F469057
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 611 | 308 | 611 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10019026|Ga0105245_100190262 |
| Length | 131 |
| Sequence | LVLDIFLYRYMISGMARAATTADAFNAVAEPRRRLILDVLAGGERPVNDLVRELGLGQPQVSKHLRVLREVGAVEVRDHGRQRLYRLNGPALKPIHDWVKSYESLWSERFDQLDVVLDELKQKEEGDGSDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 119 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 203 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 208 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 282 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 285 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 291 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.31 |
| Nodule | 0 |
| Rhizoplane | 6.55 |
| Rhizosphere | 89.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10012886 | 3300002077 | Bacteria | 1689 |
| 2 | JGI24033J26618_1011010 | 3300002155 | Bacteria | 1073 |
| 3 | JGI24742J22300_10016937 | 3300002244 | Bacteria | 1231 |
| 4 | JGI24751J29686_10014242 | 3300002459 | Bacteria | 1642 |
| 5 | JGI25406J46586_10008116 | 3300003203 | Bacteria | 4766 |
| 6 | JGI25406J46586_10009455 | 3300003203 | Bacteria | 4365 |
| 7 | rootH1_10190481 | 3300003323 | Bacteria | 2054 |
| 8 | JGI25407J50210_10004549 | 3300003373 | Bacteria | 3376 |
| 9 | Ga0070658_10044365 | 3300005327 | Bacteria | 3594 |
| 10 | Ga0070683_101366247 | 3300005329 | Bacteria | 681 |
| 11 | Ga0070690_100024361 | 3300005330 | Bacteria | 3721 |
| 12 | Ga0070690_100392131 | 3300005330 | Bacteria | 1017 |
| 13 | Ga0070670_100019042 | 3300005331 | Bacteria | 5886 |
| 14 | Ga0070677_10198061 | 3300005333 | Bacteria | 967 |
| 15 | Ga0070680_100101887 | 3300005336 | Bacteria | 2384 |
| 16 | Ga0070680_100142244 | 3300005336 | Bacteria | 2012 |
| 17 | Ga0070682_100006239 | 3300005337 | Bacteria | 6685 |
| 18 | Ga0070682_100109914 | 3300005337 | Bacteria | 1835 |
| 19 | Ga0068868_100028178 | 3300005338 | Bacteria | 4292 |
| 20 | Ga0068868_101411800 | 3300005338 | Bacteria | 650 |
| 21 | Ga0070660_100025013 | 3300005339 | Bacteria | 4435 |
| 22 | Ga0070660_100079968 | 3300005339 | Bacteria | 2564 |
| 23 | Ga0070689_100033963 | 3300005340 | Bacteria | 3890 |
| 24 | Ga0070689_100106019 | 3300005340 | Bacteria | 2229 |
| 25 | Ga0070689_100429410 | 3300005340 | Bacteria | 1121 |
| 26 | Ga0070691_10064422 | 3300005341 | Bacteria | 1769 |
| 27 | Ga0070661_101169298 | 3300005344 | Unclassified | 643 |
| 28 | Ga0070692_10056496 | 3300005345 | Bacteria | 2055 |
| 29 | Ga0070668_100492240 | 3300005347 | Bacteria | 1060 |
| 30 | Ga0070675_100289112 | 3300005354 | Bacteria | 1442 |
| 31 | Ga0070671_100032574 | 3300005355 | Bacteria | 4308 |
| 32 | Ga0070671_100133610 | 3300005355 | Bacteria | 2091 |
| 33 | Ga0070674_100068560 | 3300005356 | Bacteria | 2499 |
| 34 | Ga0070673_100243709 | 3300005364 | Bacteria | 1564 |
| 35 | Ga0070673_101376941 | 3300005364 | Bacteria | 664 |
| 36 | Ga0070688_100003853 | 3300005365 | Bacteria | 7778 |
| 37 | Ga0070659_100064082 | 3300005366 | Bacteria | 2908 |
| 38 | Ga0070667_100150411 | 3300005367 | Bacteria | 2045 |
| 39 | Ga0070703_10058086 | 3300005406 | Unclassified | 1258 |
| 40 | Ga0070709_10155272 | 3300005434 | Bacteria | 1586 |
| 41 | Ga0070709_10175870 | 3300005434 | Bacteria | 1499 |
| 42 | Ga0070714_100659514 | 3300005435 | Bacteria | 1008 |
| 43 | Ga0070714_101306624 | 3300005435 | Unclassified | 708 |
| 44 | Ga0070710_10047971 | 3300005437 | Bacteria | 2384 |
| 45 | Ga0070701_10000911 | 3300005438 | Bacteria | 10702 |
| 46 | Ga0070701_10512761 | 3300005438 | Unclassified | 781 |
| 47 | Ga0070701_10823337 | 3300005438 | Bacteria | 635 |
| 48 | Ga0070711_100003577 | 3300005439 | Bacteria | 9064 |
| 49 | Ga0070711_100097858 | 3300005439 | Bacteria | 2129 |
| 50 | Ga0070711_100121618 | 3300005439 | Bacteria | 1932 |
| 51 | Ga0070705_101125286 | 3300005440 | Bacteria | 643 |
| 52 | Ga0070705_101709909 | 3300005440 | Bacteria | 532 |
| 53 | Ga0070700_100001973 | 3300005441 | Bacteria | 10413 |
| 54 | Ga0070700_101974727 | 3300005441 | Bacteria | 506 |
| 55 | Ga0070694_100364091 | 3300005444 | Bacteria | 1124 |
| 56 | Ga0070694_100622624 | 3300005444 | Bacteria | 871 |
| 57 | Ga0070663_100001959 | 3300005455 | Bacteria | 11500 |
| 58 | Ga0070663_101205913 | 3300005455 | Bacteria | 665 |
| 59 | Ga0070678_100000298 | 3300005456 | Bacteria | 23008 |
| 60 | Ga0070681_10105938 | 3300005458 | Bacteria | 2753 |
| 61 | Ga0070681_11111122 | 3300005458 | Bacteria | 711 |
| 62 | Ga0070681_11272816 | 3300005458 | Unclassified | 658 |
| 63 | Ga0068867_100002281 | 3300005459 | Bacteria | 13492 |
| 64 | Ga0068867_100575674 | 3300005459 | Unclassified | 979 |
| 65 | Ga0070685_10045060 | 3300005466 | Bacteria | 2527 |
| 66 | Ga0070685_10259135 | 3300005466 | Bacteria | 1156 |
| 67 | Ga0070706_100905568 | 3300005467 | Bacteria | 815 |
| 68 | Ga0070707_100145063 | 3300005468 | Bacteria | 2311 |
| 69 | Ga0070707_100562202 | 3300005468 | Bacteria | 1103 |
| 70 | Ga0070699_100371783 | 3300005518 | Bacteria | 1290 |
| 71 | Ga0070699_100866036 | 3300005518 | Bacteria | 827 |
| 72 | Ga0070679_100453820 | 3300005530 | Bacteria | 1226 |
| 73 | Ga0070684_100520279 | 3300005535 | Bacteria | 1103 |
| 74 | Ga0070684_100637232 | 3300005535 | Bacteria | 992 |
| 75 | Ga0068853_100085008 | 3300005539 | Bacteria | 2773 |
| 76 | Ga0070672_101165162 | 3300005543 | Bacteria | 686 |
| 77 | Ga0070686_100007440 | 3300005544 | Bacteria | 6112 |
| 78 | Ga0070686_100517855 | 3300005544 | Bacteria | 928 |
| 79 | Ga0070686_101847964 | 3300005544 | Bacteria | 515 |
| 80 | Ga0070696_100033756 | 3300005546 | Bacteria | 3518 |
| 81 | Ga0070696_100454910 | 3300005546 | Bacteria | 1011 |
| 82 | Ga0070693_100023513 | 3300005547 | Bacteria | 3295 |
| 83 | Ga0070693_100127431 | 3300005547 | Bacteria | 1587 |
| 84 | Ga0070693_100231632 | 3300005547 | Bacteria | 1216 |
| 85 | Ga0070704_100159925 | 3300005549 | Bacteria | 1780 |
| 86 | Ga0068855_100360924 | 3300005563 | Bacteria | 1598 |
| 87 | Ga0068855_100577021 | 3300005563 | Bacteria | 1215 |
| 88 | Ga0068855_100868110 | 3300005563 | Bacteria | 955 |
| 89 | Ga0070664_102375906 | 3300005564 | Bacteria | 503 |
| 90 | Ga0068857_100048398 | 3300005577 | Bacteria | 3775 |
| 91 | Ga0068857_101082183 | 3300005577 | Unclassified | 774 |
| 92 | Ga0068856_100003239 | 3300005614 | Bacteria | 16573 |
| 93 | Ga0068856_100064387 | 3300005614 | Bacteria | 3622 |
| 94 | Ga0070702_100023431 | 3300005615 | Bacteria | 3280 |
| 95 | Ga0068852_100002120 | 3300005616 | Bacteria | 13586 |
| 96 | Ga0068852_102517537 | 3300005616 | Bacteria | 535 |
| 97 | Ga0068859_100042556 | 3300005617 | Bacteria | 4563 |
| 98 | Ga0068859_100061676 | 3300005617 | Bacteria | 3779 |
| 99 | Ga0068859_100104270 | 3300005617 | Archaea | 2895 |
| 100 | Ga0068864_100100815 | 3300005618 | Bacteria | 2560 |
| 101 | Ga0068864_100449674 | 3300005618 | Bacteria | 1232 |
| 102 | Ga0068864_100838530 | 3300005618 | Bacteria | 905 |
| 103 | Ga0068866_10014980 | 3300005718 | Bacteria | 3436 |
| 104 | Ga0068861_100574388 | 3300005719 | Bacteria | 1031 |
| 105 | Ga0068851_10082842 | 3300005834 | Bacteria | 1678 |
| 106 | Ga0068870_10013058 | 3300005840 | Bacteria | 3893 |
| 107 | Ga0068870_10189885 | 3300005840 | Unclassified | 1239 |
| 108 | Ga0068858_100013790 | 3300005842 | Bacteria | 7629 |
| 109 | Ga0068858_101074521 | 3300005842 | Unclassified | 790 |
| 110 | Ga0068860_100761269 | 3300005843 | Bacteria | 980 |
| 111 | Ga0068862_102124526 | 3300005844 | Bacteria | 573 |
| 112 | Ga0081455_10010177 | 3300005937 | Bacteria | 9574 |
| 113 | Ga0081455_10017821 | 3300005937 | Bacteria | 6790 |
| 114 | Ga0081538_10000669 | 3300005981 | Bacteria | 37700 |
| 115 | Ga0081538_10000902 | 3300005981 | Bacteria | 32102 |
| 116 | Ga0081538_10018916 | 3300005981 | Bacteria | 5147 |
| 117 | Ga0081538_10071257 | 3300005981 | Bacteria | 1913 |
| 118 | Ga0081538_10338541 | 3300005981 | Bacteria | 546 |
| 119 | Ga0081540_1053311 | 3300005983 | Bacteria | 1984 |
| 120 | Ga0081539_10000182 | 3300005985 | Bacteria | 148133 |
| 121 | Ga0081539_10044037 | 3300005985 | Bacteria | 2580 |
| 122 | Ga0070717_10321991 | 3300006028 | Bacteria | 1378 |
| 123 | Ga0070717_10557221 | 3300006028 | Bacteria | 1038 |
| 124 | Ga0075365_10576044 | 3300006038 | Bacteria | 796 |
| 125 | Ga0075363_100115916 | 3300006048 | Archaea | 1492 |
| 126 | Ga0075363_100667823 | 3300006048 | Bacteria | 626 |
| 127 | Ga0075363_100864244 | 3300006048 | Unclassified | 552 |
| 128 | Ga0075432_10295522 | 3300006058 | Bacteria | 671 |
| 129 | Ga0070715_10030275 | 3300006163 | Bacteria | 2186 |
| 130 | Ga0070716_100155765 | 3300006173 | Bacteria | 1475 |
| 131 | Ga0070712_100019749 | 3300006175 | Bacteria | 4400 |
| 132 | Ga0075367_10409214 | 3300006178 | Bacteria | 858 |
| 133 | Ga0097621_100035448 | 3300006237 | Bacteria | 3987 |
| 134 | Ga0068871_100607464 | 3300006358 | Bacteria | 995 |
| 135 | Ga0075428_100031225 | 3300006844 | Bacteria | 5891 |
| 136 | Ga0075428_100037399 | 3300006844 | Bacteria | 5344 |
| 137 | Ga0075428_101031814 | 3300006844 | Bacteria | 870 |
| 138 | Ga0075428_102584971 | 3300006844 | Bacteria | 519 |
| 139 | Ga0075430_100010106 | 3300006846 | Bacteria | 7986 |
| 140 | Ga0075430_100012632 | 3300006846 | Bacteria | 7192 |
| 141 | Ga0075430_100995234 | 3300006846 | Bacteria | 691 |
| 142 | Ga0075431_101198696 | 3300006847 | Unclassified | 722 |
| 143 | Ga0075431_101652827 | 3300006847 | Bacteria | 598 |
| 144 | Ga0075433_10039711 | 3300006852 | Bacteria | 4071 |
| 145 | Ga0075433_10271070 | 3300006852 | Bacteria | 1504 |
| 146 | Ga0075433_10971637 | 3300006852 | Bacteria | 740 |
| 147 | Ga0075434_100032531 | 3300006871 | Bacteria | 5143 |
| 148 | Ga0075434_100095193 | 3300006871 | Bacteria | 2984 |
| 149 | Ga0075434_102155128 | 3300006871 | Bacteria | 562 |
| 150 | Ga0075429_100007437 | 3300006880 | Bacteria | 9505 |
| 151 | Ga0075429_100082653 | 3300006880 | Bacteria | 2799 |
| 152 | Ga0075429_100764991 | 3300006880 | Bacteria | 846 |
| 153 | Ga0068865_100031672 | 3300006881 | Bacteria | 3527 |
| 154 | Ga0068865_100171974 | 3300006881 | Bacteria | 1662 |
| 155 | Ga0068865_100513869 | 3300006881 | Bacteria | 1001 |
| 156 | Ga0075436_100436374 | 3300006914 | Bacteria | 952 |
| 157 | Ga0075436_100632416 | 3300006914 | Bacteria | 790 |
| 158 | Ga0097620_100042556 | 3300006931 | Bacteria | 4563 |
| 159 | Ga0097620_100061679 | 3300006931 | Bacteria | 3779 |
| 160 | Ga0097620_100104273 | 3300006931 | Archaea | 2895 |
| 161 | Ga0075435_100000686 | 3300007076 | Bacteria | 20987 |
| 162 | Ga0111539_10032821 | 3300009094 | Bacteria | 6304 |
| 163 | Ga0111539_10051458 | 3300009094 | Bacteria | 4905 |
| 164 | Ga0111539_11227807 | 3300009094 | Bacteria | 870 |
| 165 | Ga0105245_10019026 | 3300009098 | Bacteria | 6011 |
| 166 | Ga0105245_10050490 | 3300009098 | Bacteria | 3728 |
| 167 | Ga0105245_10549756 | 3300009098 | Bacteria | 1176 |
| 168 | Ga0114129_10003650 | 3300009147 | Bacteria | 21650 |
| 169 | Ga0114129_10029537 | 3300009147 | Bacteria | 7763 |
| 170 | Ga0114129_10112507 | 3300009147 | Bacteria | 3754 |
| 171 | Ga0114129_10132970 | 3300009147 | Bacteria | 3415 |
| 172 | Ga0114129_10213403 | 3300009147 | Bacteria | 2608 |
| 173 | Ga0114129_10228966 | 3300009147 | Bacteria | 2504 |
| 174 | Ga0114129_10411171 | 3300009147 | Bacteria | 1781 |
| 175 | Ga0105243_10002101 | 3300009148 | Bacteria | 16849 |
| 176 | Ga0105243_10120018 | 3300009148 | Archaea | 2215 |
| 177 | Ga0105243_10435665 | 3300009148 | Bacteria | 1226 |
| 178 | Ga0105241_10019097 | 3300009174 | Bacteria | 5055 |
| 179 | Ga0105241_10480392 | 3300009174 | Bacteria | 1104 |
| 180 | Ga0105242_10003124 | 3300009176 | Bacteria | 12921 |
| 181 | Ga0105242_10178362 | 3300009176 | Unclassified | 1872 |
| 182 | Ga0105242_10510983 | 3300009176 | Bacteria | 1144 |
| 183 | Ga0105242_11148627 | 3300009176 | Bacteria | 793 |
| 184 | Ga0105248_10021005 | 3300009177 | Bacteria | 7235 |
| 185 | Ga0105248_10089177 | 3300009177 | Bacteria | 3471 |
| 186 | Ga0105248_10899672 | 3300009177 | Bacteria | 999 |
| 187 | Ga0105237_10476973 | 3300009545 | Bacteria | 1254 |
| 188 | Ga0105237_10736885 | 3300009545 | Bacteria | 992 |
| 189 | Ga0105238_10020762 | 3300009551 | Bacteria | 6688 |
| 190 | Ga0105249_10002268 | 3300009553 | Bacteria | 16680 |
| 191 | Ga0105249_10267466 | 3300009553 | Bacteria | 1702 |
| 192 | Ga0105249_11841946 | 3300009553 | Bacteria | 678 |
| 193 | Ga0099796_10327983 | 3300010159 | Bacteria | 655 |
| 194 | Ga0105239_10061108 | 3300010375 | Bacteria | 4135 |
| 195 | Ga0105239_10457207 | 3300010375 | Bacteria | 1449 |
| 196 | Ga0105239_12089734 | 3300010375 | Bacteria | 658 |
| 197 | Ga0157371_10203491 | 3300013102 | Bacteria | 1420 |
| 198 | Ga0157370_10499069 | 3300013104 | Bacteria | 1118 |
| 199 | Ga0157370_11642959 | 3300013104 | Unclassified | 577 |
| 200 | Ga0157369_10432933 | 3300013105 | Bacteria | 1363 |
| 201 | Ga0157369_10949951 | 3300013105 | Unclassified | 881 |
| 202 | Ga0157374_10001932 | 3300013296 | Bacteria | 17377 |
| 203 | Ga0157374_10884536 | 3300013296 | Bacteria | 911 |
| 204 | Ga0157374_11441534 | 3300013296 | Bacteria | 712 |
| 205 | Ga0157378_10002234 | 3300013297 | Bacteria | 17171 |
| 206 | Ga0157378_10119289 | 3300013297 | Bacteria | 2429 |
| 207 | Ga0163162_10021305 | 3300013306 | Bacteria | 6381 |
| 208 | Ga0163162_12408500 | 3300013306 | Unclassified | 605 |
| 209 | Ga0157372_11304122 | 3300013307 | Bacteria | 838 |
| 210 | Ga0157372_11380449 | 3300013307 | Bacteria | 812 |
| 211 | Ga0157375_10058096 | 3300013308 | Bacteria | 3826 |
| 212 | Ga0157375_10081823 | 3300013308 | Bacteria | 3270 |
| 213 | Ga0163163_11628181 | 3300014325 | Bacteria | 706 |
| 214 | Ga0157380_10017866 | 3300014326 | Bacteria | 5257 |
| 215 | Ga0157380_10344463 | 3300014326 | Bacteria | 1392 |
| 216 | Ga0157377_10001693 | 3300014745 | Bacteria | 9609 |
| 217 | Ga0157379_10232720 | 3300014968 | Bacteria | 1670 |
| 218 | Ga0157376_10005356 | 3300014969 | Bacteria | 8964 |
| 219 | Ga0157376_10311674 | 3300014969 | Bacteria | 1493 |
| 220 | Ga0213873_10061746 | 3300021358 | Bacteria | 1016 |
| 221 | Ga0213873_10158630 | 3300021358 | Bacteria | 684 |
| 222 | Ga0213874_10318892 | 3300021377 | Bacteria | 589 |
| 223 | Ga0213876_10001139 | 3300021384 | Bacteria | 16937 |
| 224 | Ga0213875_10038849 | 3300021388 | Bacteria | 2243 |
| 225 | Ga0207656_10153290 | 3300025321 | Bacteria | 1093 |
| 226 | Ga0207653_10030985 | 3300025885 | Bacteria | 1727 |
| 227 | Ga0207653_10230058 | 3300025885 | Bacteria | 706 |
| 228 | Ga0207682_10109060 | 3300025893 | Bacteria | 1217 |
| 229 | Ga0207692_10142735 | 3300025898 | Bacteria | 1363 |
| 230 | Ga0207642_10054953 | 3300025899 | Bacteria | 1818 |
| 231 | Ga0207710_10366555 | 3300025900 | Bacteria | 736 |
| 232 | Ga0207688_10140322 | 3300025901 | Bacteria | 1422 |
| 233 | Ga0207680_10023379 | 3300025903 | Bacteria | 3374 |
| 234 | Ga0207699_10046025 | 3300025906 | Bacteria | 2549 |
| 235 | Ga0207699_10062124 | 3300025906 | Bacteria | 2251 |
| 236 | Ga0207643_10013602 | 3300025908 | Bacteria | 4409 |
| 237 | Ga0207643_10038160 | 3300025908 | Bacteria | 2698 |
| 238 | Ga0207654_10107294 | 3300025911 | Bacteria | 1731 |
| 239 | Ga0207654_10290826 | 3300025911 | Bacteria | 1108 |
| 240 | Ga0207707_10243454 | 3300025912 | Unclassified | 1563 |
| 241 | Ga0207693_10007175 | 3300025915 | Bacteria | 9179 |
| 242 | Ga0207663_10033549 | 3300025916 | Bacteria | 3059 |
| 243 | Ga0207663_10836654 | 3300025916 | Bacteria | 734 |
| 244 | Ga0207662_10015041 | 3300025918 | Bacteria | 4347 |
| 245 | Ga0207662_10074295 | 3300025918 | Bacteria | 2063 |
| 246 | Ga0207662_10409815 | 3300025918 | Bacteria | 921 |
| 247 | Ga0207657_10004070 | 3300025919 | Bacteria | 15518 |
| 248 | Ga0207657_10042720 | 3300025919 | Bacteria | 3997 |
| 249 | Ga0207657_10527901 | 3300025919 | Bacteria | 923 |
| 250 | Ga0207652_10100193 | 3300025921 | Bacteria | 2557 |
| 251 | Ga0207652_10198458 | 3300025921 | Bacteria | 1806 |
| 252 | Ga0207646_10397036 | 3300025922 | Bacteria | 1246 |
| 253 | Ga0207694_10767491 | 3300025924 | Bacteria | 814 |
| 254 | Ga0207650_10001896 | 3300025925 | Bacteria | 14752 |
| 255 | Ga0207659_10451226 | 3300025926 | Bacteria | 1083 |
| 256 | Ga0207659_10841809 | 3300025926 | Bacteria | 788 |
| 257 | Ga0207687_10139571 | 3300025927 | Bacteria | 1837 |
| 258 | Ga0207687_10187839 | 3300025927 | Bacteria | 1606 |
| 259 | Ga0207664_10344571 | 3300025929 | Unclassified | 1318 |
| 260 | Ga0207644_10237493 | 3300025931 | Bacteria | 1450 |
| 261 | Ga0207644_10394456 | 3300025931 | Bacteria | 1130 |
| 262 | Ga0207706_10478987 | 3300025933 | Bacteria | 1075 |
| 263 | Ga0207706_10784245 | 3300025933 | Bacteria | 810 |
| 264 | Ga0207686_10014856 | 3300025934 | Bacteria | 4346 |
| 265 | Ga0207686_10126001 | 3300025934 | Bacteria | 1750 |
| 266 | Ga0207709_10246390 | 3300025935 | Bacteria | 1303 |
| 267 | Ga0207670_10147928 | 3300025936 | Bacteria | 1739 |
| 268 | Ga0207670_10194797 | 3300025936 | Bacteria | 1536 |
| 269 | Ga0207670_10327379 | 3300025936 | Bacteria | 1207 |
| 270 | Ga0207669_10192844 | 3300025937 | Bacteria | 1471 |
| 271 | Ga0207704_10089184 | 3300025938 | Bacteria | 2020 |
| 272 | Ga0207665_10070580 | 3300025939 | Bacteria | 2384 |
| 273 | Ga0207665_10269231 | 3300025939 | Bacteria | 1264 |
| 274 | Ga0207665_10609547 | 3300025939 | Bacteria | 853 |
| 275 | Ga0207691_10081295 | 3300025940 | Bacteria | 2913 |
| 276 | Ga0207691_10214397 | 3300025940 | Bacteria | 1671 |
| 277 | Ga0207711_10027079 | 3300025941 | Bacteria | 4813 |
| 278 | Ga0207711_10112790 | 3300025941 | Archaea | 2420 |
| 279 | Ga0207661_11253079 | 3300025944 | Bacteria | 682 |
| 280 | Ga0207679_11204156 | 3300025945 | Bacteria | 695 |
| 281 | Ga0207679_11214763 | 3300025945 | Bacteria | 692 |
| 282 | Ga0207667_10429702 | 3300025949 | Bacteria | 1343 |
| 283 | Ga0207667_10819849 | 3300025949 | Bacteria | 926 |
| 284 | Ga0207651_10257702 | 3300025960 | Bacteria | 1430 |
| 285 | Ga0207651_10340993 | 3300025960 | Bacteria | 1259 |
| 286 | Ga0207712_10047091 | 3300025961 | Bacteria | 2992 |
| 287 | Ga0207712_10102053 | 3300025961 | Bacteria | 2135 |
| 288 | Ga0207668_10002697 | 3300025972 | Bacteria | 10384 |
| 289 | Ga0207668_12130873 | 3300025972 | Bacteria | 505 |
| 290 | Ga0207658_10165417 | 3300025986 | Bacteria | 1817 |
| 291 | Ga0207677_10183916 | 3300026023 | Unclassified | 1646 |
| 292 | Ga0207677_10424595 | 3300026023 | Bacteria | 1133 |
| 293 | Ga0207677_10672395 | 3300026023 | Bacteria | 916 |
| 294 | Ga0207703_10027981 | 3300026035 | Bacteria | 4439 |
| 295 | Ga0207639_10382465 | 3300026041 | Bacteria | 1264 |
| 296 | Ga0207678_10007751 | 3300026067 | Bacteria | 9486 |
| 297 | Ga0207678_10583610 | 3300026067 | Bacteria | 979 |
| 298 | Ga0207678_11466751 | 3300026067 | Bacteria | 603 |
| 299 | Ga0207708_10000352 | 3300026075 | Bacteria | 36059 |
| 300 | Ga0207708_10019855 | 3300026075 | Bacteria | 5066 |
| 301 | Ga0207702_10179997 | 3300026078 | Bacteria | 1946 |
| 302 | Ga0207648_10033696 | 3300026089 | Bacteria | 4517 |
| 303 | Ga0207648_10042164 | 3300026089 | Bacteria | 4007 |
| 304 | Ga0207648_10239663 | 3300026089 | Bacteria | 1615 |
| 305 | Ga0207676_10446478 | 3300026095 | Archaea | 1218 |
| 306 | Ga0207676_10787101 | 3300026095 | Bacteria | 927 |
| 307 | Ga0207674_10056049 | 3300026116 | Bacteria | 4004 |
| 308 | Ga0207674_10391228 | 3300026116 | Bacteria | 1344 |
| 309 | Ga0207675_100015239 | 3300026118 | Bacteria | 7171 |
| 310 | Ga0207683_10000598 | 3300026121 | Bacteria | 33267 |
| 311 | Ga0207683_10019625 | 3300026121 | Bacteria | 5776 |
| 312 | Ga0207428_10115786 | 3300027907 | Bacteria | 2059 |
| 313 | Ga0207428_10271472 | 3300027907 | Bacteria | 1261 |
| 314 | Ga0268266_10027679 | 3300028379 | Bacteria | 4820 |
| 315 | Ga0268266_10100293 | 3300028379 | Bacteria | 2551 |
| 316 | Ga0307408_100011866 | 3300031548 | Bacteria | 5765 |
| 317 | Ga0307408_100117574 | 3300031548 | Bacteria | 2054 |
| 318 | Ga0307405_10038900 | 3300031731 | Bacteria | 2871 |
| 319 | Ga0307405_10145617 | 3300031731 | Bacteria | 1659 |
| 320 | Ga0307405_10171833 | 3300031731 | Bacteria | 1547 |
| 321 | Ga0307405_10298643 | 3300031731 | Bacteria | 1221 |
| 322 | Ga0307413_10298435 | 3300031824 | Bacteria | 1221 |
| 323 | Ga0307410_10193576 | 3300031852 | Bacteria | 1548 |
| 324 | Ga0307410_10689919 | 3300031852 | Bacteria | 860 |
| 325 | Ga0307406_10059659 | 3300031901 | Bacteria | 2457 |
| 326 | Ga0307406_10126140 | 3300031901 | Bacteria | 1789 |
| 327 | Ga0307406_10928400 | 3300031901 | Bacteria | 743 |
| 328 | Ga0307407_10049644 | 3300031903 | Bacteria | 2396 |
| 329 | Ga0307407_10178165 | 3300031903 | Bacteria | 1406 |
| 330 | Ga0307407_10675217 | 3300031903 | Bacteria | 776 |
| 331 | Ga0307412_10062126 | 3300031911 | Bacteria | 2514 |
| 332 | Ga0307412_10234836 | 3300031911 | Bacteria | 1414 |
| 333 | Ga0307409_100093471 | 3300031995 | Bacteria | 2471 |
| 334 | Ga0307409_100289504 | 3300031995 | Bacteria | 1518 |
| 335 | Ga0307409_100399488 | 3300031995 | Bacteria | 1312 |
| 336 | Ga0307416_100030108 | 3300032002 | Bacteria | 4069 |
| 337 | Ga0307416_100044284 | 3300032002 | Bacteria | 3493 |
| 338 | Ga0307416_100078507 | 3300032002 | Unclassified | 2778 |
| 339 | Ga0307416_100213536 | 3300032002 | Bacteria | 1843 |
| 340 | Ga0307416_100550000 | 3300032002 | Bacteria | 1227 |
| 341 | Ga0307414_10170193 | 3300032004 | Bacteria | 1741 |
| 342 | Ga0307411_10061143 | 3300032005 | Bacteria | 2506 |
| 343 | Ga0307411_10683032 | 3300032005 | Bacteria | 892 |
| 344 | Ga0307415_100000180 | 3300032126 | Bacteria | 28325 |
| 345 | Ga0307415_100166071 | 3300032126 | Bacteria | 1716 |
| 346 | Ga0307415_101692482 | 3300032126 | Bacteria | 610 |
| 347 | Ga0373959_0128829 | 3300034820 | Bacteria | 625 |
| 348 | Ga0373941_0257234 | 3300035115 | Bacteria | 684 |
| 349 | Ga0373945_0122829 | 3300035116 | Bacteria | 1034 |
| 350 | Ga0373946_0041328 | 3300035171 | Bacteria | 1891 |
| 351 | Ga0373935_0417321 | 3300035692 | Bacteria | 966 |
| 352 | Ga0373925_0195437 | 3300037068 | Bacteria | 1607 |
| 353 | Ga0395899_0002792 | 3300037312 | Bacteria | 14071 |
| 354 | Ga0395899_0059451 | 3300037312 | Bacteria | 2818 |
| 355 | Ga0395899_0349808 | 3300037312 | Bacteria | 989 |
| 356 | Ga0395899_1014631 | 3300037312 | Bacteria | 500 |
| 357 | Ga0395900_0015059 | 3300037418 | Bacteria | 7883 |
| 358 | Ga0395900_0016596 | 3300037418 | Bacteria | 7510 |
| 359 | Ga0395900_0094308 | 3300037418 | Bacteria | 3074 |
| 360 | Ga0395900_0867582 | 3300037418 | Bacteria | 827 |
| 361 | Ga0395898_0004598 | 3300037466 | Bacteria | 15063 |
| 362 | Ga0395898_0062093 | 3300037466 | Bacteria | 3629 |
| 363 | Ga0395898_0178271 | 3300037466 | Bacteria | 2031 |
| 364 | Ga0395898_1129148 | 3300037466 | Bacteria | 716 |
| 365 | Ga0395898_1198031 | 3300037466 | Bacteria | 691 |
| 366 | Ga0395905_0011277 | 3300037471 | Bacteria | 8638 |
| 367 | Ga0395905_0038521 | 3300037471 | Bacteria | 4487 |
| 368 | Ga0395905_0326925 | 3300037471 | Bacteria | 1423 |
| 369 | Ga0395905_0404774 | 3300037471 | Bacteria | 1260 |
| 370 | Ga0395905_0640437 | 3300037471 | Bacteria | 965 |
| 371 | Ga0436364_0707398 | 3300037853 | Bacteria | 771 |
| 372 | Ga0436364_0752322 | 3300037853 | Bacteria | 1250 |
| 373 | Ga0436364_1016261 | 3300037853 | Bacteria | 7562 |
| 374 | Ga0436364_1038598 | 3300037853 | Bacteria | 1861 |
| 375 | Ga0395901_0007686 | 3300038443 | Bacteria | 10875 |
| 376 | Ga0395901_0029263 | 3300038443 | Bacteria | 5669 |
| 377 | Ga0395901_0062654 | 3300038443 | Bacteria | 3870 |
| 378 | Ga0395901_0169160 | 3300038443 | Bacteria | 2293 |
| 379 | Ga0395901_0592852 | 3300038443 | Bacteria | 1118 |
| 380 | Ga0436365_0714445 | 3300039437 | Bacteria | 7977 |
| 381 | Ga0436365_1125982 | 3300039437 | Bacteria | 14552 |
| 382 | Ga0436363_0699357 | 3300039450 | Bacteria | 591 |
| 383 | Ga0436363_1098434 | 3300039450 | Bacteria | 1388 |
| 384 | Ga0436363_1141298 | 3300039450 | Bacteria | 601 |
| 385 | Ga0436363_1468400 | 3300039450 | Bacteria | 658 |
| 386 | Ga0436362_0098660 | 3300039453 | Bacteria | 3230 |
| 387 | Ga0436362_0391771 | 3300039453 | Bacteria | 674 |
| 388 | Ga0436362_0857944 | 3300039453 | Bacteria | 1366 |
| 389 | Ga0439453_0132568 | 3300041408 | Bacteria | 580 |
| 390 | Ga0451800_0330475 | 3300041459 | Bacteria | 819 |
| 391 | Ga0451807_2426203 | 3300041486 | Bacteria | 972 |
| 392 | Ga0451833_0406180 | 3300041491 | Bacteria | 672 |
| 393 | Ga0451853_1776019 | 3300041512 | Bacteria | 651 |
| 394 | Ga0451853_1922546 | 3300041512 | Bacteria | 1608 |
| 395 | Ga0439449_0058991 | 3300042007 | Bacteria | 1417 |
| 396 | Ga0439454_002002 | 3300042011 | Bacteria | 2073 |
| 397 | Ga0439434_0034967 | 3300042435 | Bacteria | 1535 |
| 398 | Ga0466969_0126163 | 3300044656 | Bacteria | 1189 |
| 399 | Ga0466968_0033282 | 3300044735 | Bacteria | 2148 |
| 400 | Ga0466968_0303634 | 3300044735 | Bacteria | 768 |
| 401 | Ga0466970_0378978 | 3300044765 | Bacteria | 805 |
| 402 | Ga0466960_0000058 | 3300044901 | Bacteria | 36894 |
| 403 | Ga0466967_0010170 | 3300045976 | Bacteria | 7037 |
| 404 | Ga0466967_0184865 | 3300045976 | Bacteria | 1968 |
| 405 | Ga0466967_0336047 | 3300045976 | Bacteria | 1460 |
| 406 | Ga0495603_0037073 | 3300046455 | Bacteria | 2925 |
| 407 | Ga0495629_0288218 | 3300046459 | Unclassified | 1126 |
| 408 | Ga0495580_0074948 | 3300046472 | Bacteria | 2362 |
| 409 | Ga0495582_0078774 | 3300046473 | Bacteria | 1828 |
| 410 | Ga0495582_0404966 | 3300046473 | Bacteria | 787 |
| 411 | Ga0495605_0121934 | 3300046474 | Unclassified | 1181 |
| 412 | Ga0495639_0028748 | 3300046475 | Bacteria | 2463 |
| 413 | Ga0495584_0045009 | 3300046491 | Bacteria | 2226 |
| 414 | Ga0495584_0224995 | 3300046491 | Bacteria | 954 |
| 415 | Ga0495594_0071871 | 3300046499 | Bacteria | 1924 |
| 416 | Ga0495596_0167217 | 3300046500 | Bacteria | 855 |
| 417 | Ga0495620_0242523 | 3300046515 | Bacteria | 688 |
| 418 | Ga0495644_0096346 | 3300046523 | Bacteria | 1118 |
| 419 | Ga0495663_0181088 | 3300046525 | Bacteria | 730 |
| 420 | Ga0495652_0507906 | 3300046529 | Bacteria | 835 |
| 421 | Ga0495665_0077748 | 3300046531 | Bacteria | 1746 |
| 422 | Ga0495656_0095125 | 3300046615 | Unclassified | 1369 |
| 423 | Ga0495656_0141376 | 3300046615 | Bacteria | 1155 |
| 424 | Ga0495656_0253544 | 3300046615 | Bacteria | 890 |
| 425 | Ga0495668_0044275 | 3300046616 | Bacteria | 2474 |
| 426 | Ga0495611_0166379 | 3300046648 | Bacteria | 1031 |
| 427 | Ga0495588_0251173 | 3300046674 | Bacteria | 932 |
| 428 | Ga0495647_0297117 | 3300046681 | Bacteria | 727 |
| 429 | Ga0495658_0310073 | 3300046683 | Bacteria | 999 |
| 430 | Ga0495624_0846973 | 3300046690 | Unclassified | 539 |
| 431 | Ga0495670_0185005 | 3300046691 | Bacteria | 1101 |
| 432 | Ga0495670_0798809 | 3300046691 | Bacteria | 515 |
| 433 | Ga0495671_0590823 | 3300046692 | Unclassified | 528 |
| 434 | Ga0495589_0037555 | 3300046794 | Bacteria | 2427 |
| 435 | Ga0495589_0070056 | 3300046794 | Bacteria | 1715 |
| 436 | Ga0495581_0001162 | 3300047315 | Bacteria | 14417 |
| 437 | Ga0495581_0009944 | 3300047315 | Bacteria | 5503 |
| 438 | Ga0495636_0235667 | 3300047318 | Bacteria | 843 |
| 439 | Ga0496100_0007236 | 3300048903 | Bacteria | 6104 |
| 440 | Ga0496100_0561904 | 3300048903 | Bacteria | 883 |
| 441 | Ga0496101_0005203 | 3300048904 | Bacteria | 8275 |
| 442 | Ga0496101_0356154 | 3300048904 | Bacteria | 1150 |
| 443 | Ga0496102_0032594 | 3300048905 | Bacteria | 4680 |
| 444 | Ga0496102_0402672 | 3300048905 | Bacteria | 1286 |
| 445 | Ga0496102_0698350 | 3300048905 | Bacteria | 937 |
| 446 | Ga0496102_0848508 | 3300048905 | Bacteria | 836 |
| 447 | Ga0496103_0002529 | 3300048906 | Bacteria | 11459 |
| 448 | Ga0496103_0415977 | 3300048906 | Bacteria | 863 |
| 449 | Ga0496103_0525948 | 3300048906 | Bacteria | 756 |
| 450 | Ga0496104_0009729 | 3300048907 | Bacteria | 8570 |
| 451 | Ga0496104_0076446 | 3300048907 | Bacteria | 3189 |
| 452 | Ga0496105_0034204 | 3300048908 | Bacteria | 4179 |
| 453 | Ga0496105_0038149 | 3300048908 | Bacteria | 3958 |
| 454 | Ga0496106_0000909 | 3300048909 | Bacteria | 21550 |
| 455 | Ga0496106_0160880 | 3300048909 | Bacteria | 1775 |
| 456 | Ga0496107_0004852 | 3300048910 | Bacteria | 9134 |
| 457 | Ga0496107_0085855 | 3300048910 | Unclassified | 2296 |
| 458 | Ga0496107_0379209 | 3300048910 | Bacteria | 1052 |
| 459 | Ga0496108_0119825 | 3300048911 | Bacteria | 2256 |
| 460 | Ga0496109_0018035 | 3300048912 | Bacteria | 6195 |
| 461 | Ga0496109_0093771 | 3300048912 | Bacteria | 2778 |
| 462 | Ga0496109_0434985 | 3300048912 | Bacteria | 1239 |
| 463 | Ga0496110_0104320 | 3300048913 | Bacteria | 2543 |
| 464 | Ga0496110_0725224 | 3300048913 | Bacteria | 896 |
| 465 | Ga0496111_0163642 | 3300048914 | Bacteria | 1652 |
| 466 | Ga0496112_0013931 | 3300048915 | Bacteria | 7439 |
| 467 | Ga0496112_0019479 | 3300048915 | Bacteria | 6406 |
| 468 | Ga0496112_0039644 | 3300048915 | Bacteria | 4604 |
| 469 | Ga0496113_0022294 | 3300048916 | Bacteria | 4477 |
| 470 | Ga0496113_0241243 | 3300048916 | Bacteria | 1442 |
| 471 | Ga0496113_0650853 | 3300048916 | Bacteria | 843 |
| 472 | Ga0496114_0087925 | 3300048917 | Bacteria | 2635 |
| 473 | Ga0496114_0146915 | 3300048917 | Bacteria | 2044 |
| 474 | Ga0496115_0020181 | 3300048918 | Bacteria | 5137 |
| 475 | Ga0496115_0032095 | 3300048918 | Bacteria | 4142 |
| 476 | Ga0496115_0175650 | 3300048918 | Archaea | 1771 |
| 477 | Ga0501031_0001473 | 3300049568 | Bacteria | 14623 |
| 478 | Ga0501031_0208117 | 3300049568 | Bacteria | 1275 |
| 479 | Ga0501031_0262173 | 3300049568 | Bacteria | 1123 |
| 480 | Ga0501031_0531750 | 3300049568 | Bacteria | 758 |
| 481 | Ga0501032_0044805 | 3300049569 | Unclassified | 2993 |
| 482 | Ga0501032_0185424 | 3300049569 | Bacteria | 1361 |
| 483 | Ga0501032_0521684 | 3300049569 | Bacteria | 758 |
| 484 | Ga0501033_0015102 | 3300049570 | Bacteria | 5860 |
| 485 | Ga0501033_0747400 | 3300049570 | Bacteria | 663 |
| 486 | Ga0501034_0240224 | 3300049571 | Bacteria | 1758 |
| 487 | Ga0501036_0012918 | 3300049572 | Bacteria | 6934 |
| 488 | Ga0501036_0138340 | 3300049572 | Bacteria | 2055 |
| 489 | Ga0501036_0522247 | 3300049572 | Bacteria | 987 |
| 490 | Ga0501036_0578452 | 3300049572 | Bacteria | 932 |
| 491 | Ga0501037_0036644 | 3300049573 | Bacteria | 3614 |
| 492 | Ga0501038_0275907 | 3300049574 | Bacteria | 1324 |
| 493 | Ga0501038_0414590 | 3300049574 | Bacteria | 1040 |
| 494 | Ga0501039_0007983 | 3300049575 | Bacteria | 8064 |
| 495 | Ga0501039_0016098 | 3300049575 | Bacteria | 5727 |
| 496 | Ga0501039_0223241 | 3300049575 | Bacteria | 1481 |
| 497 | Ga0501040_0054526 | 3300049576 | Bacteria | 2740 |
| 498 | Ga0501040_0136175 | 3300049576 | Bacteria | 1729 |
| 499 | Ga0501040_0323348 | 3300049576 | Bacteria | 1103 |
| 500 | Ga0501041_0057263 | 3300049577 | Bacteria | 2383 |
| 501 | Ga0501041_0137131 | 3300049577 | Bacteria | 1525 |
| 502 | Ga0501042_0003275 | 3300049578 | Bacteria | 10133 |
| 503 | Ga0501042_0053139 | 3300049578 | Bacteria | 2890 |
| 504 | Ga0501042_0138830 | 3300049578 | Bacteria | 1752 |
| 505 | Ga0501042_0270395 | 3300049578 | Bacteria | 1227 |
| 506 | Ga0501042_0380820 | 3300049578 | Bacteria | 1021 |
| 507 | Ga0501042_0427616 | 3300049578 | Bacteria | 960 |
| 508 | Ga0501043_0028360 | 3300049579 | Unclassified | 4395 |
| 509 | Ga0501043_1288493 | 3300049579 | Bacteria | 510 |
| 510 | Ga0501046_0024599 | 3300049580 | Bacteria | 4938 |
| 511 | Ga0501046_0134918 | 3300049580 | Bacteria | 1870 |
| 512 | Ga0501048_0007617 | 3300049582 | Bacteria | 8206 |
| 513 | Ga0501048_0040007 | 3300049582 | Bacteria | 3361 |
| 514 | Ga0501048_0300875 | 3300049582 | Bacteria | 1141 |
| 515 | Ga0501048_0438931 | 3300049582 | Bacteria | 934 |
| 516 | Ga0501068_0000766 | 3300049584 | Bacteria | 16539 |
| 517 | Ga0501069_0045868 | 3300049585 | Bacteria | 2422 |
| 518 | Ga0501069_0175159 | 3300049585 | Bacteria | 1239 |
| 519 | Ga0501069_0182271 | 3300049585 | Bacteria | 1214 |
| 520 | Ga0501069_0869665 | 3300049585 | Bacteria | 548 |
| 521 | Ga0501070_0274146 | 3300049586 | Bacteria | 1377 |
| 522 | Ga0501070_0925048 | 3300049586 | Bacteria | 679 |
| 523 | Ga0501071_0004551 | 3300049587 | Bacteria | 8800 |
| 524 | Ga0501071_0007395 | 3300049587 | Bacteria | 7207 |
| 525 | Ga0501071_0055963 | 3300049587 | Bacteria | 2848 |
| 526 | Ga0501071_0660044 | 3300049587 | Bacteria | 805 |
| 527 | Ga0501072_0030449 | 3300049588 | Bacteria | 4220 |
| 528 | Ga0501072_0412256 | 3300049588 | Bacteria | 1071 |
| 529 | Ga0501072_0978159 | 3300049588 | Bacteria | 660 |
| 530 | Ga0501072_1313517 | 3300049588 | Bacteria | 560 |
| 531 | Ga0501073_0105968 | 3300049589 | Bacteria | 1951 |
| 532 | Ga0501074_0013240 | 3300049590 | Bacteria | 5997 |
| 533 | Ga0501074_0170064 | 3300049590 | Bacteria | 1556 |
| 534 | Ga0501075_0056996 | 3300049591 | Bacteria | 2941 |
| 535 | Ga0501075_0099895 | 3300049591 | Bacteria | 2204 |
| 536 | Ga0501075_0528637 | 3300049591 | Bacteria | 900 |
| 537 | Ga0501076_0004230 | 3300049592 | Bacteria | 10157 |
| 538 | Ga0501076_0033773 | 3300049592 | Bacteria | 3995 |
| 539 | Ga0501076_0092938 | 3300049592 | Bacteria | 2427 |
| 540 | Ga0501076_0545158 | 3300049592 | Bacteria | 956 |
| 541 | Ga0501077_0020161 | 3300049593 | Bacteria | 4220 |
| 542 | Ga0501077_0044358 | 3300049593 | Bacteria | 2825 |
| 543 | Ga0501077_0336629 | 3300049593 | Bacteria | 962 |
| 544 | Ga0501202_171630 | 3300049652 | Bacteria | 580 |
| 545 | Ga0501223_071229 | 3300049663 | Bacteria | 687 |
| 546 | Ga0501235_234708 | 3300049669 | Bacteria | 508 |
| 547 | Ga0501257_065815 | 3300049686 | Bacteria | 921 |
| 548 | Ga0501259_107939 | 3300049688 | Bacteria | 647 |
| 549 | Ga0501079_0029292 | 3300049741 | Bacteria | 4227 |
| 550 | Ga0501079_0208528 | 3300049741 | Bacteria | 1526 |
| 551 | Ga0501079_0263073 | 3300049741 | Bacteria | 1348 |
| 552 | Ga0501080_0016052 | 3300049742 | Bacteria | 6911 |
| 553 | Ga0501080_0558963 | 3300049742 | Bacteria | 1019 |
| 554 | Ga0501081_0001718 | 3300049743 | Bacteria | 13595 |
| 555 | Ga0501081_0684424 | 3300049743 | Bacteria | 770 |
| 556 | Ga0501081_1203661 | 3300049743 | Bacteria | 574 |
| 557 | Ga0501083_0040859 | 3300049744 | Bacteria | 3147 |
| 558 | Ga0501083_0989550 | 3300049744 | Bacteria | 547 |
| 559 | Ga0501266_045054 | 3300049763 | Bacteria | 667 |
| 560 | Ga0501276_040570 | 3300049773 | Bacteria | 517 |
| 561 | Ga0501035_0172327 | 3300049822 | Bacteria | 1869 |
| 562 | Ga0501044_0372235 | 3300049823 | Bacteria | 1345 |
| 563 | Ga0501045_0002214 | 3300049824 | Bacteria | 13191 |
| 564 | Ga0501045_0149719 | 3300049824 | Bacteria | 1736 |
| 565 | Ga0501045_0276664 | 3300049824 | Bacteria | 1250 |
| 566 | Ga0501045_0527821 | 3300049824 | Bacteria | 876 |
| 567 | Ga0501045_0916836 | 3300049824 | Bacteria | 643 |
| 568 | nmdc:mga00v17_207819_c1 | 3300050491 | Bacteria | 1266 |
| 569 | nmdc:mga0yw44_371230_c1 | 3300050492 | Bacteria | 965 |
| 570 | nmdc:mga0yw44_666724_c1 | 3300050492 | Bacteria | 707 |
| 571 | nmdc:mga05p37_198700_c2 | 3300050507 | Bacteria | 1521 |
| 572 | nmdc:mga05p37_19939_c1 | 3300050507 | Bacteria | 8113 |
| 573 | nmdc:mga05p37_60531_c1 | 3300050507 | Bacteria | 4662 |
| 574 | nmdc:mga05p37_906041_c1 | 3300050507 | Bacteria | 950 |
| 575 | nmdc:mga09592_1625518_c1 | 3300050508 | Bacteria | 523 |
| 576 | nmdc:mga09592_23642_c1 | 3300050508 | Bacteria | 5076 |
| 577 | nmdc:mga09592_312603_c1 | 3300050508 | Bacteria | 1361 |
| 578 | nmdc:mga09592_56633_c1 | 3300050508 | Bacteria | 3312 |
| 579 | nmdc:mga09592_842321_c1 | 3300050508 | Bacteria | 774 |
| 580 | nmdc:mga0qj67_17946_c1 | 3300050509 | Bacteria | 5388 |
| 581 | nmdc:mga0qj67_281586_c1 | 3300050509 | Bacteria | 1348 |
| 582 | nmdc:mga0qj67_819529_c1 | 3300050509 | Bacteria | 736 |
| 583 | nmdc:mga06r32_101792_c1 | 3300050510 | Bacteria | 2819 |
| 584 | nmdc:mga06r32_1488457_c1 | 3300050510 | Bacteria | 617 |
| 585 | nmdc:mga06r32_513974_c1 | 3300050510 | Bacteria | 1174 |
| 586 | nmdc:mga06r32_641850_c1 | 3300050510 | Bacteria | 1030 |
| 587 | nmdc:mga08y16_117964_c1 | 3300050511 | Bacteria | 2762 |
| 588 | nmdc:mga08y16_268118_c1 | 3300050511 | Bacteria | 1763 |
| 589 | nmdc:mga08y16_506112_c1 | 3300050511 | Bacteria | 1226 |
| 590 | nmdc:mga0n895_51209_c1 | 3300050512 | Bacteria | 4050 |
| 591 | nmdc:mga0rr50_2139_c1 | 3300050513 | Bacteria | 11044 |
| 592 | nmdc:mga0rr50_391137_c1 | 3300050513 | Bacteria | 1173 |
| 593 | nmdc:mga08x19_325701_c1 | 3300050514 | Bacteria | 1070 |
| 594 | nmdc:mga08x19_874641_c1 | 3300050514 | Unclassified | 638 |
| 595 | nmdc:mga0a205_327430_c1 | 3300050515 | Bacteria | 1402 |
| 596 | nmdc:mga0a205_403075_c1 | 3300050515 | Bacteria | 763 |
| 597 | nmdc:mga0a205_85373_c1 | 3300050515 | Bacteria | 3048 |
| 598 | Ga0501084_0067216 | 3300054114 | Bacteria | 3000 |
| 599 | Ga0501084_0073618 | 3300054114 | Bacteria | 2861 |
| 600 | Ga0501084_0226242 | 3300054114 | Bacteria | 1578 |
| 601 | Ga0501084_0253537 | 3300054114 | Bacteria | 1485 |
| 602 | Ga0501084_0444688 | 3300054114 | Bacteria | 1096 |
| 603 | Ga0501082_0019758 | 3300060353 | Bacteria | 5810 |
| 604 | Ga0501082_0030877 | 3300060353 | Bacteria | 4619 |
| 605 | Ga0501082_0043028 | 3300060353 | Bacteria | 3893 |
| 606 | Ga0501082_0194534 | 3300060353 | Bacteria | 1764 |
| 607 | Ga0530510_0009763 | 3300061734 | Bacteria | 6735 |
| 608 | Ga0530510_0177109 | 3300061734 | Bacteria | 1581 |
| 609 | Ga0530510_0735265 | 3300061734 | Bacteria | 752 |
| 610 | Ga0530510_0996351 | 3300061734 | Bacteria | 641 |
| 611 | Ga0530510_1468568 | 3300061734 | Bacteria | 523 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10190481 | rootH1_101904813 | 108 |
| 2 | 3300005458 | Ga0070681_11272816 | Ga0070681_112728161 | 108 |
| 3 | 3300013105 | Ga0157369_10949951 | Ga0157369_109499512 | 108 |
| 4 | 3300025885 | Ga0207653_10230058 | Ga0207653_102300582 | 108 |
| 5 | 3300005329 | Ga0070683_101366247 | Ga0070683_1013662471 | 110 |
| 6 | 3300006846 | Ga0075430_100010106 | Ga0075430_1000101062 | 110 |
| 7 | 3300006847 | Ga0075431_101652827 | Ga0075431_1016528272 | 110 |
| 8 | 3300006871 | Ga0075434_102155128 | Ga0075434_1021551281 | 110 |
| 9 | 3300006880 | Ga0075429_100082653 | Ga0075429_1000826532 | 110 |
| 10 | 3300009147 | Ga0114129_10003650 | Ga0114129_1000365015 | 110 |
| 11 | 3300025945 | Ga0207679_11204156 | Ga0207679_112041562 | 110 |
| 12 | 3300046515 | Ga0495620_0242523 | Ga0495620_0242523_228_560 | 110 |
| 13 | 3300046615 | Ga0495656_0253544 | Ga0495656_0253544_44_376 | 110 |
| 14 | 3300048916 | Ga0496113_0650853 | Ga0496113_0650853_152_484 | 110 |
| 15 | 3300049585 | Ga0501069_0869665 | Ga0501069_0869665_162_494 | 110 |
| 16 | 3300050492 | nmdc:mga0yw44_371230_c1 | nmdc:mga0yw44_371230_c1_312_644 | 110 |
| 17 | 3300003203 | JGI25406J46586_10009455 | JGI25406J46586_100094555 | 111 |
| 18 | 3300005439 | Ga0070711_100121618 | Ga0070711_1001216182 | 111 |
| 19 | 3300005985 | Ga0081539_10000182 | Ga0081539_1000018248 | 111 |
| 20 | 3300006048 | Ga0075363_100864244 | Ga0075363_1008642442 | 111 |
| 21 | 3300013296 | Ga0157374_10884536 | Ga0157374_108845362 | 111 |
| 22 | 3300039453 | Ga0436362_0391771 | Ga0436362_0391771_102_437 | 111 |
| 23 | 3300044656 | Ga0466969_0126163 | Ga0466969_0126163_540_875 | 111 |
| 24 | 3300050507 | nmdc:mga05p37_60531_c1 | nmdc:mga05p37_60531_c1_174_530 | 111 |
| 25 | 3300050508 | nmdc:mga09592_56633_c1 | nmdc:mga09592_56633_c1_1166_1522 | 111 |
| 26 | 3300050509 | nmdc:mga0qj67_281586_c1 | nmdc:mga0qj67_281586_c1_753_1109 | 111 |
| 27 | 3300050510 | nmdc:mga06r32_1488457_c1 | nmdc:mga06r32_1488457_c1_122_478 | 111 |
| 28 | 3300005435 | Ga0070714_100659514 | Ga0070714_1006595142 | 113 |
| 29 | 3300005719 | Ga0068861_100574388 | Ga0068861_1005743882 | 113 |
| 30 | 3300006028 | Ga0070717_10321991 | Ga0070717_103219913 | 113 |
| 31 | 3300006058 | Ga0075432_10295522 | Ga0075432_102955221 | 113 |
| 32 | 3300014326 | Ga0157380_10344463 | Ga0157380_103444632 | 113 |
| 33 | 3300025935 | Ga0207709_10246390 | Ga0207709_102463903 | 113 |
| 34 | 3300026067 | Ga0207678_11466751 | Ga0207678_114667512 | 113 |
| 35 | 3300027907 | Ga0207428_10271472 | Ga0207428_102714723 | 113 |
| 36 | 3300050491 | nmdc:mga00v17_207819_c1 | nmdc:mga00v17_207819_c1_227_577 | 113 |
| 37 | 3300005564 | Ga0070664_102375906 | Ga0070664_1023759062 | 114 |
| 38 | 3300005616 | Ga0068852_102517537 | Ga0068852_1025175371 | 114 |
| 39 | 3300006852 | Ga0075433_10271070 | Ga0075433_102710702 | 114 |
| 40 | 3300006871 | Ga0075434_100095193 | Ga0075434_1000951933 | 114 |
| 41 | 3300009148 | Ga0105243_10435665 | Ga0105243_104356653 | 114 |
| 42 | 3300009176 | Ga0105242_10510983 | Ga0105242_105109833 | 114 |
| 43 | 3300013296 | Ga0157374_11441534 | Ga0157374_114415342 | 114 |
| 44 | 3300014325 | Ga0163163_11628181 | Ga0163163_116281812 | 114 |
| 45 | 3300025918 | Ga0207662_10409815 | Ga0207662_104098152 | 114 |
| 46 | 3300025939 | Ga0207665_10269231 | Ga0207665_102692312 | 114 |
| 47 | 3300025972 | Ga0207668_10002697 | Ga0207668_1000269712 | 114 |
| 48 | 3300037466 | Ga0395898_0178271 | Ga0395898_0178271_383_733 | 114 |
| 49 | 3300037471 | Ga0395905_0640437 | Ga0395905_0640437_218_568 | 114 |
| 50 | 3300048906 | Ga0496103_0525948 | Ga0496103_0525948_327_671 | 114 |
| 51 | 3300048913 | Ga0496110_0725224 | Ga0496110_0725224_29_373 | 114 |
| 52 | 3300050511 | nmdc:mga08y16_506112_c1 | nmdc:mga08y16_506112_c1_153_497 | 114 |
| 53 | 3300005441 | Ga0070700_101974727 | Ga0070700_1019747271 | 115 |
| 54 | 3300005467 | Ga0070706_100905568 | Ga0070706_1009055682 | 115 |
| 55 | 3300005544 | Ga0070686_100517855 | Ga0070686_1005178552 | 115 |
| 56 | 3300005937 | Ga0081455_10010177 | Ga0081455_100101772 | 115 |
| 57 | 3300037312 | Ga0395899_1014631 | Ga0395899_1014631_75_422 | 115 |
| 58 | 3300037471 | Ga0395905_0404774 | Ga0395905_0404774_632_979 | 115 |
| 59 | 3300045976 | Ga0466967_0184865 | Ga0466967_0184865_902_1249 | 115 |
| 60 | 3300048905 | Ga0496102_0848508 | Ga0496102_0848508_299_652 | 115 |
| 61 | 3300050508 | nmdc:mga09592_842321_c1 | nmdc:mga09592_842321_c1_11_358 | 115 |
| 62 | 3300061734 | Ga0530510_0996351 | Ga0530510_0996351_179_526 | 115 |
| 63 | 3300005983 | Ga0081540_1053311 | Ga0081540_10533113 | 116 |
| 64 | 3300006852 | Ga0075433_10971637 | Ga0075433_109716372 | 116 |
| 65 | 3300009094 | Ga0111539_10051458 | Ga0111539_100514582 | 116 |
| 66 | 3300009098 | Ga0105245_10549756 | Ga0105245_105497562 | 116 |
| 67 | 3300009147 | Ga0114129_10411171 | Ga0114129_104111712 | 116 |
| 68 | 3300027907 | Ga0207428_10115786 | Ga0207428_101157864 | 116 |
| 69 | 3300031995 | Ga0307409_100289504 | Ga0307409_1002895043 | 116 |
| 70 | 3300035115 | Ga0373941_0257234 | Ga0373941_0257234_293_649 | 116 |
| 71 | 3300038443 | Ga0395901_0062654 | Ga0395901_0062654_3489_3839 | 116 |
| 72 | 3300044901 | Ga0466960_0000058 | Ga0466960_0000058_29813_30163 | 116 |
| 73 | 3300050507 | nmdc:mga05p37_906041_c1 | nmdc:mga05p37_906041_c1_93_443 | 116 |
| 74 | 3300050510 | nmdc:mga06r32_641850_c1 | nmdc:mga06r32_641850_c1_239_589 | 116 |
| 75 | 3300050511 | nmdc:mga08y16_268118_c1 | nmdc:mga08y16_268118_c1_1036_1386 | 116 |
| 76 | 3300050515 | nmdc:mga0a205_403075_c1 | nmdc:mga0a205_403075_c1_156_506 | 116 |
| 77 | 3300002155 | JGI24033J26618_1011010 | JGI24033J26618_10110102 | 117 |
| 78 | 3300002459 | JGI24751J29686_10014242 | JGI24751J29686_100142422 | 117 |
| 79 | 3300003373 | JGI25407J50210_10004549 | JGI25407J50210_100045491 | 117 |
| 80 | 3300005327 | Ga0070658_10044365 | Ga0070658_100443652 | 117 |
| 81 | 3300005330 | Ga0070690_100392131 | Ga0070690_1003921312 | 117 |
| 82 | 3300005331 | Ga0070670_100019042 | Ga0070670_1000190427 | 117 |
| 83 | 3300005336 | Ga0070680_100142244 | Ga0070680_1001422442 | 117 |
| 84 | 3300005337 | Ga0070682_100109914 | Ga0070682_1001099143 | 117 |
| 85 | 3300005338 | Ga0068868_101411800 | Ga0068868_1014118002 | 117 |
| 86 | 3300005339 | Ga0070660_100025013 | Ga0070660_1000250133 | 117 |
| 87 | 3300005340 | Ga0070689_100106019 | Ga0070689_1001060194 | 117 |
| 88 | 3300005340 | Ga0070689_100429410 | Ga0070689_1004294102 | 117 |
| 89 | 3300005344 | Ga0070661_101169298 | Ga0070661_1011692982 | 117 |
| 90 | 3300005355 | Ga0070671_100032574 | Ga0070671_1000325743 | 117 |
| 91 | 3300005364 | Ga0070673_100243709 | Ga0070673_1002437092 | 117 |
| 92 | 3300005364 | Ga0070673_101376941 | Ga0070673_1013769411 | 117 |
| 93 | 3300005434 | Ga0070709_10175870 | Ga0070709_101758703 | 117 |
| 94 | 3300005438 | Ga0070701_10512761 | Ga0070701_105127612 | 117 |
| 95 | 3300005438 | Ga0070701_10823337 | Ga0070701_108233371 | 117 |
| 96 | 3300005439 | Ga0070711_100097858 | Ga0070711_1000978583 | 117 |
| 97 | 3300005440 | Ga0070705_101709909 | Ga0070705_1017099092 | 117 |
| 98 | 3300005444 | Ga0070694_100622624 | Ga0070694_1006226242 | 117 |
| 99 | 3300005455 | Ga0070663_101205913 | Ga0070663_1012059131 | 117 |
| 100 | 3300005458 | Ga0070681_10105938 | Ga0070681_101059383 | 117 |
| 101 | 3300005458 | Ga0070681_11111122 | Ga0070681_111111222 | 117 |
| 102 | 3300005459 | Ga0068867_100575674 | Ga0068867_1005756742 | 117 |
| 103 | 3300005466 | Ga0070685_10259135 | Ga0070685_102591352 | 117 |
| 104 | 3300005468 | Ga0070707_100145063 | Ga0070707_1001450633 | 117 |
| 105 | 3300005468 | Ga0070707_100562202 | Ga0070707_1005622022 | 117 |
| 106 | 3300005518 | Ga0070699_100866036 | Ga0070699_1008660361 | 117 |
| 107 | 3300005535 | Ga0070684_100520279 | Ga0070684_1005202792 | 117 |
| 108 | 3300005543 | Ga0070672_101165162 | Ga0070672_1011651621 | 117 |
| 109 | 3300005544 | Ga0070686_101847964 | Ga0070686_1018479641 | 117 |
| 110 | 3300005546 | Ga0070696_100454910 | Ga0070696_1004549102 | 117 |
| 111 | 3300005547 | Ga0070693_100127431 | Ga0070693_1001274312 | 117 |
| 112 | 3300005547 | Ga0070693_100231632 | Ga0070693_1002316322 | 117 |
| 113 | 3300005563 | Ga0068855_100360924 | Ga0068855_1003609243 | 117 |
| 114 | 3300005563 | Ga0068855_100577021 | Ga0068855_1005770212 | 117 |
| 115 | 3300005577 | Ga0068857_100048398 | Ga0068857_1000483981 | 117 |
| 116 | 3300005614 | Ga0068856_100003239 | Ga0068856_10000323922 | 117 |
| 117 | 3300005617 | Ga0068859_100042556 | Ga0068859_1000425564 | 117 |
| 118 | 3300005617 | Ga0068859_100104270 | Ga0068859_1001042705 | 117 |
| 119 | 3300005618 | Ga0068864_100100815 | Ga0068864_1001008153 | 117 |
| 120 | 3300005618 | Ga0068864_100449674 | Ga0068864_1004496741 | 117 |
| 121 | 3300005618 | Ga0068864_100838530 | Ga0068864_1008385302 | 117 |
| 122 | 3300005840 | Ga0068870_10013058 | Ga0068870_100130583 | 117 |
| 123 | 3300005840 | Ga0068870_10189885 | Ga0068870_101898852 | 117 |
| 124 | 3300005842 | Ga0068858_100013790 | Ga0068858_1000137907 | 117 |
| 125 | 3300005842 | Ga0068858_101074521 | Ga0068858_1010745212 | 117 |
| 126 | 3300005843 | Ga0068860_100761269 | Ga0068860_1007612691 | 117 |
| 127 | 3300005844 | Ga0068862_102124526 | Ga0068862_1021245262 | 117 |
| 128 | 3300005937 | Ga0081455_10017821 | Ga0081455_100178218 | 117 |
| 129 | 3300005981 | Ga0081538_10000669 | Ga0081538_1000066927 | 117 |
| 130 | 3300005981 | Ga0081538_10000902 | Ga0081538_100009027 | 117 |
| 131 | 3300005981 | Ga0081538_10018916 | Ga0081538_100189164 | 117 |
| 132 | 3300005981 | Ga0081538_10071257 | Ga0081538_100712572 | 117 |
| 133 | 3300005981 | Ga0081538_10338541 | Ga0081538_103385411 | 117 |
| 134 | 3300006028 | Ga0070717_10557221 | Ga0070717_105572212 | 117 |
| 135 | 3300006038 | Ga0075365_10576044 | Ga0075365_105760442 | 117 |
| 136 | 3300006048 | Ga0075363_100115916 | Ga0075363_1001159162 | 117 |
| 137 | 3300006844 | Ga0075428_100031225 | Ga0075428_1000312252 | 117 |
| 138 | 3300006844 | Ga0075428_100037399 | Ga0075428_1000373993 | 117 |
| 139 | 3300006844 | Ga0075428_101031814 | Ga0075428_1010318142 | 117 |
| 140 | 3300006844 | Ga0075428_102584971 | Ga0075428_1025849711 | 117 |
| 141 | 3300006846 | Ga0075430_100012632 | Ga0075430_1000126327 | 117 |
| 142 | 3300006846 | Ga0075430_100995234 | Ga0075430_1009952341 | 117 |
| 143 | 3300006852 | Ga0075433_10039711 | Ga0075433_100397114 | 117 |
| 144 | 3300006871 | Ga0075434_100032531 | Ga0075434_1000325319 | 117 |
| 145 | 3300006880 | Ga0075429_100007437 | Ga0075429_1000074378 | 117 |
| 146 | 3300006880 | Ga0075429_100764991 | Ga0075429_1007649911 | 117 |
| 147 | 3300006881 | Ga0068865_100513869 | Ga0068865_1005138692 | 117 |
| 148 | 3300006914 | Ga0075436_100436374 | Ga0075436_1004363741 | 117 |
| 149 | 3300006931 | Ga0097620_100042556 | Ga0097620_1000425564 | 117 |
| 150 | 3300006931 | Ga0097620_100104273 | Ga0097620_1001042735 | 117 |
| 151 | 3300007076 | Ga0075435_100000686 | Ga0075435_1000006868 | 117 |
| 152 | 3300009094 | Ga0111539_10032821 | Ga0111539_1003282111 | 117 |
| 153 | 3300009147 | Ga0114129_10029537 | Ga0114129_1002953711 | 117 |
| 154 | 3300009147 | Ga0114129_10112507 | Ga0114129_101125077 | 117 |
| 155 | 3300009147 | Ga0114129_10132970 | Ga0114129_101329704 | 117 |
| 156 | 3300009147 | Ga0114129_10213403 | Ga0114129_102134032 | 117 |
| 157 | 3300009147 | Ga0114129_10228966 | Ga0114129_102289663 | 117 |
| 158 | 3300009176 | Ga0105242_10178362 | Ga0105242_101783623 | 117 |
| 159 | 3300009553 | Ga0105249_11841946 | Ga0105249_118419461 | 117 |
| 160 | 3300010159 | Ga0099796_10327983 | Ga0099796_103279831 | 117 |
| 161 | 3300010375 | Ga0105239_10457207 | Ga0105239_104572071 | 117 |
| 162 | 3300013102 | Ga0157371_10203491 | Ga0157371_102034912 | 117 |
| 163 | 3300013104 | Ga0157370_10499069 | Ga0157370_104990692 | 117 |
| 164 | 3300013105 | Ga0157369_10432933 | Ga0157369_104329332 | 117 |
| 165 | 3300013297 | Ga0157378_10119289 | Ga0157378_101192892 | 117 |
| 166 | 3300013306 | Ga0163162_12408500 | Ga0163162_124085002 | 117 |
| 167 | 3300014968 | Ga0157379_10232720 | Ga0157379_102327204 | 117 |
| 168 | 3300021358 | Ga0213873_10158630 | Ga0213873_101586302 | 117 |
| 169 | 3300021377 | Ga0213874_10318892 | Ga0213874_103188922 | 117 |
| 170 | 3300025321 | Ga0207656_10153290 | Ga0207656_101532902 | 117 |
| 171 | 3300025906 | Ga0207699_10062124 | Ga0207699_100621244 | 117 |
| 172 | 3300025908 | Ga0207643_10013602 | Ga0207643_100136023 | 117 |
| 173 | 3300025908 | Ga0207643_10038160 | Ga0207643_100381604 | 117 |
| 174 | 3300025912 | Ga0207707_10243454 | Ga0207707_102434542 | 117 |
| 175 | 3300025916 | Ga0207663_10836654 | Ga0207663_108366541 | 117 |
| 176 | 3300025918 | Ga0207662_10015041 | Ga0207662_100150413 | 117 |
| 177 | 3300025919 | Ga0207657_10004070 | Ga0207657_1000407010 | 117 |
| 178 | 3300025919 | Ga0207657_10527901 | Ga0207657_105279011 | 117 |
| 179 | 3300025921 | Ga0207652_10198458 | Ga0207652_101984581 | 117 |
| 180 | 3300025922 | Ga0207646_10397036 | Ga0207646_103970362 | 117 |
| 181 | 3300025924 | Ga0207694_10767491 | Ga0207694_107674912 | 117 |
| 182 | 3300025925 | Ga0207650_10001896 | Ga0207650_1000189611 | 117 |
| 183 | 3300025926 | Ga0207659_10451226 | Ga0207659_104512261 | 117 |
| 184 | 3300025927 | Ga0207687_10187839 | Ga0207687_101878393 | 117 |
| 185 | 3300025929 | Ga0207664_10344571 | Ga0207664_103445713 | 117 |
| 186 | 3300025931 | Ga0207644_10237493 | Ga0207644_102374933 | 117 |
| 187 | 3300025933 | Ga0207706_10478987 | Ga0207706_104789872 | 117 |
| 188 | 3300025936 | Ga0207670_10147928 | Ga0207670_101479283 | 117 |
| 189 | 3300025939 | Ga0207665_10070580 | Ga0207665_100705805 | 117 |
| 190 | 3300025940 | Ga0207691_10214397 | Ga0207691_102143972 | 117 |
| 191 | 3300025941 | Ga0207711_10112790 | Ga0207711_101127901 | 117 |
| 192 | 3300025944 | Ga0207661_11253079 | Ga0207661_112530791 | 117 |
| 193 | 3300025945 | Ga0207679_11214763 | Ga0207679_112147631 | 117 |
| 194 | 3300025949 | Ga0207667_10819849 | Ga0207667_108198492 | 117 |
| 195 | 3300025960 | Ga0207651_10340993 | Ga0207651_103409933 | 117 |
| 196 | 3300026023 | Ga0207677_10183916 | Ga0207677_101839162 | 117 |
| 197 | 3300026023 | Ga0207677_10672395 | Ga0207677_106723951 | 117 |
| 198 | 3300026067 | Ga0207678_10583610 | Ga0207678_105836102 | 117 |
| 199 | 3300026075 | Ga0207708_10019855 | Ga0207708_100198554 | 117 |
| 200 | 3300026089 | Ga0207648_10239663 | Ga0207648_102396632 | 117 |
| 201 | 3300026095 | Ga0207676_10446478 | Ga0207676_104464781 | 117 |
| 202 | 3300026095 | Ga0207676_10787101 | Ga0207676_107871012 | 117 |
| 203 | 3300026116 | Ga0207674_10056049 | Ga0207674_100560492 | 117 |
| 204 | 3300026121 | Ga0207683_10019625 | Ga0207683_100196254 | 117 |
| 205 | 3300028379 | Ga0268266_10100293 | Ga0268266_101002936 | 117 |
| 206 | 3300031548 | Ga0307408_100011866 | Ga0307408_1000118665 | 117 |
| 207 | 3300031548 | Ga0307408_100117574 | Ga0307408_1001175743 | 117 |
| 208 | 3300031731 | Ga0307405_10038900 | Ga0307405_100389004 | 117 |
| 209 | 3300031731 | Ga0307405_10171833 | Ga0307405_101718331 | 117 |
| 210 | 3300031731 | Ga0307405_10298643 | Ga0307405_102986432 | 117 |
| 211 | 3300031824 | Ga0307413_10298435 | Ga0307413_102984351 | 117 |
| 212 | 3300031852 | Ga0307410_10193576 | Ga0307410_101935762 | 117 |
| 213 | 3300031852 | Ga0307410_10689919 | Ga0307410_106899192 | 117 |
| 214 | 3300031901 | Ga0307406_10059659 | Ga0307406_100596594 | 117 |
| 215 | 3300031901 | Ga0307406_10126140 | Ga0307406_101261403 | 117 |
| 216 | 3300031901 | Ga0307406_10928400 | Ga0307406_109284002 | 117 |
| 217 | 3300031903 | Ga0307407_10049644 | Ga0307407_100496441 | 117 |
| 218 | 3300031903 | Ga0307407_10178165 | Ga0307407_101781652 | 117 |
| 219 | 3300031903 | Ga0307407_10675217 | Ga0307407_106752171 | 117 |
| 220 | 3300031911 | Ga0307412_10062126 | Ga0307412_100621265 | 117 |
| 221 | 3300031911 | Ga0307412_10234836 | Ga0307412_102348362 | 117 |
| 222 | 3300031995 | Ga0307409_100093471 | Ga0307409_1000934714 | 117 |
| 223 | 3300031995 | Ga0307409_100399488 | Ga0307409_1003994882 | 117 |
| 224 | 3300032002 | Ga0307416_100030108 | Ga0307416_1000301084 | 117 |
| 225 | 3300032002 | Ga0307416_100044284 | Ga0307416_1000442842 | 117 |
| 226 | 3300032002 | Ga0307416_100078507 | Ga0307416_1000785074 | 117 |
| 227 | 3300032002 | Ga0307416_100550000 | Ga0307416_1005500003 | 117 |
| 228 | 3300032004 | Ga0307414_10170193 | Ga0307414_101701931 | 117 |
| 229 | 3300032005 | Ga0307411_10061143 | Ga0307411_100611432 | 117 |
| 230 | 3300032005 | Ga0307411_10683032 | Ga0307411_106830322 | 117 |
| 231 | 3300032126 | Ga0307415_100000180 | Ga0307415_10000018023 | 117 |
| 232 | 3300032126 | Ga0307415_100166071 | Ga0307415_1001660713 | 117 |
| 233 | 3300032126 | Ga0307415_101692482 | Ga0307415_1016924822 | 117 |
| 234 | 3300034820 | Ga0373959_0128829 | Ga0373959_0128829_82_438 | 117 |
| 235 | 3300035116 | Ga0373945_0122829 | Ga0373945_0122829_321_674 | 117 |
| 236 | 3300035171 | Ga0373946_0041328 | Ga0373946_0041328_602_955 | 117 |
| 237 | 3300035692 | Ga0373935_0417321 | Ga0373935_0417321_442_795 | 117 |
| 238 | 3300037068 | Ga0373925_0195437 | Ga0373925_0195437_633_986 | 117 |
| 239 | 3300037312 | Ga0395899_0002792 | Ga0395899_0002792_36_389 | 117 |
| 240 | 3300037312 | Ga0395899_0059451 | Ga0395899_0059451_1772_2125 | 117 |
| 241 | 3300037312 | Ga0395899_0349808 | Ga0395899_0349808_555_908 | 117 |
| 242 | 3300037418 | Ga0395900_0015059 | Ga0395900_0015059_741_1094 | 117 |
| 243 | 3300037418 | Ga0395900_0016596 | Ga0395900_0016596_4760_5113 | 117 |
| 244 | 3300037418 | Ga0395900_0094308 | Ga0395900_0094308_840_1193 | 117 |
| 245 | 3300037418 | Ga0395900_0867582 | Ga0395900_0867582_62_415 | 117 |
| 246 | 3300037466 | Ga0395898_0004598 | Ga0395898_0004598_8042_8395 | 117 |
| 247 | 3300037466 | Ga0395898_0062093 | Ga0395898_0062093_1053_1406 | 117 |
| 248 | 3300037466 | Ga0395898_1129148 | Ga0395898_1129148_64_417 | 117 |
| 249 | 3300037471 | Ga0395905_0011277 | Ga0395905_0011277_8250_8603 | 117 |
| 250 | 3300037471 | Ga0395905_0038521 | Ga0395905_0038521_2398_2751 | 117 |
| 251 | 3300037471 | Ga0395905_0326925 | Ga0395905_0326925_86_439 | 117 |
| 252 | 3300037853 | Ga0436364_0707398 | Ga0436364_0707398_275_628 | 117 |
| 253 | 3300037853 | Ga0436364_1016261 | Ga0436364_1016261_39_392 | 117 |
| 254 | 3300037853 | Ga0436364_1038598 | Ga0436364_1038598_1120_1473 | 117 |
| 255 | 3300038443 | Ga0395901_0007686 | Ga0395901_0007686_10360_10713 | 117 |
| 256 | 3300038443 | Ga0395901_0029263 | Ga0395901_0029263_4477_4830 | 117 |
| 257 | 3300038443 | Ga0395901_0169160 | Ga0395901_0169160_1307_1660 | 117 |
| 258 | 3300038443 | Ga0395901_0592852 | Ga0395901_0592852_194_547 | 117 |
| 259 | 3300039437 | Ga0436365_0714445 | Ga0436365_0714445_7087_7440 | 117 |
| 260 | 3300039450 | Ga0436363_0699357 | Ga0436363_0699357_90_443 | 117 |
| 261 | 3300039450 | Ga0436363_1098434 | Ga0436363_1098434_876_1229 | 117 |
| 262 | 3300039450 | Ga0436363_1141298 | Ga0436363_1141298_56_412 | 117 |
| 263 | 3300039450 | Ga0436363_1468400 | Ga0436363_1468400_225_578 | 117 |
| 264 | 3300039453 | Ga0436362_0098660 | Ga0436362_0098660_155_508 | 117 |
| 265 | 3300039453 | Ga0436362_0857944 | Ga0436362_0857944_458_811 | 117 |
| 266 | 3300041408 | Ga0439453_0132568 | Ga0439453_0132568_207_560 | 117 |
| 267 | 3300041459 | Ga0451800_0330475 | Ga0451800_0330475_264_617 | 117 |
| 268 | 3300041486 | Ga0451807_2426203 | Ga0451807_2426203_554_907 | 117 |
| 269 | 3300041491 | Ga0451833_0406180 | Ga0451833_0406180_296_652 | 117 |
| 270 | 3300041512 | Ga0451853_1922546 | Ga0451853_1922546_775_1128 | 117 |
| 271 | 3300042011 | Ga0439454_002002 | Ga0439454_002002_639_992 | 117 |
| 272 | 3300044735 | Ga0466968_0303634 | Ga0466968_0303634_302_655 | 117 |
| 273 | 3300045976 | Ga0466967_0336047 | Ga0466967_0336047_16_369 | 117 |
| 274 | 3300046459 | Ga0495629_0288218 | Ga0495629_0288218_197_550 | 117 |
| 275 | 3300046472 | Ga0495580_0074948 | Ga0495580_0074948_457_810 | 117 |
| 276 | 3300046474 | Ga0495605_0121934 | Ga0495605_0121934_102_455 | 117 |
| 277 | 3300046475 | Ga0495639_0028748 | Ga0495639_0028748_835_1188 | 117 |
| 278 | 3300046491 | Ga0495584_0045009 | Ga0495584_0045009_205_558 | 117 |
| 279 | 3300046523 | Ga0495644_0096346 | Ga0495644_0096346_550_903 | 117 |
| 280 | 3300046525 | Ga0495663_0181088 | Ga0495663_0181088_313_666 | 117 |
| 281 | 3300046531 | Ga0495665_0077748 | Ga0495665_0077748_811_1164 | 117 |
| 282 | 3300046615 | Ga0495656_0095125 | Ga0495656_0095125_263_616 | 117 |
| 283 | 3300046616 | Ga0495668_0044275 | Ga0495668_0044275_1149_1502 | 117 |
| 284 | 3300046674 | Ga0495588_0251173 | Ga0495588_0251173_480_833 | 117 |
| 285 | 3300046690 | Ga0495624_0846973 | Ga0495624_0846973_73_426 | 117 |
| 286 | 3300046691 | Ga0495670_0185005 | Ga0495670_0185005_42_395 | 117 |
| 287 | 3300046691 | Ga0495670_0798809 | Ga0495670_0798809_29_382 | 117 |
| 288 | 3300046692 | Ga0495671_0590823 | Ga0495671_0590823_151_504 | 117 |
| 289 | 3300046794 | Ga0495589_0037555 | Ga0495589_0037555_1023_1376 | 117 |
| 290 | 3300047315 | Ga0495581_0001162 | Ga0495581_0001162_11238_11591 | 117 |
| 291 | 3300047318 | Ga0495636_0235667 | Ga0495636_0235667_163_516 | 117 |
| 292 | 3300048904 | Ga0496101_0356154 | Ga0496101_0356154_524_877 | 117 |
| 293 | 3300048905 | Ga0496102_0402672 | Ga0496102_0402672_253_606 | 117 |
| 294 | 3300048906 | Ga0496103_0415977 | Ga0496103_0415977_309_662 | 117 |
| 295 | 3300048910 | Ga0496107_0379209 | Ga0496107_0379209_475_828 | 117 |
| 296 | 3300048912 | Ga0496109_0434985 | Ga0496109_0434985_93_449 | 117 |
| 297 | 3300048915 | Ga0496112_0039644 | Ga0496112_0039644_4224_4580 | 117 |
| 298 | 3300048916 | Ga0496113_0241243 | Ga0496113_0241243_995_1348 | 117 |
| 299 | 3300048918 | Ga0496115_0020181 | Ga0496115_0020181_2665_3018 | 117 |
| 300 | 3300049568 | Ga0501031_0001473 | Ga0501031_0001473_11081_11434 | 117 |
| 301 | 3300049568 | Ga0501031_0208117 | Ga0501031_0208117_825_1178 | 117 |
| 302 | 3300049568 | Ga0501031_0262173 | Ga0501031_0262173_149_505 | 117 |
| 303 | 3300049568 | Ga0501031_0531750 | Ga0501031_0531750_332_685 | 117 |
| 304 | 3300049569 | Ga0501032_0044805 | Ga0501032_0044805_2619_2972 | 117 |
| 305 | 3300049569 | Ga0501032_0185424 | Ga0501032_0185424_838_1194 | 117 |
| 306 | 3300049570 | Ga0501033_0015102 | Ga0501033_0015102_4066_4419 | 117 |
| 307 | 3300049570 | Ga0501033_0747400 | Ga0501033_0747400_252_608 | 117 |
| 308 | 3300049571 | Ga0501034_0240224 | Ga0501034_0240224_1281_1634 | 117 |
| 309 | 3300049572 | Ga0501036_0012918 | Ga0501036_0012918_878_1234 | 117 |
| 310 | 3300049572 | Ga0501036_0138340 | Ga0501036_0138340_52_405 | 117 |
| 311 | 3300049572 | Ga0501036_0578452 | Ga0501036_0578452_483_836 | 117 |
| 312 | 3300049573 | Ga0501037_0036644 | Ga0501037_0036644_2095_2448 | 117 |
| 313 | 3300049574 | Ga0501038_0275907 | Ga0501038_0275907_781_1134 | 117 |
| 314 | 3300049574 | Ga0501038_0414590 | Ga0501038_0414590_63_419 | 117 |
| 315 | 3300049575 | Ga0501039_0007983 | Ga0501039_0007983_5236_5589 | 117 |
| 316 | 3300049575 | Ga0501039_0223241 | Ga0501039_0223241_626_979 | 117 |
| 317 | 3300049576 | Ga0501040_0054526 | Ga0501040_0054526_1803_2156 | 117 |
| 318 | 3300049577 | Ga0501041_0057263 | Ga0501041_0057263_1713_2066 | 117 |
| 319 | 3300049577 | Ga0501041_0137131 | Ga0501041_0137131_187_543 | 117 |
| 320 | 3300049578 | Ga0501042_0003275 | Ga0501042_0003275_7880_8233 | 117 |
| 321 | 3300049578 | Ga0501042_0053139 | Ga0501042_0053139_1815_2171 | 117 |
| 322 | 3300049578 | Ga0501042_0138830 | Ga0501042_0138830_1346_1699 | 117 |
| 323 | 3300049578 | Ga0501042_0270395 | Ga0501042_0270395_61_417 | 117 |
| 324 | 3300049578 | Ga0501042_0427616 | Ga0501042_0427616_27_380 | 117 |
| 325 | 3300049579 | Ga0501043_0028360 | Ga0501043_0028360_3994_4347 | 117 |
| 326 | 3300049580 | Ga0501046_0024599 | Ga0501046_0024599_3919_4272 | 117 |
| 327 | 3300049580 | Ga0501046_0134918 | Ga0501046_0134918_1240_1596 | 117 |
| 328 | 3300049582 | Ga0501048_0007617 | Ga0501048_0007617_2321_2674 | 117 |
| 329 | 3300049582 | Ga0501048_0040007 | Ga0501048_0040007_801_1154 | 117 |
| 330 | 3300049582 | Ga0501048_0438931 | Ga0501048_0438931_446_802 | 117 |
| 331 | 3300049584 | Ga0501068_0000766 | Ga0501068_0000766_10500_10853 | 117 |
| 332 | 3300049585 | Ga0501069_0045868 | Ga0501069_0045868_1815_2168 | 117 |
| 333 | 3300049585 | Ga0501069_0175159 | Ga0501069_0175159_240_596 | 117 |
| 334 | 3300049586 | Ga0501070_0274146 | Ga0501070_0274146_14_370 | 117 |
| 335 | 3300049586 | Ga0501070_0925048 | Ga0501070_0925048_93_446 | 117 |
| 336 | 3300049587 | Ga0501071_0004551 | Ga0501071_0004551_1980_2333 | 117 |
| 337 | 3300049587 | Ga0501071_0007395 | Ga0501071_0007395_1366_1719 | 117 |
| 338 | 3300049587 | Ga0501071_0055963 | Ga0501071_0055963_2111_2467 | 117 |
| 339 | 3300049587 | Ga0501071_0660044 | Ga0501071_0660044_254_607 | 117 |
| 340 | 3300049588 | Ga0501072_0030449 | Ga0501072_0030449_3184_3537 | 117 |
| 341 | 3300049588 | Ga0501072_0978159 | Ga0501072_0978159_30_386 | 117 |
| 342 | 3300049588 | Ga0501072_1313517 | Ga0501072_1313517_36_389 | 117 |
| 343 | 3300049589 | Ga0501073_0105968 | Ga0501073_0105968_670_1032 | 117 |
| 344 | 3300049590 | Ga0501074_0013240 | Ga0501074_0013240_4081_4434 | 117 |
| 345 | 3300049591 | Ga0501075_0056996 | Ga0501075_0056996_319_672 | 117 |
| 346 | 3300049591 | Ga0501075_0528637 | Ga0501075_0528637_98_451 | 117 |
| 347 | 3300049592 | Ga0501076_0004230 | Ga0501076_0004230_6828_7181 | 117 |
| 348 | 3300049592 | Ga0501076_0092938 | Ga0501076_0092938_1485_1838 | 117 |
| 349 | 3300049592 | Ga0501076_0545158 | Ga0501076_0545158_345_701 | 117 |
| 350 | 3300049593 | Ga0501077_0020161 | Ga0501077_0020161_3828_4181 | 117 |
| 351 | 3300049593 | Ga0501077_0044358 | Ga0501077_0044358_2259_2615 | 117 |
| 352 | 3300049652 | Ga0501202_171630 | Ga0501202_171630_207_563 | 117 |
| 353 | 3300049663 | Ga0501223_071229 | Ga0501223_071229_97_453 | 117 |
| 354 | 3300049669 | Ga0501235_234708 | Ga0501235_234708_23_376 | 117 |
| 355 | 3300049686 | Ga0501257_065815 | Ga0501257_065815_45_401 | 117 |
| 356 | 3300049688 | Ga0501259_107939 | Ga0501259_107939_19_375 | 117 |
| 357 | 3300049741 | Ga0501079_0263073 | Ga0501079_0263073_203_556 | 117 |
| 358 | 3300049742 | Ga0501080_0016052 | Ga0501080_0016052_1646_1999 | 117 |
| 359 | 3300049742 | Ga0501080_0558963 | Ga0501080_0558963_172_525 | 117 |
| 360 | 3300049743 | Ga0501081_0001718 | Ga0501081_0001718_654_1007 | 117 |
| 361 | 3300049743 | Ga0501081_0684424 | Ga0501081_0684424_337_690 | 117 |
| 362 | 3300049743 | Ga0501081_1203661 | Ga0501081_1203661_29_382 | 117 |
| 363 | 3300049744 | Ga0501083_0040859 | Ga0501083_0040859_2289_2642 | 117 |
| 364 | 3300049744 | Ga0501083_0989550 | Ga0501083_0989550_165_521 | 117 |
| 365 | 3300049763 | Ga0501266_045054 | Ga0501266_045054_206_562 | 117 |
| 366 | 3300049773 | Ga0501276_040570 | Ga0501276_040570_125_481 | 117 |
| 367 | 3300049822 | Ga0501035_0172327 | Ga0501035_0172327_179_532 | 117 |
| 368 | 3300049823 | Ga0501044_0372235 | Ga0501044_0372235_255_608 | 117 |
| 369 | 3300049824 | Ga0501045_0002214 | Ga0501045_0002214_811_1164 | 117 |
| 370 | 3300049824 | Ga0501045_0149719 | Ga0501045_0149719_51_407 | 117 |
| 371 | 3300049824 | Ga0501045_0527821 | Ga0501045_0527821_492_845 | 117 |
| 372 | 3300049824 | Ga0501045_0916836 | Ga0501045_0916836_30_386 | 117 |
| 373 | 3300050492 | nmdc:mga0yw44_666724_c1 | nmdc:mga0yw44_666724_c1_94_447 | 117 |
| 374 | 3300050507 | nmdc:mga05p37_198700_c2 | nmdc:mga05p37_198700_c2_185_541 | 117 |
| 375 | 3300050507 | nmdc:mga05p37_19939_c1 | nmdc:mga05p37_19939_c1_4256_4609 | 117 |
| 376 | 3300050508 | nmdc:mga09592_1625518_c1 | nmdc:mga09592_1625518_c1_31_384 | 117 |
| 377 | 3300050508 | nmdc:mga09592_23642_c1 | nmdc:mga09592_23642_c1_3022_3378 | 117 |
| 378 | 3300050508 | nmdc:mga09592_312603_c1 | nmdc:mga09592_312603_c1_794_1147 | 117 |
| 379 | 3300050509 | nmdc:mga0qj67_17946_c1 | nmdc:mga0qj67_17946_c1_4981_5337 | 117 |
| 380 | 3300050509 | nmdc:mga0qj67_819529_c1 | nmdc:mga0qj67_819529_c1_112_465 | 117 |
| 381 | 3300050510 | nmdc:mga06r32_513974_c1 | nmdc:mga06r32_513974_c1_810_1163 | 117 |
| 382 | 3300050511 | nmdc:mga08y16_117964_c1 | nmdc:mga08y16_117964_c1_1317_1673 | 117 |
| 383 | 3300050512 | nmdc:mga0n895_51209_c1 | nmdc:mga0n895_51209_c1_795_1157 | 117 |
| 384 | 3300050513 | nmdc:mga0rr50_2139_c1 | nmdc:mga0rr50_2139_c1_4835_5188 | 117 |
| 385 | 3300050513 | nmdc:mga0rr50_391137_c1 | nmdc:mga0rr50_391137_c1_534_890 | 117 |
| 386 | 3300050514 | nmdc:mga08x19_325701_c1 | nmdc:mga08x19_325701_c1_656_1009 | 117 |
| 387 | 3300050515 | nmdc:mga0a205_327430_c1 | nmdc:mga0a205_327430_c1_128_490 | 117 |
| 388 | 3300050515 | nmdc:mga0a205_85373_c1 | nmdc:mga0a205_85373_c1_1218_1571 | 117 |
| 389 | 3300054114 | Ga0501084_0067216 | Ga0501084_0067216_1399_1755 | 117 |
| 390 | 3300054114 | Ga0501084_0226242 | Ga0501084_0226242_622_975 | 117 |
| 391 | 3300054114 | Ga0501084_0444688 | Ga0501084_0444688_467_820 | 117 |
| 392 | 3300060353 | Ga0501082_0019758 | Ga0501082_0019758_11_367 | 117 |
| 393 | 3300060353 | Ga0501082_0030877 | Ga0501082_0030877_3435_3788 | 117 |
| 394 | 3300060353 | Ga0501082_0043028 | Ga0501082_0043028_1640_1993 | 117 |
| 395 | 3300060353 | Ga0501082_0194534 | Ga0501082_0194534_897_1250 | 117 |
| 396 | 3300061734 | Ga0530510_0009763 | Ga0530510_0009763_179_532 | 117 |
| 397 | 3300061734 | Ga0530510_0177109 | Ga0530510_0177109_992_1345 | 117 |
| 398 | 3300061734 | Ga0530510_0735265 | Ga0530510_0735265_24_377 | 117 |
| 399 | 3300061734 | Ga0530510_1468568 | Ga0530510_1468568_51_404 | 117 |
| 400 | 3300037466 | Ga0395898_1198031 | Ga0395898_1198031_245_601 | 118 |
| 401 | 3300048917 | Ga0496114_0146915 | Ga0496114_0146915_1341_1700 | 118 |
| 402 | 3300046473 | Ga0495582_0404966 | Ga0495582_0404966_73_432 | 119 |
| 403 | 3300046529 | Ga0495652_0507906 | Ga0495652_0507906_225_584 | 119 |
| 404 | 3300003203 | JGI25406J46586_10008116 | JGI25406J46586_100081165 | 120 |
| 405 | 3300005535 | Ga0070684_100637232 | Ga0070684_1006372322 | 120 |
| 406 | 3300005577 | Ga0068857_101082183 | Ga0068857_1010821832 | 120 |
| 407 | 3300005834 | Ga0068851_10082842 | Ga0068851_100828422 | 120 |
| 408 | 3300005985 | Ga0081539_10044037 | Ga0081539_100440373 | 120 |
| 409 | 3300006048 | Ga0075363_100667823 | Ga0075363_1006678232 | 120 |
| 410 | 3300006178 | Ga0075367_10409214 | Ga0075367_104092142 | 120 |
| 411 | 3300006847 | Ga0075431_101198696 | Ga0075431_1011986962 | 120 |
| 412 | 3300006881 | Ga0068865_100171974 | Ga0068865_1001719743 | 120 |
| 413 | 3300006914 | Ga0075436_100632416 | Ga0075436_1006324162 | 120 |
| 414 | 3300021384 | Ga0213876_10001139 | Ga0213876_1000113912 | 120 |
| 415 | 3300025911 | Ga0207654_10290826 | Ga0207654_102908262 | 120 |
| 416 | 3300025933 | Ga0207706_10784245 | Ga0207706_107842452 | 120 |
| 417 | 3300025961 | Ga0207712_10102053 | Ga0207712_101020533 | 120 |
| 418 | 3300026116 | Ga0207674_10391228 | Ga0207674_103912282 | 120 |
| 419 | 3300045976 | Ga0466967_0010170 | Ga0466967_0010170_3501_3863 | 120 |
| 420 | 3300050510 | nmdc:mga06r32_101792_c1 | nmdc:mga06r32_101792_c1_185_547 | 120 |
| 421 | 3300050514 | nmdc:mga08x19_874641_c1 | nmdc:mga08x19_874641_c1_31_393 | 120 |
| 422 | 3300005330 | Ga0070690_100024361 | Ga0070690_1000243614 | 121 |
| 423 | 3300005333 | Ga0070677_10198061 | Ga0070677_101980612 | 121 |
| 424 | 3300005336 | Ga0070680_100101887 | Ga0070680_1001018873 | 121 |
| 425 | 3300005338 | Ga0068868_100028178 | Ga0068868_1000281782 | 121 |
| 426 | 3300005340 | Ga0070689_100033963 | Ga0070689_1000339632 | 121 |
| 427 | 3300005341 | Ga0070691_10064422 | Ga0070691_100644223 | 121 |
| 428 | 3300005347 | Ga0070668_100492240 | Ga0070668_1004922401 | 121 |
| 429 | 3300005354 | Ga0070675_100289112 | Ga0070675_1002891123 | 121 |
| 430 | 3300005355 | Ga0070671_100133610 | Ga0070671_1001336103 | 121 |
| 431 | 3300005356 | Ga0070674_100068560 | Ga0070674_1000685603 | 121 |
| 432 | 3300005365 | Ga0070688_100003853 | Ga0070688_1000038538 | 121 |
| 433 | 3300005366 | Ga0070659_100064082 | Ga0070659_1000640822 | 121 |
| 434 | 3300005406 | Ga0070703_10058086 | Ga0070703_100580861 | 121 |
| 435 | 3300005439 | Ga0070711_100003577 | Ga0070711_10000357710 | 121 |
| 436 | 3300005440 | Ga0070705_101125286 | Ga0070705_1011252862 | 121 |
| 437 | 3300005441 | Ga0070700_100001973 | Ga0070700_1000019733 | 121 |
| 438 | 3300005444 | Ga0070694_100364091 | Ga0070694_1003640913 | 121 |
| 439 | 3300005455 | Ga0070663_100001959 | Ga0070663_1000019599 | 121 |
| 440 | 3300005518 | Ga0070699_100371783 | Ga0070699_1003717832 | 121 |
| 441 | 3300005530 | Ga0070679_100453820 | Ga0070679_1004538202 | 121 |
| 442 | 3300005544 | Ga0070686_100007440 | Ga0070686_1000074403 | 121 |
| 443 | 3300005547 | Ga0070693_100023513 | Ga0070693_1000235133 | 121 |
| 444 | 3300005549 | Ga0070704_100159925 | Ga0070704_1001599252 | 121 |
| 445 | 3300005563 | Ga0068855_100868110 | Ga0068855_1008681102 | 121 |
| 446 | 3300005614 | Ga0068856_100064387 | Ga0068856_1000643875 | 121 |
| 447 | 3300005615 | Ga0070702_100023431 | Ga0070702_1000234314 | 121 |
| 448 | 3300006163 | Ga0070715_10030275 | Ga0070715_100302753 | 121 |
| 449 | 3300006358 | Ga0068871_100607464 | Ga0068871_1006074642 | 121 |
| 450 | 3300009094 | Ga0111539_11227807 | Ga0111539_112278072 | 121 |
| 451 | 3300009098 | Ga0105245_10050490 | Ga0105245_100504904 | 121 |
| 452 | 3300009148 | Ga0105243_10120018 | Ga0105243_101200184 | 121 |
| 453 | 3300009176 | Ga0105242_10003124 | Ga0105242_100031246 | 121 |
| 454 | 3300009176 | Ga0105242_11148627 | Ga0105242_111486272 | 121 |
| 455 | 3300009177 | Ga0105248_10899672 | Ga0105248_108996722 | 121 |
| 456 | 3300009545 | Ga0105237_10476973 | Ga0105237_104769732 | 121 |
| 457 | 3300009553 | Ga0105249_10267466 | Ga0105249_102674662 | 121 |
| 458 | 3300013296 | Ga0157374_10001932 | Ga0157374_1000193210 | 121 |
| 459 | 3300013307 | Ga0157372_11304122 | Ga0157372_113041222 | 121 |
| 460 | 3300014326 | Ga0157380_10017866 | Ga0157380_100178663 | 121 |
| 461 | 3300014969 | Ga0157376_10311674 | Ga0157376_103116742 | 121 |
| 462 | 3300025885 | Ga0207653_10030985 | Ga0207653_100309852 | 121 |
| 463 | 3300025893 | Ga0207682_10109060 | Ga0207682_101090602 | 121 |
| 464 | 3300025898 | Ga0207692_10142735 | Ga0207692_101427352 | 121 |
| 465 | 3300025900 | Ga0207710_10366555 | Ga0207710_103665552 | 121 |
| 466 | 3300025939 | Ga0207665_10609547 | Ga0207665_106095472 | 121 |
| 467 | 3300025960 | Ga0207651_10257702 | Ga0207651_102577023 | 121 |
| 468 | 3300025961 | Ga0207712_10047091 | Ga0207712_100470912 | 121 |
| 469 | 3300025972 | Ga0207668_12130873 | Ga0207668_121308731 | 121 |
| 470 | 3300039437 | Ga0436365_1125982 | Ga0436365_1125982_3016_3384 | 121 |
| 471 | 3300041512 | Ga0451853_1776019 | Ga0451853_1776019_78_443 | 121 |
| 472 | 3300044735 | Ga0466968_0033282 | Ga0466968_0033282_232_597 | 121 |
| 473 | 3300044765 | Ga0466970_0378978 | Ga0466970_0378978_347_712 | 121 |
| 474 | 3300046455 | Ga0495603_0037073 | Ga0495603_0037073_1399_1764 | 121 |
| 475 | 3300046473 | Ga0495582_0078774 | Ga0495582_0078774_1384_1749 | 121 |
| 476 | 3300046491 | Ga0495584_0224995 | Ga0495584_0224995_102_467 | 121 |
| 477 | 3300046499 | Ga0495594_0071871 | Ga0495594_0071871_1178_1543 | 121 |
| 478 | 3300046615 | Ga0495656_0141376 | Ga0495656_0141376_177_542 | 121 |
| 479 | 3300046648 | Ga0495611_0166379 | Ga0495611_0166379_169_534 | 121 |
| 480 | 3300046681 | Ga0495647_0297117 | Ga0495647_0297117_71_436 | 121 |
| 481 | 3300046683 | Ga0495658_0310073 | Ga0495658_0310073_518_883 | 121 |
| 482 | 3300046794 | Ga0495589_0070056 | Ga0495589_0070056_160_525 | 121 |
| 483 | 3300047315 | Ga0495581_0009944 | Ga0495581_0009944_4221_4586 | 121 |
| 484 | 3300048903 | Ga0496100_0007236 | Ga0496100_0007236_5101_5466 | 121 |
| 485 | 3300048903 | Ga0496100_0561904 | Ga0496100_0561904_307_675 | 121 |
| 486 | 3300048904 | Ga0496101_0005203 | Ga0496101_0005203_7748_8113 | 121 |
| 487 | 3300048905 | Ga0496102_0032594 | Ga0496102_0032594_3392_3757 | 121 |
| 488 | 3300048905 | Ga0496102_0698350 | Ga0496102_0698350_421_789 | 121 |
| 489 | 3300048906 | Ga0496103_0002529 | Ga0496103_0002529_10586_10951 | 121 |
| 490 | 3300048907 | Ga0496104_0009729 | Ga0496104_0009729_7428_7793 | 121 |
| 491 | 3300048907 | Ga0496104_0076446 | Ga0496104_0076446_322_690 | 121 |
| 492 | 3300048908 | Ga0496105_0034204 | Ga0496105_0034204_3541_3909 | 121 |
| 493 | 3300048908 | Ga0496105_0038149 | Ga0496105_0038149_2315_2680 | 121 |
| 494 | 3300048909 | Ga0496106_0000909 | Ga0496106_0000909_8039_8404 | 121 |
| 495 | 3300048909 | Ga0496106_0160880 | Ga0496106_0160880_1267_1635 | 121 |
| 496 | 3300048910 | Ga0496107_0004852 | Ga0496107_0004852_6652_7017 | 121 |
| 497 | 3300048910 | Ga0496107_0085855 | Ga0496107_0085855_421_789 | 121 |
| 498 | 3300048911 | Ga0496108_0119825 | Ga0496108_0119825_361_726 | 121 |
| 499 | 3300048912 | Ga0496109_0018035 | Ga0496109_0018035_1255_1623 | 121 |
| 500 | 3300048912 | Ga0496109_0093771 | Ga0496109_0093771_857_1222 | 121 |
| 501 | 3300048913 | Ga0496110_0104320 | Ga0496110_0104320_1049_1417 | 121 |
| 502 | 3300048914 | Ga0496111_0163642 | Ga0496111_0163642_750_1118 | 121 |
| 503 | 3300048915 | Ga0496112_0013931 | Ga0496112_0013931_2638_3006 | 121 |
| 504 | 3300048915 | Ga0496112_0019479 | Ga0496112_0019479_968_1333 | 121 |
| 505 | 3300048916 | Ga0496113_0022294 | Ga0496113_0022294_2683_3051 | 121 |
| 506 | 3300048917 | Ga0496114_0087925 | Ga0496114_0087925_929_1294 | 121 |
| 507 | 3300048918 | Ga0496115_0032095 | Ga0496115_0032095_1127_1492 | 121 |
| 508 | 3300048918 | Ga0496115_0175650 | Ga0496115_0175650_582_950 | 121 |
| 509 | 3300049569 | Ga0501032_0521684 | Ga0501032_0521684_62_427 | 121 |
| 510 | 3300049572 | Ga0501036_0522247 | Ga0501036_0522247_284_652 | 121 |
| 511 | 3300049575 | Ga0501039_0016098 | Ga0501039_0016098_1184_1549 | 121 |
| 512 | 3300049576 | Ga0501040_0136175 | Ga0501040_0136175_18_383 | 121 |
| 513 | 3300049576 | Ga0501040_0323348 | Ga0501040_0323348_677_1045 | 121 |
| 514 | 3300049578 | Ga0501042_0380820 | Ga0501042_0380820_43_411 | 121 |
| 515 | 3300049579 | Ga0501043_1288493 | Ga0501043_1288493_97_480 | 121 |
| 516 | 3300049582 | Ga0501048_0300875 | Ga0501048_0300875_75_440 | 121 |
| 517 | 3300049585 | Ga0501069_0182271 | Ga0501069_0182271_236_601 | 121 |
| 518 | 3300049588 | Ga0501072_0412256 | Ga0501072_0412256_63_431 | 121 |
| 519 | 3300049590 | Ga0501074_0170064 | Ga0501074_0170064_238_606 | 121 |
| 520 | 3300049591 | Ga0501075_0099895 | Ga0501075_0099895_1224_1589 | 121 |
| 521 | 3300049592 | Ga0501076_0033773 | Ga0501076_0033773_2268_2636 | 121 |
| 522 | 3300049593 | Ga0501077_0336629 | Ga0501077_0336629_580_945 | 121 |
| 523 | 3300049741 | Ga0501079_0029292 | Ga0501079_0029292_645_1013 | 121 |
| 524 | 3300049741 | Ga0501079_0208528 | Ga0501079_0208528_468_833 | 121 |
| 525 | 3300049824 | Ga0501045_0276664 | Ga0501045_0276664_575_940 | 121 |
| 526 | 3300054114 | Ga0501084_0073618 | Ga0501084_0073618_341_706 | 121 |
| 527 | 3300010375 | Ga0105239_12089734 | Ga0105239_120897341 | 122 |
| 528 | 3300021388 | Ga0213875_10038849 | Ga0213875_100388491 | 122 |
| 529 | 3300037853 | Ga0436364_0752322 | Ga0436364_0752322_173_541 | 122 |
| 530 | 3300031731 | Ga0307405_10145617 | Ga0307405_101456172 | 123 |
| 531 | 3300032002 | Ga0307416_100213536 | Ga0307416_1002135363 | 123 |
| 532 | 3300009177 | Ga0105248_10089177 | Ga0105248_100891773 | 124 |
| 533 | 3300013307 | Ga0157372_11380449 | Ga0157372_113804492 | 124 |
| 534 | 3300013308 | Ga0157375_10058096 | Ga0157375_100580964 | 124 |
| 535 | 3300009174 | Ga0105241_10480392 | Ga0105241_104803922 | 126 |
| 536 | 3300025934 | Ga0207686_10126001 | Ga0207686_101260013 | 126 |
| 537 | 3300025936 | Ga0207670_10194797 | Ga0207670_101947972 | 126 |
| 538 | 3300026035 | Ga0207703_10027981 | Ga0207703_100279813 | 126 |
| 539 | 3300026089 | Ga0207648_10042164 | Ga0207648_100421642 | 126 |
| 540 | 3300054114 | Ga0501084_0253537 | Ga0501084_0253537_1072_1455 | 126 |
| 541 | 3300021358 | Ga0213873_10061746 | Ga0213873_100617461 | 127 |
| 542 | 3300002077 | JGI24744J21845_10012886 | JGI24744J21845_100128862 | 130 |
| 543 | 3300002244 | JGI24742J22300_10016937 | JGI24742J22300_100169373 | 130 |
| 544 | 3300005337 | Ga0070682_100006239 | Ga0070682_1000062393 | 130 |
| 545 | 3300005339 | Ga0070660_100079968 | Ga0070660_1000799683 | 130 |
| 546 | 3300005345 | Ga0070692_10056496 | Ga0070692_100564963 | 130 |
| 547 | 3300005367 | Ga0070667_100150411 | Ga0070667_1001504112 | 130 |
| 548 | 3300005434 | Ga0070709_10155272 | Ga0070709_101552722 | 130 |
| 549 | 3300005435 | Ga0070714_101306624 | Ga0070714_1013066241 | 130 |
| 550 | 3300005437 | Ga0070710_10047971 | Ga0070710_100479713 | 130 |
| 551 | 3300005438 | Ga0070701_10000911 | Ga0070701_100009116 | 130 |
| 552 | 3300005456 | Ga0070678_100000298 | Ga0070678_10000029829 | 130 |
| 553 | 3300005459 | Ga0068867_100002281 | Ga0068867_10000228115 | 130 |
| 554 | 3300005466 | Ga0070685_10045060 | Ga0070685_100450602 | 130 |
| 555 | 3300005539 | Ga0068853_100085008 | Ga0068853_1000850084 | 130 |
| 556 | 3300005546 | Ga0070696_100033756 | Ga0070696_1000337563 | 130 |
| 557 | 3300005616 | Ga0068852_100002120 | Ga0068852_10000212011 | 130 |
| 558 | 3300005617 | Ga0068859_100061676 | Ga0068859_1000616765 | 130 |
| 559 | 3300005718 | Ga0068866_10014980 | Ga0068866_100149803 | 130 |
| 560 | 3300006173 | Ga0070716_100155765 | Ga0070716_1001557653 | 130 |
| 561 | 3300006175 | Ga0070712_100019749 | Ga0070712_1000197495 | 130 |
| 562 | 3300006237 | Ga0097621_100035448 | Ga0097621_1000354483 | 130 |
| 563 | 3300006881 | Ga0068865_100031672 | Ga0068865_1000316723 | 130 |
| 564 | 3300006931 | Ga0097620_100061679 | Ga0097620_1000616795 | 130 |
| 565 | 3300009098 | Ga0105245_10019026 | Ga0105245_100190262 | 130 |
| 566 | 3300009148 | Ga0105243_10002101 | Ga0105243_1000210110 | 130 |
| 567 | 3300009174 | Ga0105241_10019097 | Ga0105241_100190976 | 130 |
| 568 | 3300009177 | Ga0105248_10021005 | Ga0105248_100210053 | 130 |
| 569 | 3300009545 | Ga0105237_10736885 | Ga0105237_107368852 | 130 |
| 570 | 3300009551 | Ga0105238_10020762 | Ga0105238_100207625 | 130 |
| 571 | 3300009553 | Ga0105249_10002268 | Ga0105249_1000226818 | 130 |
| 572 | 3300010375 | Ga0105239_10061108 | Ga0105239_100611085 | 130 |
| 573 | 3300013104 | Ga0157370_11642959 | Ga0157370_116429592 | 130 |
| 574 | 3300013297 | Ga0157378_10002234 | Ga0157378_100022342 | 130 |
| 575 | 3300013306 | Ga0163162_10021305 | Ga0163162_100213057 | 130 |
| 576 | 3300013308 | Ga0157375_10081823 | Ga0157375_100818233 | 130 |
| 577 | 3300014745 | Ga0157377_10001693 | Ga0157377_100016935 | 130 |
| 578 | 3300014969 | Ga0157376_10005356 | Ga0157376_100053569 | 130 |
| 579 | 3300025899 | Ga0207642_10054953 | Ga0207642_100549532 | 130 |
| 580 | 3300025901 | Ga0207688_10140322 | Ga0207688_101403221 | 130 |
| 581 | 3300025903 | Ga0207680_10023379 | Ga0207680_100233794 | 130 |
| 582 | 3300025906 | Ga0207699_10046025 | Ga0207699_100460253 | 130 |
| 583 | 3300025911 | Ga0207654_10107294 | Ga0207654_101072942 | 130 |
| 584 | 3300025915 | Ga0207693_10007175 | Ga0207693_1000717511 | 130 |
| 585 | 3300025916 | Ga0207663_10033549 | Ga0207663_100335492 | 130 |
| 586 | 3300025918 | Ga0207662_10074295 | Ga0207662_100742952 | 130 |
| 587 | 3300025919 | Ga0207657_10042720 | Ga0207657_100427203 | 130 |
| 588 | 3300025921 | Ga0207652_10100193 | Ga0207652_101001933 | 130 |
| 589 | 3300025926 | Ga0207659_10841809 | Ga0207659_108418091 | 130 |
| 590 | 3300025927 | Ga0207687_10139571 | Ga0207687_101395713 | 130 |
| 591 | 3300025931 | Ga0207644_10394456 | Ga0207644_103944562 | 130 |
| 592 | 3300025934 | Ga0207686_10014856 | Ga0207686_100148564 | 130 |
| 593 | 3300025936 | Ga0207670_10327379 | Ga0207670_103273792 | 130 |
| 594 | 3300025937 | Ga0207669_10192844 | Ga0207669_101928442 | 130 |
| 595 | 3300025938 | Ga0207704_10089184 | Ga0207704_100891843 | 130 |
| 596 | 3300025940 | Ga0207691_10081295 | Ga0207691_100812953 | 130 |
| 597 | 3300025941 | Ga0207711_10027079 | Ga0207711_100270796 | 130 |
| 598 | 3300025949 | Ga0207667_10429702 | Ga0207667_104297022 | 130 |
| 599 | 3300025986 | Ga0207658_10165417 | Ga0207658_101654173 | 130 |
| 600 | 3300026023 | Ga0207677_10424595 | Ga0207677_104245952 | 130 |
| 601 | 3300026041 | Ga0207639_10382465 | Ga0207639_103824652 | 130 |
| 602 | 3300026067 | Ga0207678_10007751 | Ga0207678_1000775111 | 130 |
| 603 | 3300026075 | Ga0207708_10000352 | Ga0207708_1000035241 | 130 |
| 604 | 3300026078 | Ga0207702_10179997 | Ga0207702_101799973 | 130 |
| 605 | 3300026089 | Ga0207648_10033696 | Ga0207648_100336963 | 130 |
| 606 | 3300026118 | Ga0207675_100015239 | Ga0207675_1000152393 | 130 |
| 607 | 3300026121 | Ga0207683_10000598 | Ga0207683_1000059824 | 130 |
| 608 | 3300028379 | Ga0268266_10027679 | Ga0268266_100276792 | 130 |
| 609 | 3300042007 | Ga0439449_0058991 | Ga0439449_0058991_131_526 | 130 |
| 610 | 3300042435 | Ga0439434_0034967 | Ga0439434_0034967_870_1265 | 130 |
| 611 | 3300046500 | Ga0495596_0167217 | Ga0495596_0167217_212_607 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9632 | 32 | 87 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.9625 | 32 | 86 |
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9492 | 20 | 91 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9484 | 35 | 86 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9465 | 21 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9804 | 31 | 86 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9677 | 32 | 85 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9632 | 32 | 87 | 1.10.10.10 |
| 5j6xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9625 | 32 | 86 | 1.10.10.10 |
| af_P32910_88_152_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9575 | 32 | 86 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M7WM41-F1-model_v4 | Transcriptional regulator | 0.9808 | 20 | 92 |
GO:0003700
|
| AF-A0A841HZ84-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9735 | 20 | 93 |
GO:0003700
|
| AF-A0A7H2BEU7-F1-model_v4 | Metalloregulator ArsR/SmtB family transcription factor | 0.9617 | 24 | 106 |
GO:0003700
|
| AF-A0A0S8DZL8-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9617 | 20 | 99 |
GO:0003700
|
| AF-A0A6A7LP56-F1-model_v4 | Metalloregulator ArsR/SmtB family transcription factor | 0.9605 | 20 | 96 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar