F468948

General Info

Members Datasets Scaffolds Average Seq Length
610 287 1220 135

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100167110|Ga0068853_1001671102
Length 149
Sequence MPDLPKPAALPPQPLCNSAALAEKGRAVLFDVLQFGAPARAFALRFDGRVVAYLNRCVHVPTELDWQPGEFLDAERAWIVCSIHGATYEPASGRCAGGPCGRGRLTAIETEERDGRVYWYPSRDTRPLAAPRHDAAGTPWPAAHSERLP

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
175 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
178 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
187 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
188 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
189 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
190 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
191 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
271 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
272 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
273 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
274 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
287 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.26
Nodule 0
Rhizoplane 2.79
Rhizosphere 75.08
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100167110 3300005539 Bacteria 1989
2 JGI24740J21852_10004917 3300001979 Bacteria 5687
3 rootH2_10086368 3300003320 Bacteria 2273
4 rootL2_10182486 3300003322 Bacteria 1044
5 Ga0055525_1000613 3300003759 Bacteria 14860
6 Ga0070658_10167788 3300005327 Bacteria 1843
7 Ga0070658_10479263 3300005327 Bacteria 1074
8 Ga0070676_10018035 3300005328 Bacteria 3909
9 Ga0070676_10056160 3300005328 Bacteria 2326
10 Ga0070676_10082737 3300005328 Bacteria 1951
11 Ga0070676_10097138 3300005328 Bacteria 1814
12 Ga0070690_100212148 3300005330 Bacteria 1352
13 Ga0070670_100008956 3300005331 Bacteria 8549
14 Ga0070670_100009699 3300005331 Bacteria 8220
15 Ga0070670_100127984 3300005331 Bacteria 2192
16 Ga0070670_100147695 3300005331 Bacteria 2034
17 Ga0070670_100267270 3300005331 Bacteria 1492
18 Ga0070677_10001953 3300005333 Bacteria 6538
19 Ga0070677_10007951 3300005333 Bacteria 3551
20 Ga0070677_10136616 3300005333 Bacteria 1126
21 Ga0070677_10154831 3300005333 Bacteria 1070
22 Ga0070677_10466634 3300005333 Bacteria 678
23 Ga0068869_100063312 3300005334 Bacteria 2717
24 Ga0068869_100600345 3300005334 Bacteria 930
25 Ga0070666_10018151 3300005335 Bacteria 4519
26 Ga0070666_10055824 3300005335 Bacteria 2666
27 Ga0070666_10284015 3300005335 Bacteria 1177
28 Ga0070666_10301600 3300005335 Bacteria 1141
29 Ga0070666_10432520 3300005335 Bacteria 949
30 Ga0070680_100032228 3300005336 Bacteria 4217
31 Ga0068868_100012907 3300005338 Bacteria 6113
32 Ga0068868_100020653 3300005338 Bacteria 4953
33 Ga0068868_100178657 3300005338 Bacteria 1760
34 Ga0068868_102408585 3300005338 Bacteria 503
35 Ga0070689_100080717 3300005340 Bacteria 2553
36 Ga0070689_101200117 3300005340 Bacteria 681
37 Ga0070687_100022122 3300005343 Bacteria 3001
38 Ga0070661_100749264 3300005344 Bacteria 798
39 Ga0070668_100136992 3300005347 Bacteria 1970
40 Ga0070668_100309104 3300005347 Bacteria 1328
41 Ga0070668_101034681 3300005347 Bacteria 739
42 Ga0070669_100078101 3300005353 Bacteria 2460
43 Ga0070669_100262743 3300005353 Bacteria 1378
44 Ga0070669_100686627 3300005353 Unclassified 864
45 Ga0070675_100001865 3300005354 Bacteria 15533
46 Ga0070675_100021792 3300005354 Bacteria 5119
47 Ga0070675_100027643 3300005354 Bacteria 4559
48 Ga0070675_100068899 3300005354 Bacteria 2930
49 Ga0070675_100085088 3300005354 Bacteria 2641
50 Ga0070675_101260817 3300005354 Bacteria 681
51 Ga0070671_100006074 3300005355 Bacteria 9625
52 Ga0070671_100016080 3300005355 Bacteria 6048
53 Ga0070671_100139069 3300005355 Bacteria 2048
54 Ga0070671_100140040 3300005355 Bacteria 2041
55 Ga0070671_100236207 3300005355 Bacteria 1551
56 Ga0070671_100377329 3300005355 Bacteria 1212
57 Ga0070674_100009918 3300005356 Bacteria 5733
58 Ga0070674_100560444 3300005356 Bacteria 960
59 Ga0070673_100064560 3300005364 Bacteria 2917
60 Ga0070673_100068880 3300005364 Bacteria 2834
61 Ga0070673_100075874 3300005364 Bacteria 2713
62 Ga0070673_100351114 3300005364 Bacteria 1309
63 Ga0070673_100540389 3300005364 Bacteria 1058
64 Ga0070673_100780979 3300005364 Bacteria 881
65 Ga0070673_101012576 3300005364 Bacteria 774
66 Ga0070673_101444992 3300005364 Bacteria 648
67 Ga0070688_100014255 3300005365 Bacteria 4501
68 Ga0070667_100012109 3300005367 Bacteria 7140
69 Ga0070667_100591732 3300005367 Bacteria 1022
70 Ga0070667_100786636 3300005367 Bacteria 883
71 Ga0070667_101374876 3300005367 Bacteria 662
72 Ga0070667_101596958 3300005367 Bacteria 613
73 Ga0070701_10220021 3300005438 Bacteria 1132
74 Ga0070663_100174135 3300005455 Bacteria 1665
75 Ga0070663_100305679 3300005455 Bacteria 1274
76 Ga0070663_101675211 3300005455 Bacteria 568
77 Ga0070663_102071566 3300005455 Bacteria 513
78 Ga0070678_100012795 3300005456 Bacteria 5233
79 Ga0070678_100048121 3300005456 Bacteria 3068
80 Ga0070678_100084722 3300005456 Bacteria 2413
81 Ga0070678_100367583 3300005456 Bacteria 1241
82 Ga0070662_100005708 3300005457 Bacteria 7968
83 Ga0070662_100035004 3300005457 Bacteria 3544
84 Ga0070662_100185251 3300005457 Bacteria 1643
85 Ga0070662_100243342 3300005457 Bacteria 1444
86 Ga0070662_100511416 3300005457 Bacteria 1002
87 Ga0070681_10137585 3300005458 Bacteria 2372
88 Ga0068867_100008603 3300005459 Bacteria 7206
89 Ga0068867_100009453 3300005459 Bacteria 6875
90 Ga0068867_100036494 3300005459 Bacteria 3568
91 Ga0068867_100178677 3300005459 Bacteria 1686
92 Ga0068867_100391630 3300005459 Bacteria 1170
93 Ga0070698_100060524 3300005471 Bacteria 3822
94 Ga0070699_100060426 3300005518 Bacteria 3284
95 Ga0070679_100014774 3300005530 Bacteria 7502
96 Ga0068853_100106951 3300005539 Bacteria 2480
97 Ga0068853_101569872 3300005539 Bacteria 637
98 Ga0070672_100001038 3300005543 Bacteria 16915
99 Ga0070672_100007252 3300005543 Bacteria 7511
100 Ga0070672_100063951 3300005543 Bacteria 2906
101 Ga0070672_100144728 3300005543 Bacteria 1963
102 Ga0070672_100636723 3300005543 Bacteria 931
103 Ga0070672_100701756 3300005543 Bacteria 886
104 Ga0070665_100279922 3300005548 Bacteria 1670
105 Ga0068855_100146187 3300005563 Bacteria 2691
106 Ga0068855_101097135 3300005563 Bacteria 832
107 Ga0070664_100200492 3300005564 Bacteria 1781
108 Ga0070664_100233881 3300005564 Bacteria 1648
109 Ga0070664_100316523 3300005564 Bacteria 1413
110 Ga0070664_100741209 3300005564 Bacteria 917
111 Ga0070664_100967284 3300005564 Bacteria 800
112 Ga0068857_100867833 3300005577 Bacteria 864
113 Ga0068857_102426600 3300005577 Bacteria 515
114 Ga0068854_100093824 3300005578 Bacteria 2238
115 Ga0068854_101071479 3300005578 Bacteria 717
116 Ga0068856_102152484 3300005614 Bacteria 567
117 Ga0068852_100048652 3300005616 Bacteria 3623
118 Ga0068852_100089938 3300005616 Bacteria 2744
119 Ga0068852_100237690 3300005616 Bacteria 1739
120 Ga0068852_100280747 3300005616 Bacteria 1605
121 Ga0068852_100281319 3300005616 Bacteria 1604
122 Ga0068852_100448548 3300005616 Bacteria 1277
123 Ga0068852_100877158 3300005616 Bacteria 914
124 Ga0068859_100020405 3300005617 Bacteria 6651
125 Ga0068859_100917913 3300005617 Bacteria 960
126 Ga0068864_100008118 3300005618 Bacteria 8657
127 Ga0068864_100014579 3300005618 Bacteria 6529
128 Ga0068864_100023041 3300005618 Bacteria 5227
129 Ga0068864_100345616 3300005618 Bacteria 1402
130 Ga0068866_10052344 3300005718 Bacteria 2083
131 Ga0068866_10289156 3300005718 Bacteria 1019
132 Ga0068866_10325786 3300005718 Bacteria 968
133 Ga0068866_10596717 3300005718 Bacteria 745
134 Ga0068866_10813095 3300005718 Bacteria 651
135 Ga0068851_10206752 3300005834 Bacteria 1098
136 Ga0068851_10257439 3300005834 Bacteria 992
137 Ga0068851_10405404 3300005834 Bacteria 803
138 Ga0068870_10033670 3300005840 Bacteria 2616
139 Ga0068870_10051664 3300005840 Bacteria 2177
140 Ga0068870_10335261 3300005840 Bacteria 965
141 Ga0068863_100048305 3300005841 Bacteria 4035
142 Ga0068858_100001901 3300005842 Bacteria 21304
143 Ga0068858_100746025 3300005842 Bacteria 954
144 Ga0068860_100196629 3300005843 Bacteria 1953
145 Ga0068860_101417437 3300005843 Bacteria 716
146 Ga0068862_100047692 3300005844 Bacteria 3657
147 Ga0075368_10020486 3300006042 Bacteria 2505
148 Ga0075368_10057664 3300006042 Bacteria 1551
149 Ga0075363_100011943 3300006048 Bacteria 4173
150 Ga0075363_100261712 3300006048 Bacteria 998
151 Ga0075364_10228940 3300006051 Bacteria 1262
152 Ga0075364_10277212 3300006051 Bacteria 1141
153 Ga0070715_10050836 3300006163 Bacteria 1781
154 Ga0075362_10000336 3300006177 Bacteria 13409
155 Ga0075362_10475805 3300006177 Bacteria 637
156 Ga0075367_10018757 3300006178 Bacteria 3823
157 Ga0075367_10078454 3300006178 Bacteria 1994
158 Ga0075367_10080471 3300006178 Bacteria 1970
159 Ga0075369_10010415 3300006186 Bacteria 3635
160 Ga0075369_10012719 3300006186 Bacteria 3325
161 Ga0075369_10288006 3300006186 Bacteria 766
162 Ga0075366_10001782 3300006195 Bacteria 10872
163 Ga0075366_10005599 3300006195 Bacteria 6814
164 Ga0075366_10005857 3300006195 Bacteria 6681
165 Ga0075366_10006382 3300006195 Bacteria 6459
166 Ga0075366_10023685 3300006195 Bacteria 3577
167 Ga0075366_10368907 3300006195 Bacteria 882
168 Ga0075366_10585522 3300006195 Bacteria 691
169 Ga0075366_10662922 3300006195 Bacteria 647
170 Ga0097621_100066886 3300006237 Bacteria 2960
171 Ga0097621_100078420 3300006237 Bacteria 2744
172 Ga0097621_100855763 3300006237 Bacteria 845
173 Ga0075370_10001494 3300006353 Bacteria 10200
174 Ga0075370_10001788 3300006353 Bacteria 9605
175 Ga0075370_10018054 3300006353 Bacteria 3822
176 Ga0075370_10018504 3300006353 Bacteria 3781
177 Ga0075370_10037432 3300006353 Bacteria 2728
178 Ga0075370_10058942 3300006353 Bacteria 2184
179 Ga0075370_10457273 3300006353 Bacteria 768
180 Ga0075370_10577607 3300006353 Bacteria 680
181 Ga0068871_100247574 3300006358 Bacteria 1552
182 Ga0068871_100286748 3300006358 Bacteria 1442
183 Ga0075428_101396738 3300006844 Bacteria 735
184 Ga0097620_100020404 3300006931 Bacteria 6651
185 Ga0097620_100167018 3300006931 Bacteria 2280
186 Ga0097620_100918081 3300006931 Bacteria 960
187 Ga0105245_12105594 3300009098 Bacteria 618
188 Ga0105243_10028976 3300009148 Bacteria 4255
189 Ga0105243_10087104 3300009148 Bacteria 2563
190 Ga0105243_10456942 3300009148 Bacteria 1200
191 Ga0105242_10194147 3300009176 Bacteria 1799
192 Ga0105242_12165557 3300009176 Bacteria 601
193 Ga0105248_10087277 3300009177 Bacteria 3511
194 Ga0105237_10001228 3300009545 Bacteria 34145
195 Ga0105237_10027281 3300009545 Bacteria 5831
196 Ga0105238_10038213 3300009551 Bacteria 4875
197 Ga0105249_10546715 3300009553 Bacteria 1208
198 Ga0105249_12739361 3300009553 Bacteria 565
199 Ga0105239_10000942 3300010375 Bacteria 41042
200 Ga0105239_10164287 3300010375 Bacteria 2482
201 Ga0157374_10264317 3300013296 Bacteria 1695
202 Ga0157378_10180174 3300013297 Bacteria 1987
203 Ga0157378_10249913 3300013297 Bacteria 1697
204 Ga0163162_10107674 3300013306 Bacteria 2883
205 Ga0163162_10117079 3300013306 Bacteria 2766
206 Ga0163162_12559632 3300013306 Bacteria 587
207 Ga0157375_10026323 3300013308 Bacteria 5419
208 Ga0157375_10051692 3300013308 Bacteria 4037
209 Ga0157375_10198873 3300013308 Bacteria 2159
210 Ga0157375_10817434 3300013308 Bacteria 1080
211 Ga0163163_10048132 3300014325 Bacteria 4191
212 Ga0157380_10095198 3300014326 Bacteria 2466
213 Ga0157380_10453709 3300014326 Bacteria 1232
214 Ga0157380_12743403 3300014326 Bacteria 559
215 Ga0157377_10150856 3300014745 Bacteria 1437
216 Ga0157379_10072236 3300014968 Bacteria 3087
217 Ga0157379_10147879 3300014968 Bacteria 2119
218 Ga0157376_10067577 3300014969 Bacteria 3024
219 Ga0157376_10098965 3300014969 Bacteria 2543
220 Ga0157376_10099842 3300014969 Bacteria 2533
221 Ga0157376_10161395 3300014969 Bacteria 2032
222 Ga0163161_10016764 3300017792 Bacteria 5120
223 Ga0213874_10166983 3300021377 Bacteria 776
224 Ga0209758_1000327 3300025297 Bacteria 89663
225 Ga0207697_10009261 3300025315 Bacteria 4260
226 Ga0207656_10027725 3300025321 Bacteria 2319
227 Ga0207682_10001757 3300025893 Bacteria 9947
228 Ga0207682_10029494 3300025893 Bacteria 2194
229 Ga0207682_10065346 3300025893 Bacteria 1531
230 Ga0207682_10090797 3300025893 Bacteria 1324
231 Ga0207682_10092444 3300025893 Bacteria 1313
232 Ga0207682_10590713 3300025893 Bacteria 524
233 Ga0207642_10016540 3300025899 Bacteria 2781
234 Ga0207642_10360802 3300025899 Bacteria 860
235 Ga0207642_10393132 3300025899 Bacteria 828
236 Ga0207642_10415697 3300025899 Bacteria 808
237 Ga0207642_10486464 3300025899 Bacteria 753
238 Ga0207688_10220450 3300025901 Bacteria 1142
239 Ga0207680_10004734 3300025903 Bacteria 6475
240 Ga0207680_10081174 3300025903 Bacteria 2038
241 Ga0207680_10246508 3300025903 Bacteria 1233
242 Ga0207680_10464301 3300025903 Bacteria 899
243 Ga0207680_10945493 3300025903 Bacteria 618
244 Ga0207645_10003842 3300025907 Bacteria 11246
245 Ga0207645_10039778 3300025907 Bacteria 3013
246 Ga0207645_10055579 3300025907 Bacteria 2527
247 Ga0207645_10097173 3300025907 Bacteria 1898
248 Ga0207643_10045867 3300025908 Bacteria 2469
249 Ga0207643_10085980 3300025908 Bacteria 1827
250 Ga0207643_10137233 3300025908 Bacteria 1459
251 Ga0207705_10050214 3300025909 Bacteria 3003
252 Ga0207684_10003915 3300025910 Bacteria 14258
253 Ga0207707_10399460 3300025912 Bacteria 1180
254 Ga0207695_10058389 3300025913 Bacteria 4005
255 Ga0207671_10021304 3300025914 Bacteria 4919
256 Ga0207671_10031787 3300025914 Bacteria 3932
257 Ga0207660_10117252 3300025917 Bacteria 2012
258 Ga0207662_10032602 3300025918 Bacteria 3033
259 Ga0207649_10101112 3300025920 Bacteria 1908
260 Ga0207649_10853990 3300025920 Bacteria 712
261 Ga0207652_10007210 3300025921 Bacteria 8969
262 Ga0207652_10675137 3300025921 Bacteria 923
263 Ga0207681_10006956 3300025923 Bacteria 6940
264 Ga0207681_10065665 3300025923 Bacteria 2509
265 Ga0207681_10079215 3300025923 Bacteria 2314
266 Ga0207681_11269970 3300025923 Bacteria 618
267 Ga0207694_10063844 3300025924 Bacteria 2869
268 Ga0207650_10000587 3300025925 Bacteria 29198
269 Ga0207650_10119397 3300025925 Bacteria 2050
270 Ga0207650_10176296 3300025925 Bacteria 1701
271 Ga0207650_10200954 3300025925 Bacteria 1597
272 Ga0207650_10420962 3300025925 Bacteria 1108
273 Ga0207659_10000861 3300025926 Bacteria 18018
274 Ga0207659_10001723 3300025926 Bacteria 12970
275 Ga0207659_10075917 3300025926 Bacteria 2468
276 Ga0207659_10140502 3300025926 Bacteria 1874
277 Ga0207644_10003548 3300025931 Bacteria 10097
278 Ga0207644_10009546 3300025931 Bacteria 6372
279 Ga0207644_10057622 3300025931 Bacteria 2805
280 Ga0207644_10210639 3300025931 Bacteria 1536
281 Ga0207644_10393958 3300025931 Bacteria 1131
282 Ga0207644_11408481 3300025931 Bacteria 585
283 Ga0207690_10104245 3300025932 Bacteria 2031
284 Ga0207706_10002114 3300025933 Bacteria 19441
285 Ga0207706_10030828 3300025933 Bacteria 4782
286 Ga0207706_10244534 3300025933 Bacteria 1568
287 Ga0207706_10352837 3300025933 Bacteria 1279
288 Ga0207686_11121050 3300025934 Bacteria 642
289 Ga0207709_10102857 3300025935 Bacteria 1892
290 Ga0207709_10170707 3300025935 Bacteria 1526
291 Ga0207709_10586621 3300025935 Bacteria 881
292 Ga0207670_10055773 3300025936 Bacteria 2672
293 Ga0207669_10014392 3300025937 Bacteria 3963
294 Ga0207669_10037404 3300025937 Bacteria 2784
295 Ga0207704_10048159 3300025938 Bacteria 2553
296 Ga0207691_10001498 3300025940 Bacteria 23269
297 Ga0207691_10012394 3300025940 Bacteria 8172
298 Ga0207691_10030471 3300025940 Bacteria 5041
299 Ga0207691_10085067 3300025940 Bacteria 2839
300 Ga0207691_10184690 3300025940 Bacteria 1821
301 Ga0207691_10214990 3300025940 Bacteria 1669
302 Ga0207691_10274102 3300025940 Bacteria 1452
303 Ga0207691_10299853 3300025940 Bacteria 1381
304 Ga0207711_10033263 3300025941 Bacteria 4361
305 Ga0207689_10088813 3300025942 Bacteria 2539
306 Ga0207679_10071324 3300025945 Bacteria 2620
307 Ga0207679_10143355 3300025945 Bacteria 1934
308 Ga0207679_10293580 3300025945 Bacteria 1398
309 Ga0207679_10483326 3300025945 Bacteria 1103
310 Ga0207667_11517014 3300025949 Bacteria 641
311 Ga0207651_10004701 3300025960 Bacteria 6931
312 Ga0207651_10080692 3300025960 Bacteria 2342
313 Ga0207651_10172277 3300025960 Bacteria 1708
314 Ga0207651_10208674 3300025960 Bacteria 1571
315 Ga0207651_10309860 3300025960 Bacteria 1316
316 Ga0207651_10949066 3300025960 Bacteria 767
317 Ga0207712_10430882 3300025961 Bacteria 1115
318 Ga0207668_10765196 3300025972 Bacteria 853
319 Ga0207640_10156143 3300025981 Bacteria 1682
320 Ga0207640_10276105 3300025981 Bacteria 1317
321 Ga0207658_10020421 3300025986 Bacteria 4587
322 Ga0207658_10133371 3300025986 Bacteria 1999
323 Ga0207658_10562513 3300025986 Bacteria 1021
324 Ga0207658_11302129 3300025986 Bacteria 664
325 Ga0207677_10005004 3300026023 Bacteria 7158
326 Ga0207677_10007714 3300026023 Bacteria 5974
327 Ga0207677_10436037 3300026023 Bacteria 1119
328 Ga0207677_11382092 3300026023 Bacteria 648
329 Ga0207703_10001321 3300026035 Bacteria 22774
330 Ga0207703_10425277 3300026035 Bacteria 1237
331 Ga0207703_10501098 3300026035 Bacteria 1140
332 Ga0207639_10298347 3300026041 Bacteria 1423
333 Ga0207639_10424153 3300026041 Bacteria 1203
334 Ga0207639_10582243 3300026041 Bacteria 1030
335 Ga0207639_10744667 3300026041 Bacteria 911
336 Ga0207678_10006013 3300026067 Bacteria 10798
337 Ga0207678_10164764 3300026067 Bacteria 1893
338 Ga0207678_10287935 3300026067 Bacteria 1411
339 Ga0207708_10278658 3300026075 Bacteria 1354
340 Ga0207702_10728489 3300026078 Bacteria 978
341 Ga0207641_10068379 3300026088 Bacteria 3045
342 Ga0207641_10107670 3300026088 Bacteria 2466
343 Ga0207648_10000823 3300026089 Bacteria 35061
344 Ga0207648_10016286 3300026089 Bacteria 6799
345 Ga0207648_10049956 3300026089 Bacteria 3658
346 Ga0207648_10059732 3300026089 Bacteria 3325
347 Ga0207648_10070174 3300026089 Bacteria 3054
348 Ga0207648_10077835 3300026089 Bacteria 2892
349 Ga0207648_10252442 3300026089 Bacteria 1572
350 Ga0207648_10315040 3300026089 Bacteria 1405
351 Ga0207648_10532387 3300026089 Bacteria 1077
352 Ga0207648_11017864 3300026089 Bacteria 776
353 Ga0207676_10002877 3300026095 Bacteria 12269
354 Ga0207676_10008533 3300026095 Bacteria 7285
355 Ga0207676_10030148 3300026095 Bacteria 4069
356 Ga0207674_10013266 3300026116 Bacteria 9152
357 Ga0207675_100001080 3300026118 Bacteria 27005
358 Ga0207675_100288822 3300026118 Bacteria 1595
359 Ga0207683_10010279 3300026121 Bacteria 7977
360 Ga0207683_10016480 3300026121 Bacteria 6290
361 Ga0207683_10162780 3300026121 Bacteria 2018
362 Ga0207683_10424537 3300026121 Bacteria 1225
363 Ga0207683_11390581 3300026121 Bacteria 649
364 Ga0207698_10047770 3300026142 Bacteria 3245
365 Ga0207698_10055093 3300026142 Bacteria 3062
366 Ga0207698_10164359 3300026142 Bacteria 1946
367 Ga0207698_10179504 3300026142 Bacteria 1874
368 Ga0207698_10225853 3300026142 Bacteria 1696
369 Ga0207698_10788992 3300026142 Bacteria 951
370 Ga0207698_10796198 3300026142 Bacteria 947
371 Ga0209813_10024196 3300027866 Bacteria 1735
372 Ga0209813_10060264 3300027866 Bacteria 1210
373 Ga0268265_10087379 3300028380 Bacteria 2480
374 Ga0268265_10107671 3300028380 Bacteria 2267
375 Ga0268265_11375656 3300028380 Bacteria 707
376 Ga0268264_10058104 3300028381 Bacteria 3238
377 Ga0268264_10248323 3300028381 Bacteria 1652
378 Ga0268264_10332318 3300028381 Bacteria 1441
379 Ga0265336_10000014 3300028666 Bacteria 241247
380 Ga0307517_10000174 3300028786 Bacteria 105578
381 Ga0307517_10143023 3300028786 Bacteria 1671
382 Ga0307517_10155649 3300028786 Bacteria 1551
383 Ga0307515_10000080 3300028794 Bacteria 224941
384 Ga0307515_10002453 3300028794 Bacteria 40400
385 Ga0307515_10004018 3300028794 Bacteria 30712
386 Ga0307515_10163649 3300028794 Bacteria 2254
387 Ga0307515_10570781 3300028794 Bacteria 741
388 Ga0265324_10001016 3300029957 Bacteria 17236
389 Ga0307512_10031486 3300030522 Bacteria 4592
390 Ga0307512_10033803 3300030522 Bacteria 4389
391 Ga0307512_10077867 3300030522 Bacteria 2406
392 Ga0307513_10045166 3300031456 Bacteria 4817
393 Ga0307513_10195323 3300031456 Bacteria 1870
394 Ga0307509_10000225 3300031507 Bacteria 90913
395 Ga0307509_10005996 3300031507 Bacteria 16595
396 Ga0307509_10107163 3300031507 Bacteria 2811
397 Ga0307509_10159924 3300031507 Bacteria 2152
398 Ga0307509_10216707 3300031507 Bacteria 1732
399 Ga0307509_10604272 3300031507 Bacteria 769
400 Ga0307408_100291366 3300031548 Bacteria 1363
401 Ga0307408_100329521 3300031548 Bacteria 1289
402 Ga0307508_10000123 3300031616 Bacteria 92439
403 Ga0307508_10000185 3300031616 Bacteria 75407
404 Ga0307508_10077818 3300031616 Bacteria 2896
405 Ga0307514_10010896 3300031649 Bacteria 7590
406 Ga0307514_10032702 3300031649 Bacteria 4158
407 Ga0307514_10121761 3300031649 Bacteria 1818
408 Ga0307514_10125826 3300031649 Bacteria 1776
409 Ga0307514_10205684 3300031649 Bacteria 1230
410 Ga0307516_10005049 3300031730 Bacteria 15969
411 Ga0307405_10375811 3300031731 Bacteria 1105
412 Ga0307413_11118761 3300031824 Bacteria 681
413 Ga0307518_10219643 3300031838 Bacteria 1242
414 Ga0307410_10511374 3300031852 Bacteria 990
415 Ga0307407_10259634 3300031903 Bacteria 1194
416 Ga0307412_10088661 3300031911 Bacteria 2159
417 Ga0307412_10538811 3300031911 Bacteria 978
418 Ga0307409_100399556 3300031995 Bacteria 1312
419 Ga0307416_101661837 3300032002 Bacteria 744
420 Ga0307416_102396174 3300032002 Bacteria 627
421 Ga0307414_10807580 3300032004 Bacteria 856
422 Ga0307411_10241773 3300032005 Bacteria 1414
423 Ga0307411_10290983 3300032005 Bacteria 1305
424 Ga0307411_12086662 3300032005 Bacteria 530
425 Ga0307415_100219561 3300032126 Bacteria 1523
426 Ga0307415_100286340 3300032126 Bacteria 1358
427 Ga0307415_101914837 3300032126 Bacteria 576
428 Ga0307415_102499756 3300032126 Bacteria 509
429 Ga0307507_10079564 3300033179 Bacteria 2896
430 Ga0307507_10172045 3300033179 Bacteria 1571
431 Ga0307510_10002036 3300033180 Bacteria 22846
432 Ga0307510_10034205 3300033180 Bacteria 5694
433 Ga0307510_10056274 3300033180 Bacteria 4098
434 Ga0307510_10227514 3300033180 Bacteria 1370
435 Ga0307510_10535697 3300033180 Bacteria 616
436 Ga0373932_0092294 3300035112 Bacteria 973
437 Ga0373954_0153016 3300035118 Bacteria 1127
438 Ga0373924_0166684 3300035410 Unclassified 967
439 Ga0373931_0008787 3300035691 Bacteria 4806
440 Ga0373931_0347509 3300035691 Bacteria 928
441 Ga0373927_0012586 3300035695 Bacteria 5630
442 Ga0373927_0459899 3300035695 Bacteria 841
443 Ga0373947_0045879 3300035725 Bacteria 2616
444 Ga0373925_1399906 3300037068 Unclassified 573
445 Ga0395898_0001856 3300037466 Bacteria 27096
446 Ga0395905_0007759 3300037471 Bacteria 10644
447 Ga0395905_0033384 3300037471 Bacteria 4834
448 Ga0436363_0123701 3300039450 Bacteria 1704
449 Ga0439439_0065084 3300041406 Bacteria 972
450 Ga0439461_0004624 3300041410 Bacteria 2307
451 Ga0439465_0015821 3300041413 Bacteria 2353
452 Ga0451789_0009001 3300041443 Bacteria 589
453 Ga0451791_1394348 3300041451 Bacteria 909
454 Ga0451793_1454431 3300041452 Bacteria 576
455 Ga0451795_1455001 3300041456 Bacteria 556
456 Ga0451804_0125096 3300041463 Bacteria 1762
457 Ga0451833_1380058 3300041491 Bacteria 652
458 Ga0451853_1066355 3300041512 Bacteria 913
459 Ga0451853_2440260 3300041512 Bacteria 1046
460 Ga0439431_0002588 3300041997 Bacteria 3997
461 Ga0439442_056118 3300042002 Bacteria 833
462 Ga0439450_149176 3300042008 Bacteria 612
463 Ga0439455_0034558 3300042012 Bacteria 1272
464 Ga0439462_0084524 3300042015 Bacteria 868
465 Ga0450888_024650 3300042126 Bacteria 783
466 Ga0450896_016432 3300042133 Bacteria 1063
467 Ga0450898_002013 3300042134 Bacteria 2786
468 Ga0439458_0014497 3300042157 Bacteria 1780
469 Ga0450909_052772 3300042185 Bacteria 636
470 Ga0439434_0018964 3300042435 Bacteria 2062
471 Ga0466969_0002402 3300044656 Bacteria 10011
472 Ga0466969_0023706 3300044656 Bacteria 3160
473 Ga0466972_0014669 3300044658 Bacteria 3922
474 Ga0466965_0025856 3300044683 Bacteria 2844
475 Ga0466965_0033351 3300044683 Bacteria 2516
476 Ga0466966_0095242 3300044684 Bacteria 1844
477 Ga0466963_0060506 3300044694 Bacteria 2529
478 Ga0466964_0002511 3300044706 Bacteria 6527
479 Ga0466964_0014632 3300044706 Bacteria 2983
480 Ga0466971_0022613 3300044719 Bacteria 2802
481 Ga0466957_0351812 3300044842 Bacteria 999
482 Ga0466959_0000027 3300045049 Bacteria 114262
483 Ga0451576_0020730 3300045051 Bacteria 7155
484 Ga0451576_2546762 3300045051 Bacteria 522
485 Ga0466958_0077178 3300045836 Bacteria 2045
486 Ga0495592_0001312 3300046454 Bacteria 17260
487 Ga0495638_0044159 3300046460 Bacteria 2809
488 Ga0495641_0205912 3300046461 Bacteria 882
489 Ga0495650_0003795 3300046471 Bacteria 10769
490 Ga0495580_0351902 3300046472 Unclassified 998
491 Ga0495664_0154216 3300046477 Bacteria 1393
492 Ga0495583_0132168 3300046506 Bacteria 1044
493 Ga0495606_0145876 3300046507 Bacteria 1394
494 Ga0495610_0054979 3300046512 Bacteria 1921
495 Ga0495610_0116959 3300046512 Bacteria 1174
496 Ga0495616_0397572 3300046513 Bacteria 567
497 Ga0495620_0219831 3300046515 Bacteria 727
498 Ga0495630_0461554 3300046517 Bacteria 973
499 Ga0495632_0003352 3300046519 Bacteria 11415
500 Ga0495648_0496982 3300046524 Bacteria 524
501 Ga0495666_0176311 3300046526 Bacteria 988
502 Ga0495666_0251300 3300046526 Bacteria 805
503 Ga0495642_0076873 3300046528 Bacteria 1402
504 Ga0495652_0721217 3300046529 Bacteria 669
505 Ga0495640_0301127 3300046533 Bacteria 996
506 Ga0495621_0090038 3300046539 Bacteria 1155
507 Ga0495597_0382901 3300046542 Bacteria 536
508 Ga0495622_0098369 3300046557 Bacteria 1342
509 Ga0495625_0025423 3300046660 Bacteria 4492
510 Ga0495658_0031522 3300046683 Bacteria 2888
511 Ga0495658_0067269 3300046683 Bacteria 2072
512 Ga0495658_0399768 3300046683 Bacteria 876
513 Ga0495658_0482470 3300046683 Bacteria 793
514 Ga0495658_0583554 3300046683 Bacteria 716
515 Ga0495624_0259094 3300046690 Bacteria 1051
516 Ga0495671_0279271 3300046692 Bacteria 805
517 Ga0495649_0002120 3300046694 Bacteria 14224
518 Ga0495660_0038597 3300046810 Bacteria 2654
519 Ga0495687_010550 3300047443 Bacteria 5059
520 Ga0495673_0254721 3300047469 Bacteria 640
521 Ga0495684_0234892 3300047471 Unclassified 1340
522 Ga0495686_0003436 3300047472 Bacteria 13741
523 Ga0495686_0048165 3300047472 Bacteria 2688
524 Ga0495593_0110771 3300047673 Bacteria 1402
525 Ga0495626_0066365 3300048091 Bacteria 1632
526 Ga0496101_0388216 3300048904 Bacteria 1099
527 Ga0496102_0029951 3300048905 Bacteria 4870
528 Ga0496108_0142201 3300048911 Bacteria 2067
529 Ga0496108_0168179 3300048911 Bacteria 1896
530 Ga0496108_0239065 3300048911 Bacteria 1580
531 Ga0496109_0372729 3300048912 Bacteria 1348
532 Ga0496109_0457425 3300048912 Bacteria 1205
533 Ga0496110_0499952 3300048913 Bacteria 1107
534 Ga0496110_0971719 3300048913 Bacteria 756
535 Ga0496110_1043168 3300048913 Bacteria 725
536 Ga0496113_0411641 3300048916 Bacteria 1086
537 Ga0496113_0586036 3300048916 Bacteria 893
538 Ga0496124_0000596 3300048927 Bacteria 60853
539 Ga0496124_0448628 3300048927 Bacteria 880
540 Ga0496125_0026833 3300048928 Bacteria 5234
541 Ga0496125_0343237 3300048928 Bacteria 895
542 Ga0501043_0000020 3300049579 Bacteria 155270
543 Ga0501046_0000039 3300049580 Bacteria 155237
544 Ga0501047_0000028 3300049581 Bacteria 220279
545 Ga0501047_0180459 3300049581 Bacteria 1978
546 Ga0501048_0042394 3300049582 Bacteria 3259
547 Ga0501206_005674 3300049653 Bacteria 1610
548 Ga0501081_0817109 3300049743 Bacteria 702
549 Ga0501035_0016072 3300049822 Bacteria 6906
550 Ga0501045_0003924 3300049824 Bacteria 10247
551 nmdc:mga03683_4458_c2 3300050489 Bacteria 3990
552 nmdc:mga03683_499273_c1 3300050489 Bacteria 589
553 nmdc:mga03683_5592_c1 3300050489 Bacteria 4251
554 nmdc:mga03n38_220610_c1 3300050490 Bacteria 989
555 nmdc:mga03n38_34414_c1 3300050490 Bacteria 2164
556 nmdc:mga00v17_121253_c1 3300050491 Bacteria 1665
557 nmdc:mga00v17_75832_c1 3300050491 Bacteria 2091
558 nmdc:mga0yw44_11375_c1 3300050492 Bacteria 4589
559 nmdc:mga0k408_1297_c2 3300050493 Bacteria 9516
560 nmdc:mga0k408_186950_c1 3300050493 Bacteria 1236
561 nmdc:mga0k408_28918_c1 3300050493 Bacteria 3153
562 nmdc:mga0k408_4162_c1 3300050493 Bacteria 7678
563 nmdc:mga0k408_444067_c1 3300050493 Bacteria 771
564 nmdc:mga0k408_56181_c1 3300050493 Bacteria 2284
565 nmdc:mga0k408_5953_c1 3300050493 Bacteria 6507
566 nmdc:mga0k408_6062_c1 3300050493 Bacteria 6444
567 nmdc:mga0k408_62310_c1 3300050493 Bacteria 2169
568 nmdc:mga0k408_633285_c1 3300050493 Bacteria 629
569 nmdc:mga0k408_64087_c2 3300050493 Bacteria 856
570 nmdc:mga06z11_5010_c1 3300050494 Bacteria 5266
571 nmdc:mga06z11_7518_c1 3300050494 Bacteria 4489
572 nmdc:mga06z11_8871_c1 3300050494 Bacteria 4214
573 nmdc:mga04h51_120780_c1 3300050495 Bacteria 976
574 nmdc:mga04h51_23895_c1 3300050495 Bacteria 1866
575 nmdc:mga04h51_61538_c1 3300050495 Bacteria 1288
576 nmdc:mga07m45_14218_c1 3300050496 Bacteria 4235
577 nmdc:mga07m45_153063_c1 3300050496 Bacteria 1338
578 nmdc:mga07m45_166538_c1 3300050496 Bacteria 1280
579 nmdc:mga07m45_21310_c1 3300050496 Bacteria 3528
580 nmdc:mga07m45_271518_c1 3300050496 Bacteria 986
581 nmdc:mga07m45_6344_c1 3300050496 Bacteria 5969
582 nmdc:mga07m45_7091_c1 3300050496 Bacteria 5707
583 nmdc:mga07m45_7472_c1 3300050496 Bacteria 5587
584 nmdc:mga09592_680303_c1 3300050508 Bacteria 877
585 nmdc:mga0n895_910688_c1 3300050512 Bacteria 864
586 nmdc:mga0sz30_15718_c1 3300050516 Bacteria 2994
587 nmdc:mga0sz30_4813_c1 3300050516 Bacteria 4913
588 Ga0495655_0042318 3300053083 Bacteria 1169
589 Ga0500578_0000079 3300053086 Bacteria 107137
590 Ga0500644_0036295 3300053088 Bacteria 1603
591 Ga0500651_0074405 3300053093 Bacteria 2110
592 Ga0500650_0414515 3300053098 Bacteria 581
593 Ga0500594_0001408 3300053118 Bacteria 5221
594 Ga0500614_027825 3300053123 Bacteria 1362
595 Ga0500621_281378 3300053126 Bacteria 542
596 Ga0500655_056246 3300053133 Bacteria 788
597 Ga0500559_0000329 3300053136 Bacteria 35808
598 Ga0500561_0032044 3300053137 Unclassified 1333
599 Ga0500568_0020365 3300053139 Bacteria 2870
600 Ga0500568_0050450 3300053139 Bacteria 1640
601 Ga0500616_0441954 3300053153 Bacteria 513
602 Ga0500619_000045 3300053154 Bacteria 38384
603 Ga0500622_0007462 3300053156 Bacteria 6208
604 Ga0500627_0097854 3300053158 Bacteria 1316
605 Ga0500636_0023411 3300053177 Bacteria 3652
606 Ga0500587_007603 3300053739 Bacteria 1407
607 Ga0466962_0126812 3300061719 Bacteria 1232
608 Ga0530510_0404238 3300061734 Bacteria 1030
609 2587759952 2585428062 Bacteria 6842168
610 2644341021 2643221660 Bacteria 4208257
611 Ga0068853_100167110
612 JGI24740J21852_10004917
613 rootH2_10086368
614 rootL2_10182486
615 Ga0055525_1000613
616 Ga0070658_10167788
617 Ga0070658_10479263
618 Ga0070676_10018035
619 Ga0070676_10056160
620 Ga0070676_10082737
621 Ga0070676_10097138
622 Ga0070690_100212148
623 Ga0070670_100008956
624 Ga0070670_100009699
625 Ga0070670_100127984
626 Ga0070670_100147695
627 Ga0070670_100267270
628 Ga0070677_10001953
629 Ga0070677_10007951
630 Ga0070677_10136616
631 Ga0070677_10154831
632 Ga0070677_10466634
633 Ga0068869_100063312
634 Ga0068869_100600345
635 Ga0070666_10018151
636 Ga0070666_10055824
637 Ga0070666_10284015
638 Ga0070666_10301600
639 Ga0070666_10432520
640 Ga0070680_100032228
641 Ga0068868_100012907
642 Ga0068868_100020653
643 Ga0068868_100178657
644 Ga0068868_102408585
645 Ga0070689_100080717
646 Ga0070689_101200117
647 Ga0070687_100022122
648 Ga0070661_100749264
649 Ga0070668_100136992
650 Ga0070668_100309104
651 Ga0070668_101034681
652 Ga0070669_100078101
653 Ga0070669_100262743
654 Ga0070669_100686627
655 Ga0070675_100001865
656 Ga0070675_100021792
657 Ga0070675_100027643
658 Ga0070675_100068899
659 Ga0070675_100085088
660 Ga0070675_101260817
661 Ga0070671_100006074
662 Ga0070671_100016080
663 Ga0070671_100139069
664 Ga0070671_100140040
665 Ga0070671_100236207
666 Ga0070671_100377329
667 Ga0070674_100009918
668 Ga0070674_100560444
669 Ga0070673_100064560
670 Ga0070673_100068880
671 Ga0070673_100075874
672 Ga0070673_100351114
673 Ga0070673_100540389
674 Ga0070673_100780979
675 Ga0070673_101012576
676 Ga0070673_101444992
677 Ga0070688_100014255
678 Ga0070667_100012109
679 Ga0070667_100591732
680 Ga0070667_100786636
681 Ga0070667_101374876
682 Ga0070667_101596958
683 Ga0070701_10220021
684 Ga0070663_100174135
685 Ga0070663_100305679
686 Ga0070663_101675211
687 Ga0070663_102071566
688 Ga0070678_100012795
689 Ga0070678_100048121
690 Ga0070678_100084722
691 Ga0070678_100367583
692 Ga0070662_100005708
693 Ga0070662_100035004
694 Ga0070662_100185251
695 Ga0070662_100243342
696 Ga0070662_100511416
697 Ga0070681_10137585
698 Ga0068867_100008603
699 Ga0068867_100009453
700 Ga0068867_100036494
701 Ga0068867_100178677
702 Ga0068867_100391630
703 Ga0070698_100060524
704 Ga0070699_100060426
705 Ga0070679_100014774
706 Ga0068853_100106951
707 Ga0068853_101569872
708 Ga0070672_100001038
709 Ga0070672_100007252
710 Ga0070672_100063951
711 Ga0070672_100144728
712 Ga0070672_100636723
713 Ga0070672_100701756
714 Ga0070665_100279922
715 Ga0068855_100146187
716 Ga0068855_101097135
717 Ga0070664_100200492
718 Ga0070664_100233881
719 Ga0070664_100316523
720 Ga0070664_100741209
721 Ga0070664_100967284
722 Ga0068857_100867833
723 Ga0068857_102426600
724 Ga0068854_100093824
725 Ga0068854_101071479
726 Ga0068856_102152484
727 Ga0068852_100048652
728 Ga0068852_100089938
729 Ga0068852_100237690
730 Ga0068852_100280747
731 Ga0068852_100281319
732 Ga0068852_100448548
733 Ga0068852_100877158
734 Ga0068859_100020405
735 Ga0068859_100917913
736 Ga0068864_100008118
737 Ga0068864_100014579
738 Ga0068864_100023041
739 Ga0068864_100345616
740 Ga0068866_10052344
741 Ga0068866_10289156
742 Ga0068866_10325786
743 Ga0068866_10596717
744 Ga0068866_10813095
745 Ga0068851_10206752
746 Ga0068851_10257439
747 Ga0068851_10405404
748 Ga0068870_10033670
749 Ga0068870_10051664
750 Ga0068870_10335261
751 Ga0068863_100048305
752 Ga0068858_100001901
753 Ga0068858_100746025
754 Ga0068860_100196629
755 Ga0068860_101417437
756 Ga0068862_100047692
757 Ga0075368_10020486
758 Ga0075368_10057664
759 Ga0075363_100011943
760 Ga0075363_100261712
761 Ga0075364_10228940
762 Ga0075364_10277212
763 Ga0070715_10050836
764 Ga0075362_10000336
765 Ga0075362_10475805
766 Ga0075367_10018757
767 Ga0075367_10078454
768 Ga0075367_10080471
769 Ga0075369_10010415
770 Ga0075369_10012719
771 Ga0075369_10288006
772 Ga0075366_10001782
773 Ga0075366_10005599
774 Ga0075366_10005857
775 Ga0075366_10006382
776 Ga0075366_10023685
777 Ga0075366_10368907
778 Ga0075366_10585522
779 Ga0075366_10662922
780 Ga0097621_100066886
781 Ga0097621_100078420
782 Ga0097621_100855763
783 Ga0075370_10001494
784 Ga0075370_10001788
785 Ga0075370_10018054
786 Ga0075370_10018504
787 Ga0075370_10037432
788 Ga0075370_10058942
789 Ga0075370_10457273
790 Ga0075370_10577607
791 Ga0068871_100247574
792 Ga0068871_100286748
793 Ga0075428_101396738
794 Ga0097620_100020404
795 Ga0097620_100167018
796 Ga0097620_100918081
797 Ga0105245_12105594
798 Ga0105243_10028976
799 Ga0105243_10087104
800 Ga0105243_10456942
801 Ga0105242_10194147
802 Ga0105242_12165557
803 Ga0105248_10087277
804 Ga0105237_10001228
805 Ga0105237_10027281
806 Ga0105238_10038213
807 Ga0105249_10546715
808 Ga0105249_12739361
809 Ga0105239_10000942
810 Ga0105239_10164287
811 Ga0157374_10264317
812 Ga0157378_10180174
813 Ga0157378_10249913
814 Ga0163162_10107674
815 Ga0163162_10117079
816 Ga0163162_12559632
817 Ga0157375_10026323
818 Ga0157375_10051692
819 Ga0157375_10198873
820 Ga0157375_10817434
821 Ga0163163_10048132
822 Ga0157380_10095198
823 Ga0157380_10453709
824 Ga0157380_12743403
825 Ga0157377_10150856
826 Ga0157379_10072236
827 Ga0157379_10147879
828 Ga0157376_10067577
829 Ga0157376_10098965
830 Ga0157376_10099842
831 Ga0157376_10161395
832 Ga0163161_10016764
833 Ga0213874_10166983
834 Ga0209758_1000327
835 Ga0207697_10009261
836 Ga0207656_10027725
837 Ga0207682_10001757
838 Ga0207682_10029494
839 Ga0207682_10065346
840 Ga0207682_10090797
841 Ga0207682_10092444
842 Ga0207682_10590713
843 Ga0207642_10016540
844 Ga0207642_10360802
845 Ga0207642_10393132
846 Ga0207642_10415697
847 Ga0207642_10486464
848 Ga0207688_10220450
849 Ga0207680_10004734
850 Ga0207680_10081174
851 Ga0207680_10246508
852 Ga0207680_10464301
853 Ga0207680_10945493
854 Ga0207645_10003842
855 Ga0207645_10039778
856 Ga0207645_10055579
857 Ga0207645_10097173
858 Ga0207643_10045867
859 Ga0207643_10085980
860 Ga0207643_10137233
861 Ga0207705_10050214
862 Ga0207684_10003915
863 Ga0207707_10399460
864 Ga0207695_10058389
865 Ga0207671_10021304
866 Ga0207671_10031787
867 Ga0207660_10117252
868 Ga0207662_10032602
869 Ga0207649_10101112
870 Ga0207649_10853990
871 Ga0207652_10007210
872 Ga0207652_10675137
873 Ga0207681_10006956
874 Ga0207681_10065665
875 Ga0207681_10079215
876 Ga0207681_11269970
877 Ga0207694_10063844
878 Ga0207650_10000587
879 Ga0207650_10119397
880 Ga0207650_10176296
881 Ga0207650_10200954
882 Ga0207650_10420962
883 Ga0207659_10000861
884 Ga0207659_10001723
885 Ga0207659_10075917
886 Ga0207659_10140502
887 Ga0207644_10003548
888 Ga0207644_10009546
889 Ga0207644_10057622
890 Ga0207644_10210639
891 Ga0207644_10393958
892 Ga0207644_11408481
893 Ga0207690_10104245
894 Ga0207706_10002114
895 Ga0207706_10030828
896 Ga0207706_10244534
897 Ga0207706_10352837
898 Ga0207686_11121050
899 Ga0207709_10102857
900 Ga0207709_10170707
901 Ga0207709_10586621
902 Ga0207670_10055773
903 Ga0207669_10014392
904 Ga0207669_10037404
905 Ga0207704_10048159
906 Ga0207691_10001498
907 Ga0207691_10012394
908 Ga0207691_10030471
909 Ga0207691_10085067
910 Ga0207691_10184690
911 Ga0207691_10214990
912 Ga0207691_10274102
913 Ga0207691_10299853
914 Ga0207711_10033263
915 Ga0207689_10088813
916 Ga0207679_10071324
917 Ga0207679_10143355
918 Ga0207679_10293580
919 Ga0207679_10483326
920 Ga0207667_11517014
921 Ga0207651_10004701
922 Ga0207651_10080692
923 Ga0207651_10172277
924 Ga0207651_10208674
925 Ga0207651_10309860
926 Ga0207651_10949066
927 Ga0207712_10430882
928 Ga0207668_10765196
929 Ga0207640_10156143
930 Ga0207640_10276105
931 Ga0207658_10020421
932 Ga0207658_10133371
933 Ga0207658_10562513
934 Ga0207658_11302129
935 Ga0207677_10005004
936 Ga0207677_10007714
937 Ga0207677_10436037
938 Ga0207677_11382092
939 Ga0207703_10001321
940 Ga0207703_10425277
941 Ga0207703_10501098
942 Ga0207639_10298347
943 Ga0207639_10424153
944 Ga0207639_10582243
945 Ga0207639_10744667
946 Ga0207678_10006013
947 Ga0207678_10164764
948 Ga0207678_10287935
949 Ga0207708_10278658
950 Ga0207702_10728489
951 Ga0207641_10068379
952 Ga0207641_10107670
953 Ga0207648_10000823
954 Ga0207648_10016286
955 Ga0207648_10049956
956 Ga0207648_10059732
957 Ga0207648_10070174
958 Ga0207648_10077835
959 Ga0207648_10252442
960 Ga0207648_10315040
961 Ga0207648_10532387
962 Ga0207648_11017864
963 Ga0207676_10002877
964 Ga0207676_10008533
965 Ga0207676_10030148
966 Ga0207674_10013266
967 Ga0207675_100001080
968 Ga0207675_100288822
969 Ga0207683_10010279
970 Ga0207683_10016480
971 Ga0207683_10162780
972 Ga0207683_10424537
973 Ga0207683_11390581
974 Ga0207698_10047770
975 Ga0207698_10055093
976 Ga0207698_10164359
977 Ga0207698_10179504
978 Ga0207698_10225853
979 Ga0207698_10788992
980 Ga0207698_10796198
981 Ga0209813_10024196
982 Ga0209813_10060264
983 Ga0268265_10087379
984 Ga0268265_10107671
985 Ga0268265_11375656
986 Ga0268264_10058104
987 Ga0268264_10248323
988 Ga0268264_10332318
989 Ga0265336_10000014
990 Ga0307517_10000174
991 Ga0307517_10143023
992 Ga0307517_10155649
993 Ga0307515_10000080
994 Ga0307515_10002453
995 Ga0307515_10004018
996 Ga0307515_10163649
997 Ga0307515_10570781
998 Ga0265324_10001016
999 Ga0307512_10031486
1000 Ga0307512_10033803
1001 Ga0307512_10077867
1002 Ga0307513_10045166
1003 Ga0307513_10195323
1004 Ga0307509_10000225
1005 Ga0307509_10005996
1006 Ga0307509_10107163
1007 Ga0307509_10159924
1008 Ga0307509_10216707
1009 Ga0307509_10604272
1010 Ga0307408_100291366
1011 Ga0307408_100329521
1012 Ga0307508_10000123
1013 Ga0307508_10000185
1014 Ga0307508_10077818
1015 Ga0307514_10010896
1016 Ga0307514_10032702
1017 Ga0307514_10121761
1018 Ga0307514_10125826
1019 Ga0307514_10205684
1020 Ga0307516_10005049
1021 Ga0307405_10375811
1022 Ga0307413_11118761
1023 Ga0307518_10219643
1024 Ga0307410_10511374
1025 Ga0307407_10259634
1026 Ga0307412_10088661
1027 Ga0307412_10538811
1028 Ga0307409_100399556
1029 Ga0307416_101661837
1030 Ga0307416_102396174
1031 Ga0307414_10807580
1032 Ga0307411_10241773
1033 Ga0307411_10290983
1034 Ga0307411_12086662
1035 Ga0307415_100219561
1036 Ga0307415_100286340
1037 Ga0307415_101914837
1038 Ga0307415_102499756
1039 Ga0307507_10079564
1040 Ga0307507_10172045
1041 Ga0307510_10002036
1042 Ga0307510_10034205
1043 Ga0307510_10056274
1044 Ga0307510_10227514
1045 Ga0307510_10535697
1046 Ga0373932_0092294
1047 Ga0373954_0153016
1048 Ga0373924_0166684
1049 Ga0373931_0008787
1050 Ga0373931_0347509
1051 Ga0373927_0012586
1052 Ga0373927_0459899
1053 Ga0373947_0045879
1054 Ga0373925_1399906
1055 Ga0395898_0001856
1056 Ga0395905_0007759
1057 Ga0395905_0033384
1058 Ga0436363_0123701
1059 Ga0439439_0065084
1060 Ga0439461_0004624
1061 Ga0439465_0015821
1062 Ga0451789_0009001
1063 Ga0451791_1394348
1064 Ga0451793_1454431
1065 Ga0451795_1455001
1066 Ga0451804_0125096
1067 Ga0451833_1380058
1068 Ga0451853_1066355
1069 Ga0451853_2440260
1070 Ga0439431_0002588
1071 Ga0439442_056118
1072 Ga0439450_149176
1073 Ga0439455_0034558
1074 Ga0439462_0084524
1075 Ga0450888_024650
1076 Ga0450896_016432
1077 Ga0450898_002013
1078 Ga0439458_0014497
1079 Ga0450909_052772
1080 Ga0439434_0018964
1081 Ga0466969_0002402
1082 Ga0466969_0023706
1083 Ga0466972_0014669
1084 Ga0466965_0025856
1085 Ga0466965_0033351
1086 Ga0466966_0095242
1087 Ga0466963_0060506
1088 Ga0466964_0002511
1089 Ga0466964_0014632
1090 Ga0466971_0022613
1091 Ga0466957_0351812
1092 Ga0466959_0000027
1093 Ga0451576_0020730
1094 Ga0451576_2546762
1095 Ga0466958_0077178
1096 Ga0495592_0001312
1097 Ga0495638_0044159
1098 Ga0495641_0205912
1099 Ga0495650_0003795
1100 Ga0495580_0351902
1101 Ga0495664_0154216
1102 Ga0495583_0132168
1103 Ga0495606_0145876
1104 Ga0495610_0054979
1105 Ga0495610_0116959
1106 Ga0495616_0397572
1107 Ga0495620_0219831
1108 Ga0495630_0461554
1109 Ga0495632_0003352
1110 Ga0495648_0496982
1111 Ga0495666_0176311
1112 Ga0495666_0251300
1113 Ga0495642_0076873
1114 Ga0495652_0721217
1115 Ga0495640_0301127
1116 Ga0495621_0090038
1117 Ga0495597_0382901
1118 Ga0495622_0098369
1119 Ga0495625_0025423
1120 Ga0495658_0031522
1121 Ga0495658_0067269
1122 Ga0495658_0399768
1123 Ga0495658_0482470
1124 Ga0495658_0583554
1125 Ga0495624_0259094
1126 Ga0495671_0279271
1127 Ga0495649_0002120
1128 Ga0495660_0038597
1129 Ga0495687_010550
1130 Ga0495673_0254721
1131 Ga0495684_0234892
1132 Ga0495686_0003436
1133 Ga0495686_0048165
1134 Ga0495593_0110771
1135 Ga0495626_0066365
1136 Ga0496101_0388216
1137 Ga0496102_0029951
1138 Ga0496108_0142201
1139 Ga0496108_0168179
1140 Ga0496108_0239065
1141 Ga0496109_0372729
1142 Ga0496109_0457425
1143 Ga0496110_0499952
1144 Ga0496110_0971719
1145 Ga0496110_1043168
1146 Ga0496113_0411641
1147 Ga0496113_0586036
1148 Ga0496124_0000596
1149 Ga0496124_0448628
1150 Ga0496125_0026833
1151 Ga0496125_0343237
1152 Ga0501043_0000020
1153 Ga0501046_0000039
1154 Ga0501047_0000028
1155 Ga0501047_0180459
1156 Ga0501048_0042394
1157 Ga0501206_005674
1158 Ga0501081_0817109
1159 Ga0501035_0016072
1160 Ga0501045_0003924
1161 nmdc:mga03683_4458_c2
1162 nmdc:mga03683_499273_c1
1163 nmdc:mga03683_5592_c1
1164 nmdc:mga03n38_220610_c1
1165 nmdc:mga03n38_34414_c1
1166 nmdc:mga00v17_121253_c1
1167 nmdc:mga00v17_75832_c1
1168 nmdc:mga0yw44_11375_c1
1169 nmdc:mga0k408_1297_c2
1170 nmdc:mga0k408_186950_c1
1171 nmdc:mga0k408_28918_c1
1172 nmdc:mga0k408_4162_c1
1173 nmdc:mga0k408_444067_c1
1174 nmdc:mga0k408_56181_c1
1175 nmdc:mga0k408_5953_c1
1176 nmdc:mga0k408_6062_c1
1177 nmdc:mga0k408_62310_c1
1178 nmdc:mga0k408_633285_c1
1179 nmdc:mga0k408_64087_c2
1180 nmdc:mga06z11_5010_c1
1181 nmdc:mga06z11_7518_c1
1182 nmdc:mga06z11_8871_c1
1183 nmdc:mga04h51_120780_c1
1184 nmdc:mga04h51_23895_c1
1185 nmdc:mga04h51_61538_c1
1186 nmdc:mga07m45_14218_c1
1187 nmdc:mga07m45_153063_c1
1188 nmdc:mga07m45_166538_c1
1189 nmdc:mga07m45_21310_c1
1190 nmdc:mga07m45_271518_c1
1191 nmdc:mga07m45_6344_c1
1192 nmdc:mga07m45_7091_c1
1193 nmdc:mga07m45_7472_c1
1194 nmdc:mga09592_680303_c1
1195 nmdc:mga0n895_910688_c1
1196 nmdc:mga0sz30_15718_c1
1197 nmdc:mga0sz30_4813_c1
1198 Ga0495655_0042318
1199 Ga0500578_0000079
1200 Ga0500644_0036295
1201 Ga0500651_0074405
1202 Ga0500650_0414515
1203 Ga0500594_0001408
1204 Ga0500614_027825
1205 Ga0500621_281378
1206 Ga0500655_056246
1207 Ga0500559_0000329
1208 Ga0500561_0032044
1209 Ga0500568_0020365
1210 Ga0500568_0050450
1211 Ga0500616_0441954
1212 Ga0500619_000045
1213 Ga0500622_0007462
1214 Ga0500627_0097854
1215 Ga0500636_0023411
1216 Ga0500587_007603
1217 Ga0466962_0126812
1218 Ga0530510_0404238
1219 2587759952
1220 2644341021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

12

121

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.8233 14 126
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.8164 14 126
8hn2-assembly1.cif.gz_B selenomethionine-labelled soluble domain of rieske iron-sulfur protein from chlorobaculum tepidum 0.8076 14 123
1fqt-assembly1.cif.gz_B crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase 0.8048 15 131
3vmh-assembly1.cif.gz_C oxygen-bound complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase 0.8 14 124
ID Description Score Start End Superfamily
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8233 14 126 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8164 14 126 2.102.10.10
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.809 16 127 2.102.10.10
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8078 17 127 2.102.10.10
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8076 15 127 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A4R2MDM1-F1-model_v4 Nitrite reductase/ring-hydroxylating ferredoxin subunit 0.9925 15 131 GO:0046872
GO:0051537
AF-I0HWN7-F1-model_v4 Rieske domain-containing protein 0.9892 14 131 GO:0046872
GO:0051537
AF-A0A643FDJ4-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9885 14 134 GO:0046872
GO:0051537
AF-A0A521YY29-F1-model_v4 Rieske (2Fe-2S) protein 0.9884 14 133 GO:0046872
GO:0051537
AF-A0A4R6RES2-F1-model_v4 Nitrite reductase/ring-hydroxylating ferredoxin subunit 0.9862 14 132 GO:0046872
GO:0051537

Map