F468995

General Info

Members Datasets Scaffolds Average Seq Length
610 294 1220 165

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0656617|Ga0466957_0656617_116_670
Length 184
Sequence MRKPDFRRLTRGLAGKLVGALIVLLALVFVGLAAVGGSLFWNHEVQAAEQAARLELGPCIDGRTPPGCDLAAQQIPKVFGYDYQTVERTLNEVYPMLTPSYRQEFQDRAAKDIIPQARDRQLVSQATVVGTGVMTAQRDAASVMVYMNRTITDKNKQPIYDGSRLRVDYQKIGGKWLIQYITPI

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
180 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
181 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
182 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
277 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
280 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
281 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
288 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
289 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
290 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
291 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
292 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
293 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
294 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.1
Nodule 0
Rhizoplane 10.82
Rhizosphere 68.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0656617 3300044842 Bacteria 738
2 JGI24737J22298_10068525 3300001990 Bacteria 1061
3 JGI24743J22301_10030107 3300001991 Bacteria 1067
4 JGI24748J21848_1010597 3300002074 Bacteria 1084
5 JGI24749J21850_1025796 3300002076 Bacteria 838
6 Ga0055540_1000267 3300003792 Bacteria 47207
7 Ga0055540_1001209 3300003792 Bacteria 15876
8 Ga0055540_1007110 3300003792 Bacteria 4293
9 Ga0070683_100595743 3300005329 Bacteria 1058
10 Ga0070690_100011720 3300005330 Bacteria 5138
11 Ga0070690_101240322 3300005330 Bacteria 596
12 Ga0070670_100113969 3300005331 Bacteria 2331
13 Ga0070677_10101312 3300005333 Bacteria 1270
14 Ga0070666_10079997 3300005335 Bacteria 2233
15 Ga0070666_10111277 3300005335 Bacteria 1894
16 Ga0070680_101330680 3300005336 Bacteria 622
17 Ga0070682_100012156 3300005337 Bacteria 4929
18 Ga0070682_100052218 3300005337 Bacteria 2557
19 Ga0070660_100183008 3300005339 Bacteria 1696
20 Ga0070689_100048967 3300005340 Bacteria 3261
21 Ga0070691_10071837 3300005341 Bacteria 1680
22 Ga0070691_10242769 3300005341 Bacteria 963
23 Ga0070687_100143312 3300005343 Bacteria 1394
24 Ga0070687_100153493 3300005343 Bacteria 1354
25 Ga0070692_10165444 3300005345 Bacteria 1271
26 Ga0070668_100000447 3300005347 Bacteria 27306
27 Ga0070668_100007556 3300005347 Bacteria 8066
28 Ga0070668_100341256 3300005347 Bacteria 1265
29 Ga0070669_100019278 3300005353 Bacteria 4873
30 Ga0070669_100162844 3300005353 Bacteria 1735
31 Ga0070675_100192233 3300005354 Bacteria 1769
32 Ga0070671_100004889 3300005355 Bacteria 10664
33 Ga0070671_100117937 3300005355 Bacteria 2232
34 Ga0070671_100903545 3300005355 Bacteria 771
35 Ga0070671_100939153 3300005355 Bacteria 756
36 Ga0070671_101508413 3300005355 Bacteria 595
37 Ga0070674_100003480 3300005356 Bacteria 8843
38 Ga0070674_100066779 3300005356 Bacteria 2528
39 Ga0070688_100067877 3300005365 Bacteria 2272
40 Ga0070688_100090072 3300005365 Bacteria 2003
41 Ga0070659_100625298 3300005366 Bacteria 927
42 Ga0070667_100365388 3300005367 Bacteria 1309
43 Ga0070667_100679728 3300005367 Bacteria 951
44 Ga0070709_10020741 3300005434 Bacteria 3819
45 Ga0070709_10039563 3300005434 Bacteria 2894
46 Ga0070709_10527878 3300005434 Bacteria 900
47 Ga0070714_100459075 3300005435 Bacteria 1211
48 Ga0070714_101007488 3300005435 Bacteria 810
49 Ga0070713_100499074 3300005436 Bacteria 1148
50 Ga0070710_10003154 3300005437 Bacteria 7813
51 Ga0070710_10039993 3300005437 Bacteria 2582
52 Ga0070701_10007374 3300005438 Bacteria 4694
53 Ga0070701_10284173 3300005438 Bacteria 1011
54 Ga0070711_100002364 3300005439 Bacteria 10724
55 Ga0070711_100014610 3300005439 Bacteria 4948
56 Ga0070705_100341282 3300005440 Bacteria 1089
57 Ga0070700_100008626 3300005441 Bacteria 5555
58 Ga0070663_100050842 3300005455 Bacteria 2949
59 Ga0070663_100160038 3300005455 Bacteria 1732
60 Ga0070663_100225484 3300005455 Bacteria 1473
61 Ga0070678_100009943 3300005456 Bacteria 5785
62 Ga0070678_101084263 3300005456 Bacteria 739
63 Ga0070662_100023486 3300005457 Bacteria 4236
64 Ga0068867_100022689 3300005459 Bacteria 4489
65 Ga0068867_100455883 3300005459 Bacteria 1091
66 Ga0070685_10016543 3300005466 Bacteria 3932
67 Ga0070685_10182162 3300005466 Bacteria 1353
68 Ga0070685_10312740 3300005466 Bacteria 1062
69 Ga0070706_100422189 3300005467 Bacteria 1241
70 Ga0068853_100003861 3300005539 Bacteria 11480
71 Ga0068853_100020362 3300005539 Bacteria 5516
72 Ga0068853_100170339 3300005539 Bacteria 1970
73 Ga0070672_100241173 3300005543 Bacteria 1520
74 Ga0070686_100619339 3300005544 Bacteria 855
75 Ga0070695_100130299 3300005545 Bacteria 1733
76 Ga0070696_100128180 3300005546 Bacteria 1843
77 Ga0070693_100020177 3300005547 Bacteria 3510
78 Ga0070693_100113248 3300005547 Bacteria 1672
79 Ga0070665_100004503 3300005548 Bacteria 14623
80 Ga0070665_100032208 3300005548 Bacteria 5276
81 Ga0070665_100057640 3300005548 Bacteria 3894
82 Ga0070704_100004980 3300005549 Bacteria 7716
83 Ga0070704_100187867 3300005549 Bacteria 1658
84 Ga0068855_100071001 3300005563 Bacteria 4050
85 Ga0068855_100162698 3300005563 Bacteria 2532
86 Ga0068854_100025029 3300005578 Bacteria 4094
87 Ga0068854_100256686 3300005578 Bacteria 1398
88 Ga0068854_100271613 3300005578 Bacteria 1361
89 Ga0068854_100858040 3300005578 Bacteria 795
90 Ga0070702_100035850 3300005615 Bacteria 2743
91 Ga0068852_100143951 3300005616 Bacteria 2209
92 Ga0068852_100295396 3300005616 Bacteria 1566
93 Ga0068852_100568702 3300005616 Bacteria 1135
94 Ga0068859_100040491 3300005617 Bacteria 4677
95 Ga0068859_100679336 3300005617 Bacteria 1121
96 Ga0068864_100296186 3300005618 Bacteria 1513
97 Ga0068866_10011572 3300005718 Bacteria 3821
98 Ga0068866_10018304 3300005718 Bacteria 3165
99 Ga0068861_100277617 3300005719 Bacteria 1441
100 Ga0068861_100427968 3300005719 Bacteria 1181
101 Ga0068851_10395321 3300005834 Bacteria 812
102 Ga0068863_100005557 3300005841 Bacteria 12393
103 Ga0068863_101246075 3300005841 Bacteria 750
104 Ga0068858_100024470 3300005842 Bacteria 5625
105 Ga0068858_100031905 3300005842 Bacteria 4895
106 Ga0068858_100225726 3300005842 Bacteria 1775
107 Ga0068860_100077019 3300005843 Bacteria 3171
108 Ga0068860_100353925 3300005843 Bacteria 1445
109 Ga0068860_100880014 3300005843 Bacteria 911
110 Ga0068862_100012206 3300005844 Bacteria 7101
111 Ga0068862_100097015 3300005844 Bacteria 2573
112 Ga0068862_100398511 3300005844 Bacteria 1287
113 Ga0081455_10054571 3300005937 Bacteria 3404
114 Ga0081455_10280809 3300005937 Bacteria 1203
115 Ga0081538_10045825 3300005981 Bacteria 2706
116 Ga0070717_10307157 3300006028 Bacteria 1411
117 Ga0075365_10003672 3300006038 Bacteria 7963
118 Ga0075365_10004330 3300006038 Bacteria 7499
119 Ga0075365_10165611 3300006038 Bacteria 1542
120 Ga0075365_10218481 3300006038 Bacteria 1337
121 Ga0075365_10275285 3300006038 Bacteria 1184
122 Ga0075365_10823423 3300006038 Bacteria 655
123 Ga0075365_10997555 3300006038 Bacteria 590
124 Ga0075363_100002337 3300006048 Bacteria 7709
125 Ga0075363_100003650 3300006048 Bacteria 6606
126 Ga0075363_100003972 3300006048 Bacteria 6392
127 Ga0075363_100037627 3300006048 Bacteria 2542
128 Ga0075363_100191823 3300006048 Bacteria 1166
129 Ga0075364_10000348 3300006051 Bacteria 22982
130 Ga0075364_10010701 3300006051 Bacteria 5548
131 Ga0075364_10022379 3300006051 Bacteria 3991
132 Ga0075364_10040813 3300006051 Bacteria 3010
133 Ga0075364_10180849 3300006051 Bacteria 1427
134 Ga0070715_10007393 3300006163 Bacteria 3781
135 Ga0070715_10044706 3300006163 Bacteria 1874
136 Ga0070716_100021554 3300006173 Bacteria 3397
137 Ga0070716_100023401 3300006173 Bacteria 3276
138 Ga0070716_100073076 3300006173 Bacteria 2022
139 Ga0070712_100005770 3300006175 Bacteria 7650
140 Ga0070712_100008182 3300006175 Bacteria 6568
141 Ga0075362_10043411 3300006177 Bacteria 1991
142 Ga0075362_10068377 3300006177 Bacteria 1618
143 Ga0075367_10041716 3300006178 Bacteria 2683
144 Ga0075367_10214334 3300006178 Bacteria 1204
145 Ga0075367_10535060 3300006178 Bacteria 744
146 Ga0075369_10000990 3300006186 Bacteria 9472
147 Ga0075369_10024146 3300006186 Bacteria 2517
148 Ga0075369_10026359 3300006186 Bacteria 2422
149 Ga0075369_10041253 3300006186 Bacteria 1975
150 Ga0075369_10050740 3300006186 Bacteria 1795
151 Ga0075369_10106068 3300006186 Bacteria 1264
152 Ga0075369_10252099 3300006186 Bacteria 820
153 Ga0097621_100313195 3300006237 Bacteria 1389
154 Ga0075370_10022374 3300006353 Bacteria 3470
155 Ga0075370_10132621 3300006353 Bacteria 1454
156 Ga0075370_10175041 3300006353 Bacteria 1262
157 Ga0075370_10185870 3300006353 Bacteria 1223
158 Ga0068871_100382261 3300006358 Bacteria 1251
159 Ga0075428_100001622 3300006844 Bacteria 24034
160 Ga0075430_100012434 3300006846 Bacteria 7242
161 Ga0075430_100419210 3300006846 Bacteria 1105
162 Ga0068865_100018190 3300006881 Bacteria 4532
163 Ga0068865_100025095 3300006881 Bacteria 3917
164 Ga0097620_100040490 3300006931 Bacteria 4677
165 Ga0097620_100679382 3300006931 Bacteria 1121
166 Ga0105251_10361460 3300009011 Bacteria 663
167 Ga0105240_10226322 3300009093 Bacteria 2176
168 Ga0105245_10058764 3300009098 Bacteria 3462
169 Ga0105245_10117075 3300009098 Bacteria 2485
170 Ga0105245_10697086 3300009098 Bacteria 1048
171 Ga0105247_10012866 3300009101 Bacteria 5022
172 Ga0105247_10091976 3300009101 Bacteria 1927
173 Ga0105247_10121316 3300009101 Bacteria 1694
174 Ga0114129_10031389 3300009147 Bacteria 7510
175 Ga0105243_10023403 3300009148 Bacteria 4704
176 Ga0105243_10455537 3300009148 Bacteria 1201
177 Ga0105242_10008470 3300009176 Bacteria 7901
178 Ga0105242_10083786 3300009176 Bacteria 2671
179 Ga0105242_10271454 3300009176 Bacteria 1536
180 Ga0105242_10299794 3300009176 Bacteria 1466
181 Ga0105248_10014769 3300009177 Bacteria 8599
182 Ga0105248_10018088 3300009177 Bacteria 7781
183 Ga0105248_10355365 3300009177 Bacteria 1650
184 Ga0105237_10002125 3300009545 Bacteria 24943
185 Ga0105237_10296930 3300009545 Bacteria 1618
186 Ga0105238_10793002 3300009551 Bacteria 963
187 Ga0105238_11525942 3300009551 Bacteria 697
188 Ga0105249_10007470 3300009553 Bacteria 9537
189 Ga0105249_10091350 3300009553 Bacteria 2848
190 Ga0105239_10002759 3300010375 Bacteria 22044
191 Ga0105239_10292014 3300010375 Bacteria 1836
192 Ga0105239_10302168 3300010375 Bacteria 1802
193 Ga0105239_10540291 3300010375 Bacteria 1327
194 Ga0105246_10046713 3300011119 Bacteria 2955
195 Ga0157374_10397877 3300013296 Bacteria 1374
196 Ga0157374_10419029 3300013296 Bacteria 1338
197 Ga0157374_12001967 3300013296 Bacteria 605
198 Ga0157378_10346081 3300013297 Bacteria 1451
199 Ga0157378_10544110 3300013297 Bacteria 1165
200 Ga0163162_10018320 3300013306 Bacteria 6858
201 Ga0163162_10294139 3300013306 Bacteria 1755
202 Ga0163162_10473044 3300013306 Bacteria 1385
203 Ga0157372_10050467 3300013307 Bacteria 4628
204 Ga0157372_10420803 3300013307 Bacteria 1557
205 Ga0157375_10052121 3300013308 Bacteria 4021
206 Ga0157375_10114359 3300013308 Bacteria 2800
207 Ga0157375_11757921 3300013308 Bacteria 735
208 Ga0163163_10043812 3300014325 Bacteria 4389
209 Ga0163163_10254489 3300014325 Bacteria 1807
210 Ga0163163_10313982 3300014325 Bacteria 1621
211 Ga0163163_10423816 3300014325 Bacteria 1390
212 Ga0157380_10055238 3300014326 Bacteria 3153
213 Ga0182008_10053667 3300014497 Bacteria 1995
214 Ga0157379_10010060 3300014968 Bacteria 8242
215 Ga0157379_10086396 3300014968 Bacteria 2813
216 Ga0157376_10106172 3300014969 Bacteria 2463
217 Ga0157376_11020060 3300014969 Bacteria 851
218 Ga0163161_10004715 3300017792 Bacteria 9483
219 Ga0163161_10196662 3300017792 Bacteria 1552
220 Ga0163161_11018967 3300017792 Bacteria 708
221 Ga0213876_10000968 3300021384 Bacteria 18867
222 Ga0213876_10004135 3300021384 Bacteria 8150
223 Ga0213876_10485421 3300021384 Bacteria 657
224 Ga0213875_10017757 3300021388 Bacteria 3433
225 Ga0213875_10029005 3300021388 Bacteria 2624
226 Ga0213875_10226956 3300021388 Bacteria 880
227 Ga0209673_1007760 3300025273 Bacteria 4880
228 Ga0209051_1000782 3300025303 Bacteria 33613
229 Ga0209051_1002976 3300025303 Bacteria 11539
230 Ga0209051_1003729 3300025303 Bacteria 9809
231 Ga0209051_1056418 3300025303 Bacteria 1267
232 Ga0207696_1066497 3300025711 Bacteria 1007
233 Ga0207692_10026672 3300025898 Bacteria 2712
234 Ga0207692_10050438 3300025898 Bacteria 2105
235 Ga0207642_10005465 3300025899 Bacteria 4151
236 Ga0207710_10085725 3300025900 Bacteria 1467
237 Ga0207710_10125721 3300025900 Bacteria 1228
238 Ga0207688_10010481 3300025901 Bacteria 5042
239 Ga0207680_10035772 3300025903 Bacteria 2855
240 Ga0207680_10733747 3300025903 Bacteria 708
241 Ga0207647_10101753 3300025904 Bacteria 1704
242 Ga0207705_10770918 3300025909 Bacteria 747
243 Ga0207654_10081063 3300025911 Bacteria 1953
244 Ga0207671_10003644 3300025914 Bacteria 15213
245 Ga0207671_10544966 3300025914 Bacteria 925
246 Ga0207693_10002085 3300025915 Bacteria 17474
247 Ga0207693_10002333 3300025915 Bacteria 16495
248 Ga0207663_10152800 3300025916 Bacteria 1621
249 Ga0207663_10157758 3300025916 Bacteria 1598
250 Ga0207662_10129389 3300025918 Bacteria 1590
251 Ga0207662_11204709 3300025918 Bacteria 538
252 Ga0207657_10182418 3300025919 Bacteria 1696
253 Ga0207681_10010048 3300025923 Bacteria 5794
254 Ga0207681_10269854 3300025923 Bacteria 1335
255 Ga0207650_10048698 3300025925 Bacteria 3126
256 Ga0207659_10333735 3300025926 Bacteria 1254
257 Ga0207664_10062711 3300025929 Bacteria 2969
258 Ga0207664_10727170 3300025929 Bacteria 893
259 Ga0207664_11448561 3300025929 Bacteria 608
260 Ga0207644_10021702 3300025931 Bacteria 4378
261 Ga0207644_10175842 3300025931 Bacteria 1675
262 Ga0207644_10246253 3300025931 Bacteria 1425
263 Ga0207644_10273297 3300025931 Bacteria 1355
264 Ga0207690_10710814 3300025932 Bacteria 827
265 Ga0207706_10143664 3300025933 Bacteria 2099
266 Ga0207686_10009396 3300025934 Bacteria 5305
267 Ga0207686_10147512 3300025934 Bacteria 1634
268 Ga0207686_10452987 3300025934 Bacteria 987
269 Ga0207686_10484990 3300025934 Bacteria 956
270 Ga0207670_10456295 3300025936 Bacteria 1031
271 Ga0207669_10130953 3300025937 Bacteria 1723
272 Ga0207669_10148687 3300025937 Bacteria 1637
273 Ga0207669_10183240 3300025937 Bacteria 1503
274 Ga0207704_10210655 3300025938 Bacteria 1430
275 Ga0207704_10349849 3300025938 Bacteria 1150
276 Ga0207665_10017940 3300025939 Bacteria 4652
277 Ga0207665_10042510 3300025939 Bacteria 3038
278 Ga0207691_10035092 3300025940 Bacteria 4659
279 Ga0207711_10016150 3300025941 Bacteria 6197
280 Ga0207689_10008196 3300025942 Bacteria 9104
281 Ga0207689_10355255 3300025942 Bacteria 1218
282 Ga0207661_10224144 3300025944 Bacteria 1663
283 Ga0207667_10140519 3300025949 Bacteria 2486
284 Ga0207667_10825789 3300025949 Bacteria 922
285 Ga0207712_10023690 3300025961 Bacteria 4055
286 Ga0207712_10420300 3300025961 Bacteria 1128
287 Ga0207668_10000690 3300025972 Bacteria 20691
288 Ga0207668_10009326 3300025972 Bacteria 5875
289 Ga0207668_10016999 3300025972 Bacteria 4552
290 Ga0207640_10027159 3300025981 Bacteria 3485
291 Ga0207640_10562762 3300025981 Bacteria 960
292 Ga0207658_10095322 3300025986 Bacteria 2318
293 Ga0207658_10155676 3300025986 Bacteria 1867
294 Ga0207658_10516556 3300025986 Bacteria 1065
295 Ga0207677_10058268 3300026023 Bacteria 2658
296 Ga0207703_10198054 3300026035 Bacteria 1783
297 Ga0207639_10003204 3300026041 Bacteria 11000
298 Ga0207639_10034214 3300026041 Bacteria 3754
299 Ga0207678_10156227 3300026067 Bacteria 1948
300 Ga0207678_10306599 3300026067 Bacteria 1365
301 Ga0207708_10012920 3300026075 Bacteria 6226
302 Ga0207708_10018954 3300026075 Bacteria 5182
303 Ga0207641_10032676 3300026088 Bacteria 4321
304 Ga0207641_11277493 3300026088 Bacteria 734
305 Ga0207641_11514765 3300026088 Bacteria 672
306 Ga0207648_10014442 3300026089 Bacteria 7299
307 Ga0207648_10063524 3300026089 Bacteria 3218
308 Ga0207648_10710101 3300026089 Bacteria 932
309 Ga0207676_10424970 3300026095 Bacteria 1247
310 Ga0207676_10656562 3300026095 Bacteria 1013
311 Ga0207675_100004794 3300026118 Bacteria 13030
312 Ga0207675_100294288 3300026118 Bacteria 1580
313 Ga0207683_10000387 3300026121 Bacteria 40593
314 Ga0207683_10073499 3300026121 Bacteria 3025
315 Ga0207683_10373743 3300026121 Bacteria 1310
316 Ga0207698_10096630 3300026142 Bacteria 2435
317 Ga0207698_10280433 3300026142 Bacteria 1541
318 Ga0207428_10744720 3300027907 Bacteria 699
319 Ga0268266_10001713 3300028379 Bacteria 25110
320 Ga0268266_10110056 3300028379 Bacteria 2440
321 Ga0268266_10117003 3300028379 Bacteria 2368
322 Ga0268265_10360147 3300028380 Bacteria 1331
323 Ga0268264_10022314 3300028381 Bacteria 5169
324 Ga0268264_10130502 3300028381 Bacteria 2227
325 Ga0307413_10082374 3300031824 Bacteria 2067
326 Ga0307406_10059000 3300031901 Bacteria 2468
327 Ga0307407_10182845 3300031903 Bacteria 1391
328 Ga0307412_10598905 3300031911 Bacteria 933
329 Ga0307416_100969553 3300032002 Bacteria 953
330 Ga0307414_10864087 3300032004 Bacteria 828
331 Ga0373932_0187685 3300035112 Bacteria 729
332 Ga0373939_0089635 3300035114 Bacteria 1037
333 Ga0373931_0010014 3300035691 Bacteria 4545
334 Ga0436364_0471391 3300037853 Bacteria 8920
335 Ga0436364_0824285 3300037853 Bacteria 3125
336 Ga0436364_0986089 3300037853 Bacteria 651
337 Ga0436365_0235441 3300039437 Bacteria 2606
338 Ga0436365_1135069 3300039437 Bacteria 31467
339 Ga0436365_1136958 3300039437 Bacteria 16538
340 Ga0436365_1787742 3300039437 Bacteria 22817
341 Ga0436363_0238466 3300039450 Bacteria 2529
342 Ga0436363_0867395 3300039450 Bacteria 1412
343 Ga0439461_0000115 3300041410 Bacteria 10498
344 Ga0439466_0007627 3300041411 Bacteria 4087
345 Ga0439466_0020450 3300041411 Bacteria 2359
346 Ga0439466_0027711 3300041411 Bacteria 1961
347 Ga0439465_0001135 3300041413 Bacteria 8524
348 Ga0439465_0005672 3300041413 Bacteria 3974
349 Ga0439465_0017810 3300041413 Bacteria 2219
350 Ga0439465_0071626 3300041413 Bacteria 1162
351 Ga0451787_526604 3300041441 Bacteria 622
352 Ga0451793_1165438 3300041452 Bacteria 962
353 Ga0451795_0888358 3300041456 Bacteria 1191
354 Ga0451795_1481268 3300041456 Bacteria 621
355 Ga0451800_1277064 3300041459 Bacteria 1086
356 Ga0451802_0149405 3300041460 Bacteria 1555
357 Ga0451835_0721566 3300041492 Bacteria 607
358 Ga0451839_0031703 3300041496 Bacteria 742
359 Ga0451841_1270627 3300041498 Bacteria 1074
360 Ga0451851_0369480 3300041507 Bacteria 733
361 Ga0451853_0510433 3300041512 Bacteria 1031
362 Ga0451853_2100554 3300041512 Bacteria 839
363 Ga0439431_0010449 3300041997 Bacteria 2107
364 Ga0439431_0056226 3300041997 Bacteria 1029
365 Ga0439431_0086396 3300041997 Bacteria 851
366 Ga0439442_147154 3300042002 Bacteria 523
367 Ga0439445_0001416 3300042004 Bacteria 5217
368 Ga0439446_0277771 3300042156 Bacteria 583
369 Ga0439434_0013923 3300042435 Bacteria 2390
370 Ga0439459_0018224 3300042438 Bacteria 1317
371 Ga0466969_0071819 3300044656 Bacteria 1664
372 Ga0466969_0263317 3300044656 Bacteria 781
373 Ga0466972_0004921 3300044658 Bacteria 6704
374 Ga0466972_0010684 3300044658 Bacteria 4606
375 Ga0466972_0176673 3300044658 Bacteria 1001
376 Ga0466965_0002806 3300044683 Bacteria 7503
377 Ga0466965_0004065 3300044683 Bacteria 6491
378 Ga0466966_0006372 3300044684 Bacteria 7804
379 Ga0466966_0037063 3300044684 Bacteria 3146
380 Ga0466966_0294376 3300044684 Bacteria 976
381 Ga0466961_0019556 3300044693 Bacteria 4356
382 Ga0466961_0345294 3300044693 Bacteria 906
383 Ga0466963_0129241 3300044694 Bacteria 1744
384 Ga0466963_0186630 3300044694 Bacteria 1448
385 Ga0466963_0268952 3300044694 Bacteria 1197
386 Ga0466963_1146569 3300044694 Bacteria 547
387 Ga0466964_0007160 3300044706 Bacteria 4170
388 Ga0466964_0017763 3300044706 Bacteria 2725
389 Ga0466971_0011961 3300044719 Bacteria 3803
390 Ga0466971_0102314 3300044719 Bacteria 1317
391 Ga0466971_0152758 3300044719 Bacteria 1078
392 Ga0466968_0003767 3300044735 Bacteria 5617
393 Ga0466968_0041254 3300044735 Bacteria 1947
394 Ga0466968_0056576 3300044735 Bacteria 1685
395 Ga0466970_0017983 3300044765 Bacteria 3658
396 Ga0466970_0052151 3300044765 Bacteria 2183
397 Ga0466970_0067138 3300044765 Bacteria 1925
398 Ga0466970_0083754 3300044765 Bacteria 1726
399 Ga0466957_0003658 3300044842 Bacteria 8481
400 Ga0466957_0003802 3300044842 Bacteria 8345
401 Ga0466957_0018413 3300044842 Bacteria 4102
402 Ga0466957_1292894 3300044842 Bacteria 529
403 Ga0466960_0000300 3300044901 Bacteria 17233
404 Ga0466960_0003280 3300044901 Bacteria 6203
405 Ga0466960_0008150 3300044901 Bacteria 4282
406 Ga0466960_0025006 3300044901 Bacteria 2699
407 Ga0466959_0024328 3300045049 Bacteria 4485
408 Ga0466959_0024686 3300045049 Bacteria 4454
409 Ga0466959_0065461 3300045049 Bacteria 2637
410 Ga0466959_0116424 3300045049 Bacteria 1903
411 Ga0466958_0015444 3300045836 Bacteria 4375
412 Ga0466958_0172134 3300045836 Bacteria 1371
413 Ga0466958_0219641 3300045836 Bacteria 1212
414 Ga0466958_0343713 3300045836 Bacteria 960
415 Ga0466967_0004352 3300045976 Bacteria 9533
416 Ga0466967_0016121 3300045976 Bacteria 5882
417 Ga0466967_0080636 3300045976 Bacteria 2937
418 Ga0466967_0119550 3300045976 Bacteria 2432
419 Ga0466967_0426223 3300045976 Bacteria 1294
420 Ga0466967_0666268 3300045976 Bacteria 1030
421 Ga0466967_0933898 3300045976 Bacteria 863
422 Ga0466967_1226254 3300045976 Bacteria 747
423 Ga0495638_0063000 3300046460 Bacteria 2287
424 Ga0495606_0010366 3300046507 Bacteria 7745
425 Ga0495616_0192109 3300046513 Bacteria 902
426 Ga0495648_0000803 3300046524 Bacteria 33249
427 Ga0495654_0179930 3300046530 Bacteria 916
428 Ga0495668_0032642 3300046616 Bacteria 2928
429 Ga0495611_0134549 3300046648 Bacteria 1153
430 Ga0495625_0216165 3300046660 Bacteria 1258
431 Ga0495625_0238468 3300046660 Bacteria 1185
432 Ga0495635_0102247 3300046663 Bacteria 1959
433 Ga0495671_0146675 3300046692 Bacteria 1149
434 Ga0495649_0082094 3300046694 Bacteria 1723
435 Ga0495649_0356253 3300046694 Bacteria 739
436 Ga0495672_0001070 3300047320 Bacteria 27877
437 Ga0495673_0000888 3300047469 Bacteria 27514
438 Ga0495686_0002129 3300047472 Bacteria 19374
439 Ga0496100_0000278 3300048903 Bacteria 25850
440 Ga0496100_0015798 3300048903 Bacteria 4415
441 Ga0496100_0161023 3300048903 Bacteria 1609
442 Ga0496100_0266366 3300048903 Bacteria 1272
443 Ga0496101_0000201 3300048904 Bacteria 45817
444 Ga0496101_0003145 3300048904 Bacteria 10216
445 Ga0496101_0034455 3300048904 Bacteria 3576
446 Ga0496101_0053805 3300048904 Bacteria 2905
447 Ga0496101_0083109 3300048904 Bacteria 2370
448 Ga0496101_0204403 3300048904 Bacteria 1528
449 Ga0496102_0000065 3300048905 Bacteria 161370
450 Ga0496102_0018362 3300048905 Bacteria 6144
451 Ga0496102_0067984 3300048905 Bacteria 3268
452 Ga0496102_0074034 3300048905 Bacteria 3130
453 Ga0496102_0245424 3300048905 Bacteria 1688
454 Ga0496103_0000048 3300048906 Bacteria 160911
455 Ga0496103_0010967 3300048906 Bacteria 5364
456 Ga0496103_0027818 3300048906 Bacteria 3429
457 Ga0496103_0142872 3300048906 Bacteria 1531
458 Ga0496103_0581046 3300048906 Bacteria 714
459 Ga0496104_0109757 3300048907 Bacteria 2644
460 Ga0496104_0154349 3300048907 Bacteria 2204
461 Ga0496104_0334939 3300048907 Bacteria 1426
462 Ga0496104_1855058 3300048907 Bacteria 505
463 Ga0496105_0039261 3300048908 Bacteria 3902
464 Ga0496105_0126230 3300048908 Bacteria 2109
465 Ga0496105_0143342 3300048908 Bacteria 1966
466 Ga0496105_0296064 3300048908 Bacteria 1302
467 Ga0496106_0006355 3300048909 Bacteria 8751
468 Ga0496106_0052078 3300048909 Bacteria 3087
469 Ga0496106_0236814 3300048909 Bacteria 1458
470 Ga0496107_0025597 3300048910 Bacteria 4178
471 Ga0496107_0031701 3300048910 Bacteria 3774
472 Ga0496107_0141996 3300048910 Bacteria 1775
473 Ga0496107_0352552 3300048910 Bacteria 1095
474 Ga0496107_0579796 3300048910 Bacteria 830
475 Ga0496108_0000184 3300048911 Bacteria 57740
476 Ga0496108_0036201 3300048911 Bacteria 4106
477 Ga0496108_0037509 3300048911 Bacteria 4037
478 Ga0496108_0180481 3300048911 Bacteria 1828
479 Ga0496109_0001517 3300048912 Bacteria 19312
480 Ga0496109_0031311 3300048912 Bacteria 4773
481 Ga0496109_0425481 3300048912 Bacteria 1254
482 Ga0496109_0474398 3300048912 Bacteria 1181
483 Ga0496110_0023012 3300048913 Bacteria 5298
484 Ga0496110_0323068 3300048913 Bacteria 1406
485 Ga0496110_0869211 3300048913 Bacteria 807
486 Ga0496111_0356723 3300048914 Bacteria 1082
487 Ga0496112_0000990 3300048915 Bacteria 20779
488 Ga0496112_0017854 3300048915 Bacteria 6678
489 Ga0496112_0042591 3300048915 Bacteria 4442
490 Ga0496112_0093221 3300048915 Bacteria 2982
491 Ga0496112_0344241 3300048915 Bacteria 1434
492 Ga0496113_0382387 3300048916 Bacteria 1130
493 Ga0496114_0005647 3300048917 Bacteria 9810
494 Ga0496114_0010551 3300048917 Bacteria 7351
495 Ga0496114_0147879 3300048917 Bacteria 2037
496 Ga0496115_0098929 3300048918 Bacteria 2389
497 Ga0496115_0192055 3300048918 Bacteria 1687
498 Ga0496115_1284704 3300048918 Bacteria 546
499 Ga0496116_0000125 3300048919 Bacteria 160885
500 Ga0496117_0000111 3300048920 Bacteria 184570
501 Ga0496118_0000083 3300048921 Bacteria 184570
502 Ga0496118_0000697 3300048921 Bacteria 54602
503 Ga0496118_0355844 3300048921 Bacteria 778
504 Ga0496119_0006294 3300048922 Bacteria 11064
505 Ga0496120_0015818 3300048923 Bacteria 4957
506 Ga0496121_0001000 3300048924 Bacteria 50532
507 Ga0496122_0049729 3300048925 Bacteria 3205
508 Ga0496123_0009951 3300048926 Bacteria 8478
509 Ga0496126_0001376 3300048929 Bacteria 38453
510 Ga0496126_0001532 3300048929 Bacteria 35585
511 Ga0496126_0014847 3300048929 Bacteria 7856
512 Ga0496126_0061929 3300048929 Bacteria 3359
513 Ga0496126_0526115 3300048929 Bacteria 942
514 Ga0501032_0018378 3300049569 Bacteria 4898
515 Ga0501032_0201070 3300049569 Bacteria 1300
516 Ga0501033_0191154 3300049570 Bacteria 1465
517 Ga0501034_0000766 3300049571 Bacteria 48089
518 Ga0501034_0047126 3300049571 Bacteria 4354
519 Ga0501034_0097809 3300049571 Bacteria 2931
520 Ga0501036_0532939 3300049572 Bacteria 976
521 Ga0501037_0030430 3300049573 Bacteria 3989
522 Ga0501038_0004079 3300049574 Bacteria 13584
523 Ga0501038_0312051 3300049574 Bacteria 1232
524 Ga0501039_0014274 3300049575 Bacteria 6081
525 Ga0501043_0031331 3300049579 Bacteria 4180
526 Ga0501043_0921466 3300049579 Bacteria 626
527 Ga0501046_0002113 3300049580 Bacteria 18804
528 Ga0501046_0254579 3300049580 Bacteria 1291
529 Ga0501047_0019294 3300049581 Bacteria 6541
530 Ga0501047_0887270 3300049581 Bacteria 705
531 Ga0501048_0003012 3300049582 Bacteria 12859
532 Ga0501067_0026228 3300049583 Bacteria 3229
533 Ga0501069_0254276 3300049585 Bacteria 1025
534 Ga0501070_0002094 3300049586 Bacteria 17504
535 Ga0501070_0025645 3300049586 Bacteria 4945
536 Ga0501070_0050712 3300049586 Bacteria 3444
537 Ga0501070_0673417 3300049586 Bacteria 820
538 Ga0501073_0328546 3300049589 Bacteria 1056
539 Ga0501077_0148373 3300049593 Bacteria 1488
540 Ga0501080_0015047 3300049742 Bacteria 7129
541 Ga0501080_0505535 3300049742 Bacteria 1080
542 Ga0501035_0001757 3300049822 Bacteria 21882
543 Ga0501035_0004921 3300049822 Bacteria 12672
544 Ga0501044_0002890 3300049823 Bacteria 19564
545 Ga0501044_0006725 3300049823 Bacteria 12678
546 Ga0501044_0292238 3300049823 Bacteria 1561
547 Ga0501044_0467819 3300049823 Bacteria 1165
548 nmdc:mga03683_55190_c1 3300050489 Bacteria 1668
549 nmdc:mga03n38_3550_c1 3300050490 Bacteria 5034
550 nmdc:mga03n38_39757_c1 3300050490 Bacteria 2041
551 nmdc:mga03n38_488259_c1 3300050490 Bacteria 690
552 nmdc:mga03n38_5218_c1 3300050490 Bacteria 4401
553 nmdc:mga00v17_15946_c1 3300050491 Bacteria 4227
554 nmdc:mga00v17_271399_c1 3300050491 Bacteria 1101
555 nmdc:mga00v17_36619_c1 3300050491 Bacteria 2926
556 nmdc:mga00v17_8519_c1 3300050491 Bacteria 5519
557 nmdc:mga00v17_8566_c1 3300050491 Bacteria 5505
558 nmdc:mga0yw44_176355_c1 3300050492 Bacteria 1405
559 nmdc:mga0yw44_234920_c1 3300050492 Bacteria 1217
560 nmdc:mga0yw44_237646_c1 3300050492 Bacteria 1210
561 nmdc:mga0yw44_2910_c1 3300050492 Bacteria 7447
562 nmdc:mga0yw44_7515_c1 3300050492 Bacteria 5367
563 nmdc:mga0yw44_878883_c1 3300050492 Bacteria 608
564 nmdc:mga06z11_175040_c1 3300050494 Bacteria 1234
565 nmdc:mga06z11_21884_c1 3300050494 Bacteria 2977
566 nmdc:mga06z11_254395_c1 3300050494 Bacteria 1035
567 nmdc:mga06z11_46607_c1 3300050494 Bacteria 2198
568 nmdc:mga04h51_19306_c1 3300050495 Bacteria 2019
569 nmdc:mga07m45_174307_c1 3300050496 Bacteria 1250
570 nmdc:mga07m45_203471_c1 3300050496 Bacteria 1152
571 nmdc:mga07m45_26314_c1 3300050496 Bacteria 3197
572 nmdc:mga07m45_54090_c1 3300050496 Bacteria 2269
573 nmdc:mga05p37_291361_c1 3300050507 Bacteria 1943
574 nmdc:mga09592_992770_c1 3300050508 Bacteria 702
575 nmdc:mga0qj67_2463_c1 3300050509 Bacteria 13183
576 nmdc:mga0qj67_366163_c1 3300050509 Bacteria 1164
577 nmdc:mga08y16_627140_c1 3300050511 Bacteria 1081
578 nmdc:mga0sz30_128515_c1 3300050516 Bacteria 1116
579 nmdc:mga0sz30_129334_c1 3300050516 Bacteria 1112
580 nmdc:mga0sz30_15444_c1 3300050516 Bacteria 3018
581 nmdc:mga0sz30_202628_c1 3300050516 Bacteria 881
582 nmdc:mga0sz30_215254_c1 3300050516 Bacteria 854
583 nmdc:mga0sz30_29945_c1 3300050516 Bacteria 2247
584 nmdc:mga0sz30_49930_c1 3300050516 Bacteria 1773
585 nmdc:mga0sz30_5395_c1 3300050516 Bacteria 4688
586 nmdc:mga0sz30_5964_c1 3300050516 Bacteria 4495
587 Ga0500635_0016858 3300053080 Bacteria 2179
588 Ga0495655_0037391 3300053083 Bacteria 1219
589 Ga0495655_0125544 3300053083 Bacteria 785
590 Ga0500643_004613 3300053087 Bacteria 6158
591 Ga0500644_0067381 3300053088 Bacteria 1280
592 Ga0500641_0051309 3300053096 Bacteria 1697
593 Ga0500628_111428 3300053129 Bacteria 734
594 Ga0500642_0099754 3300053130 Bacteria 1349
595 Ga0500652_000533 3300053131 Bacteria 13408
596 Ga0500568_0077396 3300053139 Bacteria 1266
597 Ga0500577_0045210 3300053142 Bacteria 1626
598 Ga0500616_0042694 3300053153 Bacteria 2427
599 Ga0500627_0086472 3300053158 Bacteria 1401
600 Ga0466962_0002167 3300061719 Bacteria 9282
601 Ga0466962_0008299 3300061719 Bacteria 4976
602 Ga0466962_0046936 3300061719 Bacteria 2064
603 2644491328 2643221687 Bacteria 6500351
604 2644636471 2643221715 Bacteria 6671032
605 2902797131 2902792274 Bacteria 7270173
606 2902804207 2902799365 Bacteria 5419524
607 2902814444 2902810491 Bacteria 6794147
608 2902839171 2902837492 Bacteria 6697721
609 2929217972 2929212328 Bacteria 7708288
610 2939585216 2939582691 Bacteria 7088898
611 Ga0466957_0656617
612 JGI24737J22298_10068525
613 JGI24743J22301_10030107
614 JGI24748J21848_1010597
615 JGI24749J21850_1025796
616 Ga0055540_1000267
617 Ga0055540_1001209
618 Ga0055540_1007110
619 Ga0070683_100595743
620 Ga0070690_100011720
621 Ga0070690_101240322
622 Ga0070670_100113969
623 Ga0070677_10101312
624 Ga0070666_10079997
625 Ga0070666_10111277
626 Ga0070680_101330680
627 Ga0070682_100012156
628 Ga0070682_100052218
629 Ga0070660_100183008
630 Ga0070689_100048967
631 Ga0070691_10071837
632 Ga0070691_10242769
633 Ga0070687_100143312
634 Ga0070687_100153493
635 Ga0070692_10165444
636 Ga0070668_100000447
637 Ga0070668_100007556
638 Ga0070668_100341256
639 Ga0070669_100019278
640 Ga0070669_100162844
641 Ga0070675_100192233
642 Ga0070671_100004889
643 Ga0070671_100117937
644 Ga0070671_100903545
645 Ga0070671_100939153
646 Ga0070671_101508413
647 Ga0070674_100003480
648 Ga0070674_100066779
649 Ga0070688_100067877
650 Ga0070688_100090072
651 Ga0070659_100625298
652 Ga0070667_100365388
653 Ga0070667_100679728
654 Ga0070709_10020741
655 Ga0070709_10039563
656 Ga0070709_10527878
657 Ga0070714_100459075
658 Ga0070714_101007488
659 Ga0070713_100499074
660 Ga0070710_10003154
661 Ga0070710_10039993
662 Ga0070701_10007374
663 Ga0070701_10284173
664 Ga0070711_100002364
665 Ga0070711_100014610
666 Ga0070705_100341282
667 Ga0070700_100008626
668 Ga0070663_100050842
669 Ga0070663_100160038
670 Ga0070663_100225484
671 Ga0070678_100009943
672 Ga0070678_101084263
673 Ga0070662_100023486
674 Ga0068867_100022689
675 Ga0068867_100455883
676 Ga0070685_10016543
677 Ga0070685_10182162
678 Ga0070685_10312740
679 Ga0070706_100422189
680 Ga0068853_100003861
681 Ga0068853_100020362
682 Ga0068853_100170339
683 Ga0070672_100241173
684 Ga0070686_100619339
685 Ga0070695_100130299
686 Ga0070696_100128180
687 Ga0070693_100020177
688 Ga0070693_100113248
689 Ga0070665_100004503
690 Ga0070665_100032208
691 Ga0070665_100057640
692 Ga0070704_100004980
693 Ga0070704_100187867
694 Ga0068855_100071001
695 Ga0068855_100162698
696 Ga0068854_100025029
697 Ga0068854_100256686
698 Ga0068854_100271613
699 Ga0068854_100858040
700 Ga0070702_100035850
701 Ga0068852_100143951
702 Ga0068852_100295396
703 Ga0068852_100568702
704 Ga0068859_100040491
705 Ga0068859_100679336
706 Ga0068864_100296186
707 Ga0068866_10011572
708 Ga0068866_10018304
709 Ga0068861_100277617
710 Ga0068861_100427968
711 Ga0068851_10395321
712 Ga0068863_100005557
713 Ga0068863_101246075
714 Ga0068858_100024470
715 Ga0068858_100031905
716 Ga0068858_100225726
717 Ga0068860_100077019
718 Ga0068860_100353925
719 Ga0068860_100880014
720 Ga0068862_100012206
721 Ga0068862_100097015
722 Ga0068862_100398511
723 Ga0081455_10054571
724 Ga0081455_10280809
725 Ga0081538_10045825
726 Ga0070717_10307157
727 Ga0075365_10003672
728 Ga0075365_10004330
729 Ga0075365_10165611
730 Ga0075365_10218481
731 Ga0075365_10275285
732 Ga0075365_10823423
733 Ga0075365_10997555
734 Ga0075363_100002337
735 Ga0075363_100003650
736 Ga0075363_100003972
737 Ga0075363_100037627
738 Ga0075363_100191823
739 Ga0075364_10000348
740 Ga0075364_10010701
741 Ga0075364_10022379
742 Ga0075364_10040813
743 Ga0075364_10180849
744 Ga0070715_10007393
745 Ga0070715_10044706
746 Ga0070716_100021554
747 Ga0070716_100023401
748 Ga0070716_100073076
749 Ga0070712_100005770
750 Ga0070712_100008182
751 Ga0075362_10043411
752 Ga0075362_10068377
753 Ga0075367_10041716
754 Ga0075367_10214334
755 Ga0075367_10535060
756 Ga0075369_10000990
757 Ga0075369_10024146
758 Ga0075369_10026359
759 Ga0075369_10041253
760 Ga0075369_10050740
761 Ga0075369_10106068
762 Ga0075369_10252099
763 Ga0097621_100313195
764 Ga0075370_10022374
765 Ga0075370_10132621
766 Ga0075370_10175041
767 Ga0075370_10185870
768 Ga0068871_100382261
769 Ga0075428_100001622
770 Ga0075430_100012434
771 Ga0075430_100419210
772 Ga0068865_100018190
773 Ga0068865_100025095
774 Ga0097620_100040490
775 Ga0097620_100679382
776 Ga0105251_10361460
777 Ga0105240_10226322
778 Ga0105245_10058764
779 Ga0105245_10117075
780 Ga0105245_10697086
781 Ga0105247_10012866
782 Ga0105247_10091976
783 Ga0105247_10121316
784 Ga0114129_10031389
785 Ga0105243_10023403
786 Ga0105243_10455537
787 Ga0105242_10008470
788 Ga0105242_10083786
789 Ga0105242_10271454
790 Ga0105242_10299794
791 Ga0105248_10014769
792 Ga0105248_10018088
793 Ga0105248_10355365
794 Ga0105237_10002125
795 Ga0105237_10296930
796 Ga0105238_10793002
797 Ga0105238_11525942
798 Ga0105249_10007470
799 Ga0105249_10091350
800 Ga0105239_10002759
801 Ga0105239_10292014
802 Ga0105239_10302168
803 Ga0105239_10540291
804 Ga0105246_10046713
805 Ga0157374_10397877
806 Ga0157374_10419029
807 Ga0157374_12001967
808 Ga0157378_10346081
809 Ga0157378_10544110
810 Ga0163162_10018320
811 Ga0163162_10294139
812 Ga0163162_10473044
813 Ga0157372_10050467
814 Ga0157372_10420803
815 Ga0157375_10052121
816 Ga0157375_10114359
817 Ga0157375_11757921
818 Ga0163163_10043812
819 Ga0163163_10254489
820 Ga0163163_10313982
821 Ga0163163_10423816
822 Ga0157380_10055238
823 Ga0182008_10053667
824 Ga0157379_10010060
825 Ga0157379_10086396
826 Ga0157376_10106172
827 Ga0157376_11020060
828 Ga0163161_10004715
829 Ga0163161_10196662
830 Ga0163161_11018967
831 Ga0213876_10000968
832 Ga0213876_10004135
833 Ga0213876_10485421
834 Ga0213875_10017757
835 Ga0213875_10029005
836 Ga0213875_10226956
837 Ga0209673_1007760
838 Ga0209051_1000782
839 Ga0209051_1002976
840 Ga0209051_1003729
841 Ga0209051_1056418
842 Ga0207696_1066497
843 Ga0207692_10026672
844 Ga0207692_10050438
845 Ga0207642_10005465
846 Ga0207710_10085725
847 Ga0207710_10125721
848 Ga0207688_10010481
849 Ga0207680_10035772
850 Ga0207680_10733747
851 Ga0207647_10101753
852 Ga0207705_10770918
853 Ga0207654_10081063
854 Ga0207671_10003644
855 Ga0207671_10544966
856 Ga0207693_10002085
857 Ga0207693_10002333
858 Ga0207663_10152800
859 Ga0207663_10157758
860 Ga0207662_10129389
861 Ga0207662_11204709
862 Ga0207657_10182418
863 Ga0207681_10010048
864 Ga0207681_10269854
865 Ga0207650_10048698
866 Ga0207659_10333735
867 Ga0207664_10062711
868 Ga0207664_10727170
869 Ga0207664_11448561
870 Ga0207644_10021702
871 Ga0207644_10175842
872 Ga0207644_10246253
873 Ga0207644_10273297
874 Ga0207690_10710814
875 Ga0207706_10143664
876 Ga0207686_10009396
877 Ga0207686_10147512
878 Ga0207686_10452987
879 Ga0207686_10484990
880 Ga0207670_10456295
881 Ga0207669_10130953
882 Ga0207669_10148687
883 Ga0207669_10183240
884 Ga0207704_10210655
885 Ga0207704_10349849
886 Ga0207665_10017940
887 Ga0207665_10042510
888 Ga0207691_10035092
889 Ga0207711_10016150
890 Ga0207689_10008196
891 Ga0207689_10355255
892 Ga0207661_10224144
893 Ga0207667_10140519
894 Ga0207667_10825789
895 Ga0207712_10023690
896 Ga0207712_10420300
897 Ga0207668_10000690
898 Ga0207668_10009326
899 Ga0207668_10016999
900 Ga0207640_10027159
901 Ga0207640_10562762
902 Ga0207658_10095322
903 Ga0207658_10155676
904 Ga0207658_10516556
905 Ga0207677_10058268
906 Ga0207703_10198054
907 Ga0207639_10003204
908 Ga0207639_10034214
909 Ga0207678_10156227
910 Ga0207678_10306599
911 Ga0207708_10012920
912 Ga0207708_10018954
913 Ga0207641_10032676
914 Ga0207641_11277493
915 Ga0207641_11514765
916 Ga0207648_10014442
917 Ga0207648_10063524
918 Ga0207648_10710101
919 Ga0207676_10424970
920 Ga0207676_10656562
921 Ga0207675_100004794
922 Ga0207675_100294288
923 Ga0207683_10000387
924 Ga0207683_10073499
925 Ga0207683_10373743
926 Ga0207698_10096630
927 Ga0207698_10280433
928 Ga0207428_10744720
929 Ga0268266_10001713
930 Ga0268266_10110056
931 Ga0268266_10117003
932 Ga0268265_10360147
933 Ga0268264_10022314
934 Ga0268264_10130502
935 Ga0307413_10082374
936 Ga0307406_10059000
937 Ga0307407_10182845
938 Ga0307412_10598905
939 Ga0307416_100969553
940 Ga0307414_10864087
941 Ga0373932_0187685
942 Ga0373939_0089635
943 Ga0373931_0010014
944 Ga0436364_0471391
945 Ga0436364_0824285
946 Ga0436364_0986089
947 Ga0436365_0235441
948 Ga0436365_1135069
949 Ga0436365_1136958
950 Ga0436365_1787742
951 Ga0436363_0238466
952 Ga0436363_0867395
953 Ga0439461_0000115
954 Ga0439466_0007627
955 Ga0439466_0020450
956 Ga0439466_0027711
957 Ga0439465_0001135
958 Ga0439465_0005672
959 Ga0439465_0017810
960 Ga0439465_0071626
961 Ga0451787_526604
962 Ga0451793_1165438
963 Ga0451795_0888358
964 Ga0451795_1481268
965 Ga0451800_1277064
966 Ga0451802_0149405
967 Ga0451835_0721566
968 Ga0451839_0031703
969 Ga0451841_1270627
970 Ga0451851_0369480
971 Ga0451853_0510433
972 Ga0451853_2100554
973 Ga0439431_0010449
974 Ga0439431_0056226
975 Ga0439431_0086396
976 Ga0439442_147154
977 Ga0439445_0001416
978 Ga0439446_0277771
979 Ga0439434_0013923
980 Ga0439459_0018224
981 Ga0466969_0071819
982 Ga0466969_0263317
983 Ga0466972_0004921
984 Ga0466972_0010684
985 Ga0466972_0176673
986 Ga0466965_0002806
987 Ga0466965_0004065
988 Ga0466966_0006372
989 Ga0466966_0037063
990 Ga0466966_0294376
991 Ga0466961_0019556
992 Ga0466961_0345294
993 Ga0466963_0129241
994 Ga0466963_0186630
995 Ga0466963_0268952
996 Ga0466963_1146569
997 Ga0466964_0007160
998 Ga0466964_0017763
999 Ga0466971_0011961
1000 Ga0466971_0102314
1001 Ga0466971_0152758
1002 Ga0466968_0003767
1003 Ga0466968_0041254
1004 Ga0466968_0056576
1005 Ga0466970_0017983
1006 Ga0466970_0052151
1007 Ga0466970_0067138
1008 Ga0466970_0083754
1009 Ga0466957_0003658
1010 Ga0466957_0003802
1011 Ga0466957_0018413
1012 Ga0466957_1292894
1013 Ga0466960_0000300
1014 Ga0466960_0003280
1015 Ga0466960_0008150
1016 Ga0466960_0025006
1017 Ga0466959_0024328
1018 Ga0466959_0024686
1019 Ga0466959_0065461
1020 Ga0466959_0116424
1021 Ga0466958_0015444
1022 Ga0466958_0172134
1023 Ga0466958_0219641
1024 Ga0466958_0343713
1025 Ga0466967_0004352
1026 Ga0466967_0016121
1027 Ga0466967_0080636
1028 Ga0466967_0119550
1029 Ga0466967_0426223
1030 Ga0466967_0666268
1031 Ga0466967_0933898
1032 Ga0466967_1226254
1033 Ga0495638_0063000
1034 Ga0495606_0010366
1035 Ga0495616_0192109
1036 Ga0495648_0000803
1037 Ga0495654_0179930
1038 Ga0495668_0032642
1039 Ga0495611_0134549
1040 Ga0495625_0216165
1041 Ga0495625_0238468
1042 Ga0495635_0102247
1043 Ga0495671_0146675
1044 Ga0495649_0082094
1045 Ga0495649_0356253
1046 Ga0495672_0001070
1047 Ga0495673_0000888
1048 Ga0495686_0002129
1049 Ga0496100_0000278
1050 Ga0496100_0015798
1051 Ga0496100_0161023
1052 Ga0496100_0266366
1053 Ga0496101_0000201
1054 Ga0496101_0003145
1055 Ga0496101_0034455
1056 Ga0496101_0053805
1057 Ga0496101_0083109
1058 Ga0496101_0204403
1059 Ga0496102_0000065
1060 Ga0496102_0018362
1061 Ga0496102_0067984
1062 Ga0496102_0074034
1063 Ga0496102_0245424
1064 Ga0496103_0000048
1065 Ga0496103_0010967
1066 Ga0496103_0027818
1067 Ga0496103_0142872
1068 Ga0496103_0581046
1069 Ga0496104_0109757
1070 Ga0496104_0154349
1071 Ga0496104_0334939
1072 Ga0496104_1855058
1073 Ga0496105_0039261
1074 Ga0496105_0126230
1075 Ga0496105_0143342
1076 Ga0496105_0296064
1077 Ga0496106_0006355
1078 Ga0496106_0052078
1079 Ga0496106_0236814
1080 Ga0496107_0025597
1081 Ga0496107_0031701
1082 Ga0496107_0141996
1083 Ga0496107_0352552
1084 Ga0496107_0579796
1085 Ga0496108_0000184
1086 Ga0496108_0036201
1087 Ga0496108_0037509
1088 Ga0496108_0180481
1089 Ga0496109_0001517
1090 Ga0496109_0031311
1091 Ga0496109_0425481
1092 Ga0496109_0474398
1093 Ga0496110_0023012
1094 Ga0496110_0323068
1095 Ga0496110_0869211
1096 Ga0496111_0356723
1097 Ga0496112_0000990
1098 Ga0496112_0017854
1099 Ga0496112_0042591
1100 Ga0496112_0093221
1101 Ga0496112_0344241
1102 Ga0496113_0382387
1103 Ga0496114_0005647
1104 Ga0496114_0010551
1105 Ga0496114_0147879
1106 Ga0496115_0098929
1107 Ga0496115_0192055
1108 Ga0496115_1284704
1109 Ga0496116_0000125
1110 Ga0496117_0000111
1111 Ga0496118_0000083
1112 Ga0496118_0000697
1113 Ga0496118_0355844
1114 Ga0496119_0006294
1115 Ga0496120_0015818
1116 Ga0496121_0001000
1117 Ga0496122_0049729
1118 Ga0496123_0009951
1119 Ga0496126_0001376
1120 Ga0496126_0001532
1121 Ga0496126_0014847
1122 Ga0496126_0061929
1123 Ga0496126_0526115
1124 Ga0501032_0018378
1125 Ga0501032_0201070
1126 Ga0501033_0191154
1127 Ga0501034_0000766
1128 Ga0501034_0047126
1129 Ga0501034_0097809
1130 Ga0501036_0532939
1131 Ga0501037_0030430
1132 Ga0501038_0004079
1133 Ga0501038_0312051
1134 Ga0501039_0014274
1135 Ga0501043_0031331
1136 Ga0501043_0921466
1137 Ga0501046_0002113
1138 Ga0501046_0254579
1139 Ga0501047_0019294
1140 Ga0501047_0887270
1141 Ga0501048_0003012
1142 Ga0501067_0026228
1143 Ga0501069_0254276
1144 Ga0501070_0002094
1145 Ga0501070_0025645
1146 Ga0501070_0050712
1147 Ga0501070_0673417
1148 Ga0501073_0328546
1149 Ga0501077_0148373
1150 Ga0501080_0015047
1151 Ga0501080_0505535
1152 Ga0501035_0001757
1153 Ga0501035_0004921
1154 Ga0501044_0002890
1155 Ga0501044_0006725
1156 Ga0501044_0292238
1157 Ga0501044_0467819
1158 nmdc:mga03683_55190_c1
1159 nmdc:mga03n38_3550_c1
1160 nmdc:mga03n38_39757_c1
1161 nmdc:mga03n38_488259_c1
1162 nmdc:mga03n38_5218_c1
1163 nmdc:mga00v17_15946_c1
1164 nmdc:mga00v17_271399_c1
1165 nmdc:mga00v17_36619_c1
1166 nmdc:mga00v17_8519_c1
1167 nmdc:mga00v17_8566_c1
1168 nmdc:mga0yw44_176355_c1
1169 nmdc:mga0yw44_234920_c1
1170 nmdc:mga0yw44_237646_c1
1171 nmdc:mga0yw44_2910_c1
1172 nmdc:mga0yw44_7515_c1
1173 nmdc:mga0yw44_878883_c1
1174 nmdc:mga06z11_175040_c1
1175 nmdc:mga06z11_21884_c1
1176 nmdc:mga06z11_254395_c1
1177 nmdc:mga06z11_46607_c1
1178 nmdc:mga04h51_19306_c1
1179 nmdc:mga07m45_174307_c1
1180 nmdc:mga07m45_203471_c1
1181 nmdc:mga07m45_26314_c1
1182 nmdc:mga07m45_54090_c1
1183 nmdc:mga05p37_291361_c1
1184 nmdc:mga09592_992770_c1
1185 nmdc:mga0qj67_2463_c1
1186 nmdc:mga0qj67_366163_c1
1187 nmdc:mga08y16_627140_c1
1188 nmdc:mga0sz30_128515_c1
1189 nmdc:mga0sz30_129334_c1
1190 nmdc:mga0sz30_15444_c1
1191 nmdc:mga0sz30_202628_c1
1192 nmdc:mga0sz30_215254_c1
1193 nmdc:mga0sz30_29945_c1
1194 nmdc:mga0sz30_49930_c1
1195 nmdc:mga0sz30_5395_c1
1196 nmdc:mga0sz30_5964_c1
1197 Ga0500635_0016858
1198 Ga0495655_0037391
1199 Ga0495655_0125544
1200 Ga0500643_004613
1201 Ga0500644_0067381
1202 Ga0500641_0051309
1203 Ga0500628_111428
1204 Ga0500642_0099754
1205 Ga0500652_000533
1206 Ga0500568_0077396
1207 Ga0500577_0045210
1208 Ga0500616_0042694
1209 Ga0500627_0086472
1210 Ga0466962_0002167
1211 Ga0466962_0008299
1212 Ga0466962_0046936
1213 2644491328
1214 2644636471
1215 2902797131
1216 2902804207
1217 2902814444
1218 2902839171
1219 2929217972
1220 2939585216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wz4-assembly5.cif.gz_E structure of the periplasmic domain of doti (crystal form i) 0.8441 45 164
1idp-assembly1.cif.gz_C crystal structure of scytalone dehydratase f162a mutant in the unligated state 0.8249 83 163
5cnl-assembly1.cif.gz_A crystal structure of an icml-like type iv secretion system protein (lpg0120) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.65 a resolution 0.8224 44 164
6of9-assembly1.cif.gz_I-2 structure of the chlamydamonas reinhardtii camkii hub homology domain 0.8058 104 163
5ig5-assembly1.cif.gz_B-2 crystal structure of n. vectensis camkii-b hub at ph 4.2 0.8045 103 163
ID Description Score Start End Superfamily
af_I6YGA5_49_159_3.10.450.230 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.9968 53 163 3.10.450.230
af_I6YGA5_49_159_3.10.450.230 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.9879 53 163 3.10.450.230
af_P71754_77_184_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9294 57 162 3.10.450.50
af_O53973_67_188_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9148 44 162 3.10.450.50
af_P71754_77_184_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.905 57 162 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1W9YWF3-F1-model_v4 Mammalian cell entry protein 0.9819 1 164 GO:0016020
AF-A0A853LM75-F1-model_v4 Mammalian cell entry protein 0.9797 59 164 GO:0016020
AF-A0A7I7XN34-F1-model_v4 Mammalian cell entry protein 0.9781 1 164 GO:0016020
AF-A0A1N0H831-F1-model_v4 deleted 0.9781 17 164
AF-A0A1W9YWF3-F1-model_v4 Mammalian cell entry protein 0.9759 1 164 GO:0016020

Map