864_100838530 Ga0068864_1008385302 117
122 3300005840 Ga0068870_10013058 Ga0068870_100130583 117
123 3300005840 Ga0068870_10189885 Ga0068870_101898852 117
124 3300005842 Ga0068858_100013790 Ga0068858_1000137907 117
125 3300005842 Ga0068858_101074521 Ga0068858_1010745212 117
126 3300005843 Ga0068860_100761269 Ga0068860_1007612691 117
127 3300005844 Ga0068862_102124526 Ga0068862_1021245262 117
128 3300005937 Ga0081455_10017821 Ga0081455_100178218 117
129 3300005981 Ga0081538_10000669 Ga0081538_1000066927 117
130 3300005981 Ga0081538_10000902 Ga0081538_100009027 117
131 3300005981 Ga0081538_10018916 Ga0081538_100189164 117
132 3300005981 Ga0081538_10071257 Ga0081538_100712572 117
133 3300005981 Ga0081538_10338541 Ga0081538_103385411 117
134 3300006028 Ga0070717_10557221 Ga0070717_105572212 117
135 3300006038 Ga0075365_10576044 Ga0075365_105760442 117
136 3300006048 Ga0075363_100115916 Ga0075363_1001159162 117
137 3300006844 Ga0075428_100031225 Ga0075428_1000312252 117
138 3300006844 Ga0075428_100037399 Ga0075428_1000373993 117
139 3300006844 Ga0075428_101031814 Ga0075428_1010318142 117
140 3300006844 Ga0075428_102584971 Ga0075428_1025849711 117
141 3300006846 Ga0075430_100012632 Ga0075430_1000126327 117
142 3300006846 Ga0075430_100995234 Ga0075430_1009952341 117
143 3300006852 Ga0075433_10039711 Ga0075433_100397114 117
144 3300006871 Ga0075434_100032531 Ga0075434_1000325319 117
145 3300006880 Ga0075429_100007437 Ga0075429_1000074378 117
146 3300006880 Ga0075429_100764991 Ga0075429_1007649911 117
147 3300006881 Ga0068865_100513869 Ga0068865_1005138692 117
148 3300006914 Ga0075436_100436374 Ga0075436_1004363741 117
149 3300006931 Ga0097620_100042556 Ga0097620_1000425564 117
150 3300006931 Ga0097620_100104273 Ga0097620_1001042735 117
151 3300007076 Ga0075435_100000686 Ga0075435_1000006868 117
152 3300009094 Ga0111539_10032821 Ga0111539_1003282111 117
153 3300009147 Ga0114129_10029537 Ga0114129_1002953711 117
154 3300009147 Ga0114129_10112507 Ga0114129_101125077 117
155 3300009147 Ga0114129_10132970 Ga0114129_101329704 117
156 3300009147 Ga0114129_10213403 Ga0114129_102134032 117
157 3300009147 Ga0114129_10228966 Ga0114129_102289663 117
158 3300009176 Ga0105242_10178362 Ga0105242_101783623 117
159 3300009553 Ga0105249_11841946 Ga0105249_118419461 117
160 3300010159 Ga0099796_10327983 Ga0099796_103279831 117
161 3300010375 Ga0105239_10457207 Ga0105239_104572071 117
162 3300013102 Ga0157371_10203491 Ga0157371_102034912 117
163 3300013104 Ga0157370_10499069 Ga0157370_104990692 117
164 3300013105 Ga0157369_10432933 Ga0157369_104329332 117
165 3300013297 Ga0157378_10119289 Ga0157378_101192892 117
166 3300013306 Ga0163162_12408500 Ga0163162_124085002 117
167 3300014968 Ga0157379_10232720 Ga0157379_102327204 117
168 3300021358 Ga0213873_10158630 Ga0213873_101586302 117
169 3300021377 Ga0213874_10318892 Ga0213874_103188922 117
170 3300025321 Ga0207656_10153290 Ga0207656_101532902 117
171 3300025906 Ga0207699_10062124 Ga0207699_100621244 117
172 3300025908 Ga0207643_10013602 Ga0207643_100136023 117
173 3300025908 Ga0207643_10038160 Ga0207643_100381604 117
174 3300025912 Ga0207707_10243454 Ga0207707_102434542 117
175 3300025916 Ga0207663_10836654 Ga0207663_108366541 117
176 3300025918 Ga0207662_10015041 Ga0207662_100150413 117
177 3300025919 Ga0207657_10004070 Ga0207657_1000407010 117
178 3300025919 Ga0207657_10527901 Ga0207657_105279011 117
179 3300025921 Ga0207652_10198458 Ga0207652_101984581 117
180 3300025922 Ga0207646_10397036 Ga0207646_103970362 117
181 3300025924 Ga0207694_10767491 Ga0207694_107674912 117
182 3300025925 Ga0207650_10001896 Ga0207650_1000189611 117
183 3300025926 Ga0207659_10451226 Ga0207659_104512261 117
184 3300025927 Ga0207687_10187839 Ga0207687_101878393 117
185 3300025929 Ga0207664_10344571 Ga0207664_103445713 117
186 3300025931 Ga0207644_10237493 Ga0207644_102374933 117
187 3300025933 Ga0207706_10478987 Ga0207706_104789872 117
188 3300025936 Ga0207670_10147928 Ga0207670_101479283 117
189 3300025939 Ga0207665_10070580 Ga0207665_100705805 117
190 3300025940 Ga0207691_10214397 Ga0207691_102143972 117
191 3300025941 Ga0207711_10112790 Ga0207711_101127901 117
192 3300025944 Ga0207661_11253079 Ga0207661_112530791 117
193 3300025945 Ga0207679_11214763 Ga0207679_112147631 117
194 3300025949 Ga0207667_10819849 Ga0207667_108198492 117
195 3300025960 Ga0207651_10340993 Ga0207651_103409933 117
196 3300026023 Ga0207677_10183916 Ga0207677_101839162 117
197 3300026023 Ga0207677_10672395 Ga0207677_106723951 117
198 3300026067 Ga0207678_10583610 Ga0207678_105836102 117
199 3300026075 Ga0207708_10019855 Ga0207708_100198554 117
200 3300026089 Ga0207648_10239663 Ga0207648_102396632 117
201 3300026095 Ga0207676_10446478 Ga0207676_104464781 117
202 3300026095 Ga0207676_10787101 Ga0207676_107871012 117
203 3300026116 Ga0207674_10056049 Ga0207674_100560492 117
204 3300026121 Ga0207683_10019625 Ga0207683_100196254 117
205 3300028379 Ga0268266_10100293 Ga0268266_101002936 117
206 3300031548 Ga0307408_100011866 Ga0307408_1000118665 117
207 3300031548 Ga0307408_100117574 Ga0307408_1001175743 117
208 3300031731 Ga0307405_10038900 Ga0307405_100389004 117
209 3300031731 Ga0307405_10171833 Ga0307405_101718331 117
210 3300031731 Ga0307405_10298643 Ga0307405_102986432 117
211 3300031824 Ga0307413_10298435 Ga0307413_102984351 117
212 3300031852 Ga0307410_10193576 Ga0307410_101935762 117
213 3300031852 Ga0307410_10689919 Ga0307410_106899192 117
214 3300031901 Ga0307406_10059659 Ga0307406_100596594 117
215 3300031901 Ga0307406_10126140 Ga0307406_101261403 117
216 3300031901 Ga0307406_10928400 Ga0307406_109284002 117
217 3300031903 Ga0307407_10049644 Ga0307407_100496441 117
218 3300031903 Ga0307407_10178165 Ga0307407_101781652 117
219 3300031903 Ga0307407_10675217 Ga0307407_106752171 117
220 3300031911 Ga0307412_10062126 Ga0307412_100621265 117
221 3300031911 Ga0307412_10234836 Ga0307412_102348362 117
222 3300031995 Ga0307409_100093471 Ga0307409_1000934714 117
223 3300031995 Ga0307409_100399488 Ga0307409_1003994882 117
224 3300032002 Ga0307416_100030108 Ga0307416_1000301084 117
225 3300032002 Ga0307416_100044284 Ga0307416_1000442842 117
226 3300032002 Ga0307416_100078507 Ga0307416_1000785074 117
227 3300032002 Ga0307416_100550000 Ga0307416_1005500003 117
228 3300032004 Ga0307414_10170193 Ga0307414_101701931 117
229 3300032005 Ga0307411_10061143 Ga0307411_100611432 117
230 3300032005 Ga0307411_10683032 Ga0307411_106830322 117
231 3300032126 Ga0307415_100000180 Ga0307415_10000018023 117
232 3300032126 Ga0307415_100166071 Ga0307415_1001660713 117
233 3300032126 Ga0307415_101692482 Ga0307415_1016924822 117
234 3300034820 Ga0373959_0128829 Ga0373959_0128829_82_438 117
235 3300035116 Ga0373945_0122829 Ga0373945_0122829_321_674 117
236 3300035171 Ga0373946_0041328 Ga0373946_0041328_602_955 117
237 3300035692 Ga0373935_0417321 Ga0373935_0417321_442_795 117
238 3300037068 Ga0373925_0195437 Ga0373925_0195437_633_986 117
239 3300037312 Ga0395899_0002792 Ga0395899_0002792_36_389 117
240 3300037312 Ga0395899_0059451 Ga0395899_0059451_1772_2125 117
241 3300037312 Ga0395899_0349808 Ga0395899_0349808_555_908 117
242 3300037418 Ga0395900_0015059 Ga0395900_0015059_741_1094 117
243 3300037418 Ga0395900_0016596 Ga0395900_0016596_4760_5113 117
244 3300037418 Ga0395900_0094308 Ga0395900_0094308_840_1193 117
245 3300037418 Ga0395900_0867582 Ga0395900_0867582_62_415 117
246 3300037466 Ga0395898_0004598 Ga0395898_0004598_8042_8395 117
247 3300037466 Ga0395898_0062093 Ga0395898_0062093_1053_1406 117
248 3300037466 Ga0395898_1129148 Ga0395898_1129148_64_417 117
249 3300037471 Ga0395905_0011277 Ga0395905_0011277_8250_8603 117
250 3300037471 Ga0395905_0038521 Ga0395905_0038521_2398_2751 117
251 3300037471 Ga0395905_0326925 Ga0395905_0326925_86_439 117
252 3300037853 Ga0436364_0707398 Ga0436364_0707398_275_628 117
253 3300037853 Ga0436364_1016261 Ga0436364_1016261_39_392 117
254 3300037853 Ga0436364_1038598 Ga0436364_1038598_1120_1473 117
255 3300038443 Ga0395901_0007686 Ga0395901_0007686_10360_10713 117
256 3300038443 Ga0395901_0029263 Ga0395901_0029263_4477_4830 117
257 3300038443 Ga0395901_0169160 Ga0395901_0169160_1307_1660 117
258 3300038443 Ga0395901_0592852 Ga0395901_0592852_194_547 117
259 3300039437 Ga0436365_0714445 Ga0436365_0714445_7087_7440 117
260 3300039450 Ga0436363_0699357 Ga0436363_0699357_90_443 117
261 3300039450 Ga0436363_1098434 Ga0436363_1098434_876_1229 117
262 3300039450 Ga0436363_1141298 Ga0436363_1141298_56_412 117
263 3300039450 Ga0436363_1468400 Ga0436363_1468400_225_578 117
264 3300039453 Ga0436362_0098660 Ga0436362_0098660_155_508 117
265 3300039453 Ga0436362_0857944 Ga0436362_0857944_458_811 117
266 3300041408 Ga0439453_0132568 Ga0439453_0132568_207_560 117
267 3300041459 Ga0451800_0330475 Ga0451800_0330475_264_617 117
268 3300041486 Ga0451807_2426203 Ga0451807_2426203_554_907 117
269 3300041491 Ga0451833_0406180 Ga0451833_0406180_296_652 117
270 3300041512 Ga0451853_1922546 Ga0451853_1922546_775_1128 117
271 3300042011 Ga0439454_002002 Ga0439454_002002_639_992 117
272 3300044735 Ga0466968_0303634 Ga0466968_0303634_302_655 117
273 3300045976 Ga0466967_0336047 Ga0466967_0336047_16_369 117
274 3300046459 Ga0495629_0288218 Ga0495629_0288218_197_550 117
275 3300046472 Ga0495580_0074948 Ga0495580_0074948_457_810 117
276 3300046474 Ga0495605_0121934 Ga0495605_0121934_102_455 117
277 3300046475 Ga0495639_0028748 Ga0495639_0028748_835_1188 117
278 3300046491 Ga0495584_0045009 Ga0495584_0045009_205_558 117
279 3300046523 Ga0495644_0096346 Ga0495644_0096346_550_903 117
280 3300046525 Ga0495663_0181088 Ga0495663_0181088_313_666 117
281 3300046531 Ga0495665_0077748 Ga0495665_0077748_811_1164 117
282 3300046615 Ga0495656_0095125 Ga0495656_0095125_263_616 117
283 3300046616 Ga0495668_0044275 Ga0495668_0044275_1149_1502 117
284 3300046674 Ga0495588_0251173 Ga0495588_0251173_480_833 117
285 3300046690 Ga0495624_0846973 Ga0495624_0846973_73_426 117
286 3300046691 Ga0495670_0185005 Ga0495670_0185005_42_395 117
287 3300046691 Ga0495670_0798809 Ga0495670_0798809_29_382 117
288 3300046692 Ga0495671_0590823 Ga0495671_0590823_151_504 117
289 3300046794 Ga0495589_0037555 Ga0495589_0037555_1023_1376 117
290 3300047315 Ga0495581_0001162 Ga0495581_0001162_11238_11591 117
291 3300047318 Ga0495636_0235667 Ga0495636_0235667_163_516 117
292 3300048904 Ga0496101_0356154 Ga0496101_0356154_524_877 117
293 3300048905 Ga0496102_0402672 Ga0496102_0402672_253_606 117
294 3300048906 Ga0496103_0415977 Ga0496103_0415977_309_662 117
295 3300048910 Ga0496107_0379209 Ga0496107_0379209_475_828 117
296 3300048912 Ga0496109_0434985 Ga0496109_0434985_93_449 117
297 3300048915 Ga0496112_0039644 Ga0496112_0039644_4224_4580 117
298 3300048916 Ga0496113_0241243 Ga0496113_0241243_995_1348 117
299 3300048918 Ga0496115_0020181 Ga0496115_0020181_2665_3018 117
300 3300049568 Ga0501031_0001473 Ga0501031_0001473_11081_11434 117
301 3300049568 Ga0501031_0208117 Ga0501031_0208117_825_1178 117
302 3300049568 Ga0501031_0262173 Ga0501031_0262173_149_505 117
303 3300049568 Ga0501031_0531750 Ga0501031_0531750_332_685 117
304 3300049569 Ga0501032_0044805 Ga0501032_0044805_2619_2972 117
305 3300049569 Ga0501032_0185424 Ga0501032_0185424_838_1194 117
306 3300049570 Ga0501033_0015102 Ga0501033_0015102_4066_4419 117
307 3300049570 Ga0501033_0747400 Ga0501033_0747400_252_608 117
308 3300049571 Ga0501034_0240224 Ga0501034_0240224_1281_1634 117
309 3300049572 Ga0501036_0012918 Ga0501036_0012918_878_1234 117
310 3300049572 Ga0501036_0138340 Ga0501036_0138340_52_405 117
311 3300049572 Ga0501036_0578452 Ga0501036_0578452_483_836 117
312 3300049573 Ga0501037_0036644 Ga0501037_0036644_2095_2448 117
313 3300049574 Ga0501038_0275907 Ga0501038_0275907_781_1134 117
314 3300049574 Ga0501038_0414590 Ga0501038_0414590_63_419 117
315 3300049575 Ga0501039_0007983 Ga0501039_0007983_5236_5589 117
316 3300049575 Ga0501039_0223241 Ga0501039_0223241_626_979 117
317 3300049576 Ga0501040_0054526 Ga0501040_0054526_1803_2156 117
318 3300049577 Ga0501041_0057263 Ga0501041_0057263_1713_2066 117
319 3300049577 Ga0501041_0137131 Ga0501041_0137131_187_543 117
320 3300049578 Ga0501042_0003275 Ga0501042_0003275_7880_8233 117
321 3300049578 Ga0501042_0053139 Ga0501042_0053139_1815_2171 117
322 3300049578 Ga0501042_0138830 Ga0501042_0138830_1346_1699 117
323 3300049578 Ga0501042_0270395 Ga0501042_0270395_61_417 117
324 3300049578 Ga0501042_0427616 Ga0501042_0427616_27_380 117
325 3300049579 Ga0501043_0028360 Ga0501043_0028360_3994_4347 117
326 3300049580 Ga0501046_0024599 Ga0501046_0024599_3919_4272 117
327 3300049580 Ga0501046_0134918 Ga0501046_0134918_1240_1596 117
328 3300049582 Ga0501048_0007617 Ga0501048_0007617_2321_2674 117
329 3300049582 Ga0501048_0040007 Ga0501048_0040007_801_1154 117
330 3300049582 Ga0501048_0438931 Ga0501048_0438931_446_802 117
331 3300049584 Ga0501068_0000766 Ga0501068_0000766_10500_10853 117
332 3300049585 Ga0501069_0045868 Ga0501069_0045868_1815_2168 117
333 3300049585 Ga0501069_0175159 Ga0501069_0175159_240_596 117
334 3300049586 Ga0501070_0274146 Ga0501070_0274146_14_370 117
335 3300049586 Ga0501070_0925048 Ga0501070_0925048_93_446 117
336 3300049587 Ga0501071_0004551 Ga0501071_0004551_1980_2333 117
337 3300049587 Ga0501071_0007395 Ga0501071_0007395_1366_1719 117
338 3300049587 Ga0501071_0055963 Ga0501071_0055963_2111_2467 117
339 3300049587 Ga0501071_0660044 Ga0501071_0660044_254_607 117
340 3300049588 Ga0501072_0030449 Ga0501072_0030449_3184_3537 117
341 3300049588 Ga0501072_0978159 Ga0501072_0978159_30_386 117
342 3300049588 Ga0501072_1313517 Ga0501072_1313517_36_389 117
343 3300049589 Ga0501073_0105968 Ga0501073_0105968_670_1032 117
344 3300049590 Ga0501074_0013240 Ga0501074_0013240_4081_4434 117
345 3300049591 Ga0501075_0056996 Ga0501075_0056996_319_672 117
346 3300049591 Ga0501075_0528637 Ga0501075_0528637_98_451 117
347 3300049592 Ga0501076_0004230 Ga0501076_0004230_6828_7181 117
348 3300049592 Ga0501076_0092938 Ga0501076_0092938_1485_1838 117
349 3300049592 Ga0501076_0545158 Ga0501076_0545158_345_701 117
350 3300049593 Ga0501077_0020161 Ga0501077_0020161_3828_4181 117
351 3300049593 Ga0501077_0044358 Ga0501077_0044358_2259_2615 117
352 3300049652 Ga0501202_171630 Ga0501202_171630_207_563 117
353 3300049663 Ga0501223_071229 Ga0501223_071229_97_453 117
354 3300049669 Ga0501235_234708 Ga0501235_234708_23_376 117
355 3300049686 Ga0501257_065815 Ga0501257_065815_45_401 117
356 3300049688 Ga0501259_107939 Ga0501259_107939_19_375 117
357 3300049741 Ga0501079_0263073 Ga0501079_0263073_203_556 117
358 3300049742 Ga0501080_0016052 Ga0501080_0016052_1646_1999 117
359 3300049742 Ga0501080_0558963 Ga0501080_0558963_172_525 117
360 3300049743 Ga0501081_0001718 Ga0501081_0001718_654_1007 117
361 3300049743 Ga0501081_0684424 Ga0501081_0684424_337_690 117
362 3300049743 Ga0501081_1203661 Ga0501081_1203661_29_382 117
363 3300049744 Ga0501083_0040859 Ga0501083_0040859_2289_2642 117
364 3300049744 Ga0501083_0989550 Ga0501083_0989550_165_521 117
365 3300049763 Ga0501266_045054 Ga0501266_045054_206_562 117
366 3300049773 Ga0501276_040570 Ga0501276_040570_125_481 117
367 3300049822 Ga0501035_0172327 Ga0501035_0172327_179_532 117
368 3300049823 Ga0501044_0372235 Ga0501044_0372235_255_608 117
369 3300049824 Ga0501045_0002214 Ga0501045_0002214_811_1164 117
370 3300049824 Ga0501045_0149719 Ga0501045_0149719_51_407 117
371 3300049824 Ga0501045_0527821 Ga0501045_0527821_492_845 117
372 3300049824 Ga0501045_0916836 Ga0501045_0916836_30_386 117
373 3300050492 nmdc:mga0yw44_666724_c1 nmdc:mga0yw44_666724_c1_94_447 117
374 3300050507 nmdc:mga05p37_198700_c2 nmdc:mga05p37_198700_c2_185_541 117
375 3300050507 nmdc:mga05p37_19939_c1 nmdc:mga05p37_19939_c1_4256_4609 117
376 3300050508 nmdc:mga09592_1625518_c1 nmdc:mga09592_1625518_c1_31_384 117
377 3300050508 nmdc:mga09592_23642_c1 nmdc:mga09592_23642_c1_3022_3378 117
378 3300050508 nmdc:mga09592_312603_c1 nmdc:mga09592_312603_c1_794_1147 117
379 3300050509 nmdc:mga0qj67_17946_c1 nmdc:mga0qj67_17946_c1_4981_5337 117
380 3300050509 nmdc:mga0qj67_819529_c1 nmdc:mga0qj67_819529_c1_112_465 117
381 3300050510 nmdc:mga06r32_513974_c1 nmdc:mga06r32_513974_c1_810_1163 117
382 3300050511 nmdc:mga08y16_117964_c1 nmdc:mga08y16_117964_c1_1317_1673 117
383 3300050512 nmdc:mga0n895_51209_c1 nmdc:mga0n895_51209_c1_795_1157 117
384 3300050513 nmdc:mga0rr50_2139_c1 nmdc:mga0rr50_2139_c1_4835_5188 117
385 3300050513 nmdc:mga0rr50_391137_c1 nmdc:mga0rr50_391137_c1_534_890 117
386 3300050514 nmdc:mga08x19_325701_c1 nmdc:mga08x19_325701_c1_656_1009 117
387 3300050515 nmdc:mga0a205_327430_c1 nmdc:mga0a205_327430_c1_128_490 117
388 3300050515 nmdc:mga0a205_85373_c1 nmdc:mga0a205_85373_c1_1218_1571 117
389 3300054114 Ga0501084_0067216 Ga0501084_0067216_1399_1755 117
390 3300054114 Ga0501084_0226242 Ga0501084_0226242_622_975 117
391 3300054114 Ga0501084_0444688 Ga0501084_0444688_467_820 117
392 3300060353 Ga0501082_0019758 Ga0501082_0019758_11_367 117
393 3300060353 Ga0501082_0030877 Ga0501082_0030877_3435_3788 117
394 3300060353 Ga0501082_0043028 Ga0501082_0043028_1640_1993 117
395 3300060353 Ga0501082_0194534 Ga0501082_0194534_897_1250 117
396 3300061734 Ga0530510_0009763 Ga0530510_0009763_179_532 117
397 3300061734 Ga0530510_0177109 Ga0530510_0177109_992_1345 117
398 3300061734 Ga0530510_0735265 Ga0530510_0735265_24_377 117
399 3300061734 Ga0530510_1468568 Ga0530510_1468568_51_404 117
400 3300037466 Ga0395898_1198031 Ga0395898_1198031_245_601 118
401 3300048917 Ga0496114_0146915 Ga0496114_0146915_1341_1700 118
402 3300046473 Ga0495582_0404966 Ga0495582_0404966_73_432 119
403 3300046529 Ga0495652_0507906 Ga0495652_0507906_225_584 119
404 3300003203 JGI25406J46586_10008116 JGI25406J46586_100081165 120
405 3300005535 Ga0070684_100637232 Ga0070684_1006372322 120
406 3300005577 Ga0068857_101082183 Ga0068857_1010821832 120
407 3300005834 Ga0068851_10082842 Ga0068851_100828422 120
408 3300005985 Ga0081539_10044037 Ga0081539_100440373 120
409 3300006048 Ga0075363_100667823 Ga0075363_1006678232 120
410 3300006178 Ga0075367_10409214 Ga0075367_104092142 120
411 3300006847 Ga0075431_101198696 Ga0075431_1011986962 120
412 3300006881 Ga0068865_100171974 Ga0068865_1001719743 120
413 3300006914 Ga0075436_100632416 Ga0075436_1006324162 120
414 3300021384 Ga0213876_10001139 Ga0213876_1000113912 120
415 3300025911 Ga0207654_10290826 Ga0207654_102908262 120
416 3300025933 Ga0207706_10784245 Ga0207706_107842452 120
417 3300025961 Ga0207712_10102053 Ga0207712_101020533 120
418 3300026116 Ga0207674_10391228 Ga0207674_103912282 120
419 3300045976 Ga0466967_0010170 Ga0466967_0010170_3501_3863 120
420 3300050510 nmdc:mga06r32_101792_c1 nmdc:mga06r32_101792_c1_185_547 120
421 3300050514 nmdc:mga08x19_874641_c1 nmdc:mga08x19_874641_c1_31_393 120
422 3300005330 Ga0070690_100024361 Ga0070690_1000243614 121
423 3300005333 Ga0070677_10198061 Ga0070677_101980612 121
424 3300005336 Ga0070680_100101887 Ga0070680_1001018873 121
425 3300005338 Ga0068868_100028178 Ga0068868_1000281782 121
426 3300005340 Ga0070689_100033963 Ga0070689_1000339632 121
427 3300005341 Ga0070691_10064422 Ga0070691_100644223 121
428 3300005347 Ga0070668_100492240 Ga0070668_1004922401 121
429 3300005354 Ga0070675_100289112 Ga0070675_1002891123 121
430 3300005355 Ga0070671_100133610 Ga0070671_1001336103 121
431 3300005356 Ga0070674_100068560 Ga0070674_1000685603 121
432 3300005365 Ga0070688_100003853 Ga0070688_1000038538 121
433 3300005366 Ga0070659_100064082 Ga0070659_1000640822 121
434 3300005406 Ga0070703_10058086 Ga0070703_100580861 121
435 3300005439 Ga0070711_100003577 Ga0070711_10000357710 121
436 3300005440 Ga0070705_101125286 Ga0070705_1011252862 121
437 3300005441 Ga0070700_100001973 Ga0070700_1000019733 121
438 3300005444 Ga0070694_100364091 Ga0070694_1003640913 121
439 3300005455 Ga0070663_100001959 Ga0070663_1000019599 121
440 3300005518 Ga0070699_100371783 Ga0070699_1003717832 121
441 3300005530 Ga0070679_100453820 Ga0070679_1004538202 121
442 3300005544 Ga0070686_100007440 Ga0070686_1000074403 121
443 3300005547 Ga0070693_100023513 Ga0070693_1000235133 121
444 3300005549 Ga0070704_100159925 Ga0070704_1001599252 121
445 3300005563 Ga0068855_100868110 Ga0068855_1008681102 121
446 3300005614 Ga0068856_100064387 Ga0068856_1000643875 121
447 3300005615 Ga0070702_100023431 Ga0070702_1000234314 121
448 3300006163 Ga0070715_10030275 Ga0070715_100302753 121
449 3300006358 Ga0068871_100607464 Ga0068871_1006074642 121
450 3300009094 Ga0111539_11227807 Ga0111539_112278072 121
451 3300009098 Ga0105245_10050490 Ga0105245_100504904 121
452 3300009148 Ga0105243_10120018 Ga0105243_101200184 121
453 3300009176 Ga0105242_10003124 Ga0105242_100031246 121
454 3300009176 Ga0105242_11148627 Ga0105242_111486272 121
455 3300009177 Ga0105248_10899672 Ga0105248_108996722 121
456 3300009545 Ga0105237_10476973 Ga0105237_104769732 121
457 3300009553 Ga0105249_10267466 Ga0105249_102674662 121
458 3300013296 Ga0157374_10001932 Ga0157374_1000193210 121
459 3300013307 Ga0157372_11304122 Ga0157372_113041222 121
460 3300014326 Ga0157380_10017866 Ga0157380_100178663 121
461 3300014969 Ga0157376_10311674 Ga0157376_103116742 121
462 3300025885 Ga0207653_10030985 Ga0207653_100309852 121
463 3300025893 Ga0207682_10109060 Ga0207682_101090602 121
464 3300025898 Ga0207692_10142735 Ga0207692_101427352 121
465 3300025900 Ga0207710_10366555 Ga0207710_103665552 121
466 3300025939 Ga0207665_10609547 Ga0207665_106095472 121
467 3300025960 Ga0207651_10257702 Ga0207651_102577023 121
468 3300025961 Ga0207712_10047091 Ga0207712_100470912 121
469 3300025972 Ga0207668_12130873 Ga0207668_121308731 121
470 3300039437 Ga0436365_1125982 Ga0436365_1125982_3016_3384 121
471 3300041512 Ga0451853_1776019 Ga0451853_1776019_78_443 121
472 3300044735 Ga0466968_0033282 Ga0466968_0033282_232_597 121
473 3300044765 Ga0466970_0378978 Ga0466970_0378978_347_712 121
474 3300046455 Ga0495603_0037073 Ga0495603_0037073_1399_1764 121
475 3300046473 Ga0495582_0078774 Ga0495582_0078774_1384_1749 121
476 3300046491 Ga0495584_0224995 Ga0495584_0224995_102_467 121
477 3300046499 Ga0495594_0071871 Ga0495594_0071871_1178_1543 121
478 3300046615 Ga0495656_0141376 Ga0495656_0141376_177_542 121
479 3300046648 Ga0495611_0166379 Ga0495611_0166379_169_534 121
480 3300046681 Ga0495647_0297117 Ga0495647_0297117_71_436 121
481 3300046683 Ga0495658_0310073 Ga0495658_0310073_518_883 121
482 3300046794 Ga0495589_0070056 Ga0495589_0070056_160_525 121
483 3300047315 Ga0495581_0009944 Ga0495581_0009944_4221_4586 121
484 3300048903 Ga0496100_0007236 Ga0496100_0007236_5101_5466 121
485 3300048903 Ga0496100_0561904 Ga0496100_0561904_307_675 121
486 3300048904 Ga0496101_0005203 Ga0496101_0005203_7748_8113 121
487 3300048905 Ga0496102_0032594 Ga0496102_0032594_3392_3757 121
488 3300048905 Ga0496102_0698350 Ga0496102_0698350_421_789 121
489 3300048906 Ga0496103_0002529 Ga0496103_0002529_10586_10951 121
490 3300048907 Ga0496104_0009729 Ga0496104_0009729_7428_7793 121
491 3300048907 Ga0496104_0076446 Ga0496104_0076446_322_690 121
492 3300048908 Ga0496105_0034204 Ga0496105_0034204_3541_3909 121
493 3300048908 Ga0496105_0038149 Ga0496105_0038149_2315_2680 121
494 3300048909 Ga0496106_0000909 Ga0496106_0000909_8039_8404 121
495 3300048909 Ga0496106_0160880 Ga0496106_0160880_1267_1635 121
496 3300048910 Ga0496107_0004852 Ga0496107_0004852_6652_7017 121
497 3300048910 Ga0496107_0085855 Ga0496107_0085855_421_789 121
498 3300048911 Ga0496108_0119825 Ga0496108_0119825_361_726 121
499 3300048912 Ga0496109_0018035 Ga0496109_0018035_1255_1623 121
500 3300048912 Ga0496109_0093771 Ga0496109_0093771_857_1222 121
501 3300048913 Ga0496110_0104320 Ga0496110_0104320_1049_1417 121
502 3300048914 Ga0496111_0163642 Ga0496111_0163642_750_1118 121
503 3300048915 Ga0496112_0013931 Ga0496112_0013931_2638_3006 121
504 3300048915 Ga0496112_0019479 Ga0496112_0019479_968_1333 121
505 3300048916 Ga0496113_0022294 Ga0496113_0022294_2683_3051 121
506 3300048917 Ga0496114_0087925 Ga0496114_0087925_929_1294 121
507 3300048918 Ga0496115_0032095 Ga0496115_0032095_1127_1492 121
508 3300048918 Ga0496115_0175650 Ga0496115_0175650_582_950 121
509 3300049569 Ga0501032_0521684 Ga0501032_0521684_62_427 121
510 3300049572 Ga0501036_0522247 Ga0501036_0522247_284_652 121
511 3300049575 Ga0501039_0016098 Ga0501039_0016098_1184_1549 121
512 3300049576 Ga0501040_0136175 Ga0501040_0136175_18_383 121
513 3300049576 Ga0501040_0323348 Ga0501040_0323348_677_1045 121
514 3300049578 Ga0501042_0380820 Ga0501042_0380820_43_411 121
515 3300049579 Ga0501043_1288493 Ga0501043_1288493_97_480 121
516 3300049582 Ga0501048_0300875 Ga0501048_0300875_75_440 121
517 3300049585 Ga0501069_0182271 Ga0501069_0182271_236_601 121
518 3300049588 Ga0501072_0412256 Ga0501072_0412256_63_431 121
519 3300049590 Ga0501074_0170064 Ga0501074_0170064_238_606 121
520 3300049591 Ga0501075_0099895 Ga0501075_0099895_1224_1589 121
521 3300049592 Ga0501076_0033773 Ga0501076_0033773_2268_2636 121
522 3300049593 Ga0501077_0336629 Ga0501077_0336629_580_945 121
523 3300049741 Ga0501079_0029292 Ga0501079_0029292_645_1013 121
524 3300049741 Ga0501079_0208528 Ga0501079_0208528_468_833 121
525 3300049824 Ga0501045_0276664 Ga0501045_0276664_575_940 121
526 3300054114 Ga0501084_0073618 Ga0501084_0073618_341_706 121
527 3300010375 Ga0105239_12089734 Ga0105239_120897341 122
528 3300021388 Ga0213875_10038849 Ga0213875_100388491 122
529 3300037853 Ga0436364_0752322 Ga0436364_0752322_173_541 122
530 3300031731 Ga0307405_10145617 Ga0307405_101456172 123
531 3300032002 Ga0307416_100213536 Ga0307416_1002135363 123
532 3300009177 Ga0105248_10089177 Ga0105248_100891773 124
533 3300013307 Ga0157372_11380449 Ga0157372_113804492 124
534 3300013308 Ga0157375_10058096 Ga0157375_100580964 124
535 3300009174 Ga0105241_10480392 Ga0105241_104803922 126
536 3300025934 Ga0207686_10126001 Ga0207686_101260013 126
537 3300025936 Ga0207670_10194797 Ga0207670_101947972 126
538 3300026035 Ga0207703_10027981 Ga0207703_100279813 126
539 3300026089 Ga0207648_10042164 Ga0207648_100421642 126
540 3300054114 Ga0501084_0253537 Ga0501084_0253537_1072_1455 126
541 3300021358 Ga0213873_10061746 Ga0213873_100617461 127
542 3300002077 JGI24744J21845_10012886 JGI24744J21845_100128862 130
543 3300002244 JGI24742J22300_10016937 JGI24742J22300_100169373 130
544 3300005337 Ga0070682_100006239 Ga0070682_1000062393 130
545 3300005339 Ga0070660_100079968 Ga0070660_1000799683 130
546 3300005345 Ga0070692_10056496 Ga0070692_100564963 130
547 3300005367 Ga0070667_100150411 Ga0070667_1001504112 130
548 3300005434 Ga0070709_10155272 Ga0070709_101552722 130
549 3300005435 Ga0070714_101306624 Ga0070714_1013066241 130
550 3300005437 Ga0070710_10047971 Ga0070710_100479713 130
551 3300005438 Ga0070701_10000911 Ga0070701_100009116 130
552 3300005456 Ga0070678_100000298 Ga0070678_10000029829 130
553 3300005459 Ga0068867_100002281 Ga0068867_10000228115 130
554 3300005466 Ga0070685_10045060 Ga0070685_100450602 130
555 3300005539 Ga0068853_100085008 Ga0068853_1000850084 130
556 3300005546 Ga0070696_100033756 Ga0070696_1000337563 130
557 3300005616 Ga0068852_100002120 Ga0068852_10000212011 130
558 3300005617 Ga0068859_100061676 Ga0068859_1000616765 130
559 3300005718 Ga0068866_10014980 Ga0068866_100149803 130
560 3300006173 Ga0070716_100155765 Ga0070716_1001557653 130
561 3300006175 Ga0070712_100019749 Ga0070712_1000197495 130
562 3300006237 Ga0097621_100035448 Ga0097621_1000354483 130
563 3300006881 Ga0068865_100031672 Ga0068865_1000316723 130
564 3300006931 Ga0097620_100061679 Ga0097620_1000616795 130
565 3300009098 Ga0105245_10019026 Ga0105245_100190262 130
566 3300009148 Ga0105243_10002101 Ga0105243_1000210110 130
567 3300009174 Ga0105241_10019097 Ga0105241_100190976 130
568 3300009177 Ga0105248_10021005 Ga0105248_100210053 130
569 3300009545 Ga0105237_10736885 Ga0105237_107368852 130
570 3300009551 Ga0105238_10020762 Ga0105238_100207625 130
571 3300009553 Ga0105249_10002268 Ga0105249_1000226818 130
572 3300010375 Ga0105239_10061108 Ga0105239_100611085 130
573 3300013104 Ga0157370_11642959 Ga0157370_116429592 130
574 3300013297 Ga0157378_10002234 Ga0157378_100022342 130
575 3300013306 Ga0163162_10021305 Ga0163162_100213057 130
576 3300013308 Ga0157375_10081823 Ga0157375_100818233 130
577 3300014745 Ga0157377_10001693 Ga0157377_100016935 130
578 3300014969 Ga0157376_10005356 Ga0157376_100053569 130
579 3300025899 Ga0207642_10054953 Ga0207642_100549532 130
580 3300025901 Ga0207688_10140322 Ga0207688_101403221 130
581 3300025903 Ga0207680_10023379 Ga0207680_100233794 130
582 3300025906 Ga0207699_10046025 Ga0207699_100460253 130
583 3300025911 Ga0207654_10107294 Ga0207654_101072942 130
584 3300025915 Ga0207693_10007175 Ga0207693_1000717511 130
585 3300025916 Ga0207663_10033549 Ga0207663_100335492 130
586 3300025918 Ga0207662_10074295 Ga0207662_100742952 130
587 3300025919 Ga0207657_10042720 Ga0207657_100427203 130
588 3300025921 Ga0207652_10100193 Ga0207652_101001933 130
589 3300025926 Ga0207659_10841809 Ga0207659_108418091 130
590 3300025927 Ga0207687_10139571 Ga0207687_101395713 130
591 3300025931 Ga0207644_10394456 Ga0207644_103944562 130
592 3300025934 Ga0207686_10014856 Ga0207686_100148564 130
593 3300025936 Ga0207670_10327379 Ga0207670_103273792 130
594 3300025937 Ga0207669_10192844 Ga0207669_101928442 130
595 3300025938 Ga0207704_10089184 Ga0207704_100891843 130
596 3300025940 Ga0207691_10081295 Ga0207691_100812953 130
597 3300025941 Ga0207711_10027079 Ga0207711_100270796 130
598 3300025949 Ga0207667_10429702 Ga0207667_104297022 130
599 3300025986 Ga0207658_10165417 Ga0207658_101654173 130
600 3300026023 Ga0207677_10424595 Ga0207677_104245952 130
601 3300026041 Ga0207639_10382465 Ga0207639_103824652 130
602 3300026067 Ga0207678_10007751 Ga0207678_1000775111 130
603 3300026075 Ga0207708_10000352 Ga0207708_1000035241 130
604 3300026078 Ga0207702_10179997 Ga0207702_101799973 130
605 3300026089 Ga0207648_10033696 Ga0207648_100336963 130
606 3300026118 Ga0207675_100015239 Ga0207675_1000152393 130
607 3300026121 Ga0207683_10000598 Ga0207683_1000059824 130
608 3300028379 Ga0268266_10027679 Ga0268266_100276792 130
609 3300042007 Ga0439449_0058991 Ga0439449_0058991_131_526 130
610 3300042435 Ga0439434_0034967 Ga0439434_0034967_870_1265 130
611 3300046500 Ga0495596_0167217 Ga0495596_0167217_212_607 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

30

76

0.96

PF09339

HTH_IclR

IclR helix-turn-helix domain

35

78

0.96

PF12840

HTH_20

Helix-turn-helix domain

28

77

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9632 32 87
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9625 32 86
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9492 20 91
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9484 35 86
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9465 21 95
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9804 31 86 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9677 32 85 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9632 32 87 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9625 32 86 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9575 32 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2M7WM41-F1-model_v4 Transcriptional regulator 0.9808 20 92 GO:0003700
AF-A0A841HZ84-F1-model_v4 HTH arsR-type domain-containing protein 0.9735 20 93 GO:0003700
AF-A0A7H2BEU7-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9617 24 106 GO:0003700
AF-A0A0S8DZL8-F1-model_v4 HTH arsR-type domain-containing protein 0.9617 20 99 GO:0003700
AF-A0A6A7LP56-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9605 20 96 GO:0003700

Feature Viewer

pLDDT pTM Quality
86.76 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map