F468919

General Info

Members Datasets Scaffolds Average Seq Length
609 341 1218 266

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_6170_c1|nmdc:mga08x19_6170_c1_597_1550
Length 317
Sequence MVSIEGAQRQTFRRALNGSFVSAHWPLILPAVYRLAFGRAMGTLAPIATARTEDSMTYTHGHHESVLRSHKWRTVDNSAAYLAPRLTSGISVLDLGCGPGTITADIGRRVAPGRVLGIDASADVIEKARRDTGGGPNVEFSVGDLYALDIDDDTFDVVHAHQVLQHLADPVGALREMKRVCKPGGLVAARDGDYGAFRWYPDEPTIDRWLALYRKIARRNAGEPDAGRFLLAWAHSAGFEDVLPGASVWCFATADDRAWWGGLWADRMTDSAIARQAVTEGLASEKELREIAEGWRRWAAHPDAWYAVLHGEILCRA

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
297 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
322 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
323 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
326 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
327 2643221711 Terrabacter sp. Root85 Isolate Unclassified
328 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
329 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
330 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
331 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
332 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
333 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
334 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
335 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
336 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
337 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
338 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
339 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
340 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
341 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 0.33
Isolates 2.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.43
Nodule 0
Rhizoplane 6.24
Rhizosphere 84.89
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_6170_c1 3300050514 Bacteria 7091
2 JGI24740J21852_10030184 3300001979 Bacteria 1768
3 JGI24739J22299_10018639 3300001989 Bacteria 2492
4 JGI24737J22298_10006841 3300001990 Bacteria 3874
5 JGI25406J46586_10045119 3300003203 Unclassified 1520
6 Ga0006562J51391_1166945 3300003578 Bacteria 993
7 Ga0065715_10002475 3300005293 Bacteria 5143
8 Ga0065715_10103894 3300005293 Bacteria 2999
9 Ga0065715_10262667 3300005293 Bacteria 1133
10 Ga0065707_10082505 3300005295 Bacteria 14375
11 Ga0070676_10024226 3300005328 Bacteria 3417
12 Ga0070676_10190840 3300005328 Bacteria 1338
13 Ga0070676_10198882 3300005328 Bacteria 1313
14 Ga0070683_100006608 3300005329 Bacteria 9739
15 Ga0070683_100097930 3300005329 Bacteria 2759
16 Ga0070683_100273519 3300005329 Bacteria 1607
17 Ga0070670_100015499 3300005331 Bacteria 6546
18 Ga0070670_100200977 3300005331 Bacteria 1732
19 Ga0070670_100212433 3300005331 Bacteria 1682
20 Ga0068869_100011829 3300005334 Bacteria 5741
21 Ga0070680_100148284 3300005336 Bacteria 1969
22 Ga0070682_100073140 3300005337 Bacteria 2198
23 Ga0068868_100139181 3300005338 Bacteria 1991
24 Ga0070660_100030278 3300005339 Bacteria 4061
25 Ga0070689_100143011 3300005340 Bacteria 1925
26 Ga0070691_10070776 3300005341 Bacteria 1692
27 Ga0070687_100069161 3300005343 Bacteria 1890
28 Ga0070661_100120877 3300005344 Bacteria 1962
29 Ga0070692_10057727 3300005345 Bacteria 2036
30 Ga0070668_100072546 3300005347 Bacteria 2682
31 Ga0070668_100458468 3300005347 Bacteria 1097
32 Ga0070669_100034095 3300005353 Bacteria 3685
33 Ga0070669_100069057 3300005353 Bacteria 2609
34 Ga0070675_100006704 3300005354 Bacteria 8852
35 Ga0070675_100284204 3300005354 Bacteria 1454
36 Ga0070671_100016920 3300005355 Bacteria 5897
37 Ga0070671_100077026 3300005355 Bacteria 2787
38 Ga0070671_100132383 3300005355 Bacteria 2100
39 Ga0070674_100457324 3300005356 Bacteria 1055
40 Ga0070674_100566570 3300005356 Bacteria 955
41 Ga0070673_100042028 3300005364 Bacteria 3521
42 Ga0070673_100042254 3300005364 Bacteria 3513
43 Ga0070659_100336491 3300005366 Bacteria 1264
44 Ga0070667_100078308 3300005367 Bacteria 2824
45 Ga0070709_10307324 3300005434 Bacteria 1160
46 Ga0070714_100141634 3300005435 Bacteria 2159
47 Ga0070713_100020634 3300005436 Bacteria 5055
48 Ga0070713_100374940 3300005436 Bacteria 1324
49 Ga0070710_10077632 3300005437 Bacteria 1931
50 Ga0070710_10119316 3300005437 Bacteria 1594
51 Ga0070710_10134283 3300005437 Bacteria 1511
52 Ga0070711_100019159 3300005439 Bacteria 4385
53 Ga0070705_100034879 3300005440 Bacteria 2816
54 Ga0070705_100103973 3300005440 Bacteria 1800
55 Ga0070700_100059596 3300005441 Bacteria 2404
56 Ga0070708_100028167 3300005445 Bacteria 4831
57 Ga0070708_100028565 3300005445 Bacteria 4801
58 Ga0070708_100230810 3300005445 Bacteria 1736
59 Ga0070663_100077715 3300005455 Bacteria 2431
60 Ga0070663_100324242 3300005455 Bacteria 1239
61 Ga0070678_100070087 3300005456 Bacteria 2620
62 Ga0070678_100139410 3300005456 Bacteria 1938
63 Ga0070678_100183103 3300005456 Bacteria 1716
64 Ga0070681_10023881 3300005458 Bacteria 6155
65 Ga0068867_100085710 3300005459 Bacteria 2382
66 Ga0070706_100016819 3300005467 Bacteria 6756
67 Ga0070707_100010259 3300005468 Bacteria 8724
68 Ga0070698_100015482 3300005471 Bacteria 8056
69 Ga0070698_100024846 3300005471 Bacteria 6247
70 Ga0070698_100152396 3300005471 Bacteria 2259
71 Ga0070699_100003390 3300005518 Bacteria 14096
72 Ga0070699_100004078 3300005518 Bacteria 12914
73 Ga0070699_100042284 3300005518 Bacteria 3943
74 Ga0070684_100051700 3300005535 Bacteria 3571
75 Ga0070684_100057409 3300005535 Bacteria 3399
76 Ga0070697_100004904 3300005536 Bacteria 10270
77 Ga0068853_100004950 3300005539 Bacteria 10379
78 Ga0070686_100499291 3300005544 Bacteria 944
79 Ga0070695_100007021 3300005545 Bacteria 6674
80 Ga0070695_100080840 3300005545 Bacteria 2149
81 Ga0070695_100130845 3300005545 Bacteria 1729
82 Ga0070695_100136570 3300005545 Bacteria 1696
83 Ga0070696_100132699 3300005546 Bacteria 1814
84 Ga0070704_100051466 3300005549 Bacteria 2901
85 Ga0070664_100113799 3300005564 Bacteria 2363
86 Ga0068857_100004953 3300005577 Bacteria 11313
87 Ga0068857_100040372 3300005577 Bacteria 4138
88 Ga0068857_100077717 3300005577 Bacteria 2962
89 Ga0068857_100264590 3300005577 Bacteria 1579
90 Ga0068854_100358555 3300005578 Bacteria 1196
91 Ga0068856_100099743 3300005614 Bacteria 2895
92 Ga0068856_100292383 3300005614 Bacteria 1646
93 Ga0070702_100005214 3300005615 Bacteria 6021
94 Ga0070702_100100318 3300005615 Bacteria 1774
95 Ga0070702_100147599 3300005615 Bacteria 1506
96 Ga0068859_100133741 3300005617 Bacteria 2552
97 Ga0068864_100247204 3300005618 Bacteria 1655
98 Ga0068861_100083879 3300005719 Bacteria 2500
99 Ga0068861_100491419 3300005719 Bacteria 1108
100 Ga0068851_10119806 3300005834 Bacteria 1413
101 Ga0068863_100133360 3300005841 Bacteria 2372
102 Ga0068863_100345221 3300005841 Bacteria 1449
103 Ga0068858_100114152 3300005842 Bacteria 2523
104 Ga0068860_100017540 3300005843 Bacteria 6975
105 Ga0068862_100097692 3300005844 Bacteria 2564
106 Ga0081455_10166351 3300005937 Bacteria 1684
107 Ga0081540_1033734 3300005983 Bacteria 2774
108 Ga0081539_10012581 3300005985 Bacteria 6497
109 Ga0070717_10101115 3300006028 Bacteria 2448
110 Ga0075368_10008406 3300006042 Bacteria 3675
111 Ga0075363_100023301 3300006048 Bacteria 3135
112 Ga0075363_100127485 3300006048 Bacteria 1426
113 Ga0075364_10040530 3300006051 Bacteria 3020
114 Ga0070716_100078835 3300006173 Bacteria 1959
115 Ga0070716_100127466 3300006173 Bacteria 1603
116 Ga0070716_100408458 3300006173 Bacteria 978
117 Ga0070712_100193918 3300006175 Bacteria 1591
118 Ga0075367_10037616 3300006178 Bacteria 2813
119 Ga0075367_10044895 3300006178 Bacteria 2592
120 Ga0075367_10164900 3300006178 Bacteria 1379
121 Ga0075367_10198096 3300006178 Bacteria 1254
122 Ga0075366_10020484 3300006195 Bacteria 3838
123 Ga0075366_10039569 3300006195 Bacteria 2787
124 Ga0097621_100051026 3300006237 Bacteria 3365
125 Ga0097621_100213364 3300006237 Bacteria 1680
126 Ga0075370_10196700 3300006353 Bacteria 1189
127 Ga0068871_100223084 3300006358 Bacteria 1634
128 Ga0075428_100020203 3300006844 Bacteria 7375
129 Ga0075428_100378439 3300006844 Bacteria 1518
130 Ga0075430_100420570 3300006846 Bacteria 1103
131 Ga0075431_100061721 3300006847 Bacteria 3867
132 Ga0075433_10121814 3300006852 Bacteria 2316
133 Ga0075433_10304000 3300006852 Unclassified 1412
134 Ga0075434_100020026 3300006871 Bacteria 6480
135 Ga0075434_100195814 3300006871 Bacteria 2041
136 Ga0075434_100218962 3300006871 Bacteria 1923
137 Ga0075434_100613790 3300006871 Bacteria 1106
138 Ga0068865_100097616 3300006881 Bacteria 2145
139 Ga0068865_100098612 3300006881 Bacteria 2135
140 Ga0068865_100278504 3300006881 Bacteria 1331
141 Ga0075436_100032269 3300006914 Bacteria 3609
142 Ga0075436_100041933 3300006914 Bacteria 3156
143 Ga0075436_100126942 3300006914 Bacteria 1787
144 Ga0097620_100133748 3300006931 Bacteria 2552
145 Ga0111539_10124657 3300009094 Bacteria 3019
146 Ga0111539_10223621 3300009094 Bacteria 2192
147 Ga0111539_10285612 3300009094 Bacteria 1920
148 Ga0105245_10004307 3300009098 Bacteria 12598
149 Ga0105245_10022812 3300009098 Bacteria 5493
150 Ga0105245_10406107 3300009098 Bacteria 1362
151 Ga0114129_10310382 3300009147 Bacteria 2100
152 Ga0105243_10207881 3300009148 Bacteria 1721
153 Ga0105241_10447988 3300009174 Bacteria 1141
154 Ga0105242_10012366 3300009176 Bacteria 6570
155 Ga0105242_10603492 3300009176 Bacteria 1061
156 Ga0105248_10040519 3300009177 Bacteria 5222
157 Ga0105248_10042758 3300009177 Bacteria 5081
158 Ga0105248_10087139 3300009177 Bacteria 3514
159 Ga0105248_10937763 3300009177 Bacteria 978
160 Ga0105249_10435554 3300009553 Bacteria 1347
161 Ga0105239_10352800 3300010375 Bacteria 1661
162 Ga0105239_10675954 3300010375 Bacteria 1180
163 Ga0105239_10747571 3300010375 Bacteria 1119
164 Ga0105246_10016195 3300011119 Bacteria 4718
165 Ga0105246_10031911 3300011119 Bacteria 3489
166 Ga0105246_10067873 3300011119 Bacteria 2499
167 Ga0157371_10049167 3300013102 Bacteria 2996
168 Ga0157378_10164080 3300013297 Bacteria 2080
169 Ga0163162_10110888 3300013306 Bacteria 2841
170 Ga0157372_10379908 3300013307 Bacteria 1646
171 Ga0157375_10176110 3300013308 Bacteria 2288
172 Ga0157375_10245759 3300013308 Bacteria 1950
173 Ga0157375_10355217 3300013308 Bacteria 1632
174 Ga0163163_10233720 3300014325 Bacteria 1888
175 Ga0163163_10502742 3300014325 Bacteria 1274
176 Ga0163163_10990118 3300014325 Bacteria 904
177 Ga0157380_10005475 3300014326 Bacteria 8870
178 Ga0157380_10051694 3300014326 Bacteria 3251
179 Ga0157380_10887927 3300014326 Bacteria 916
180 Ga0157377_10027930 3300014745 Bacteria 3033
181 Ga0157377_10107071 3300014745 Bacteria 1675
182 Ga0206354_11191814 3300020081 Bacteria 1131
183 Ga0213876_10003446 3300021384 Bacteria 9050
184 Ga0213875_10012960 3300021388 Bacteria 4105
185 Ga0213875_10051477 3300021388 Bacteria 1929
186 Ga0213875_10173830 3300021388 Bacteria 1012
187 Ga0207692_10010883 3300025898 Bacteria 3849
188 Ga0207692_10352491 3300025898 Bacteria 908
189 Ga0207688_10031032 3300025901 Bacteria 2948
190 Ga0207647_10033304 3300025904 Bacteria 3300
191 Ga0207699_10039726 3300025906 Bacteria 2706
192 Ga0207699_10386505 3300025906 Bacteria 994
193 Ga0207643_10029768 3300025908 Bacteria 3037
194 Ga0207684_10100627 3300025910 Bacteria 2470
195 Ga0207707_10193399 3300025912 Bacteria 1774
196 Ga0207693_10103009 3300025915 Bacteria 2238
197 Ga0207663_10198836 3300025916 Bacteria 1444
198 Ga0207663_10286875 3300025916 Bacteria 1225
199 Ga0207660_10567800 3300025917 Bacteria 923
200 Ga0207662_10006185 3300025918 Bacteria 6444
201 Ga0207657_10005312 3300025919 Bacteria 13498
202 Ga0207649_10070688 3300025920 Bacteria 2227
203 Ga0207646_10045461 3300025922 Bacteria 3942
204 Ga0207646_10128624 3300025922 Bacteria 2278
205 Ga0207681_10139478 3300025923 Bacteria 1804
206 Ga0207650_10026591 3300025925 Bacteria 4130
207 Ga0207650_10059987 3300025925 Bacteria 2838
208 Ga0207650_10080194 3300025925 Bacteria 2474
209 Ga0207659_10003271 3300025926 Bacteria 9705
210 Ga0207659_10288042 3300025926 Bacteria 1345
211 Ga0207664_10019215 3300025929 Bacteria 5046
212 Ga0207664_10145915 3300025929 Bacteria 2006
213 Ga0207664_10198059 3300025929 Bacteria 1732
214 Ga0207664_10291178 3300025929 Bacteria 1435
215 Ga0207644_10035077 3300025931 Bacteria 3513
216 Ga0207644_10406331 3300025931 Bacteria 1114
217 Ga0207690_10027617 3300025932 Bacteria 3588
218 Ga0207706_10069048 3300025933 Bacteria 3108
219 Ga0207686_10043828 3300025934 Bacteria 2744
220 Ga0207709_10110333 3300025935 Bacteria 1838
221 Ga0207670_10272003 3300025936 Bacteria 1317
222 Ga0207669_10139619 3300025937 Bacteria 1680
223 Ga0207704_10099550 3300025938 Bacteria 1934
224 Ga0207704_10328577 3300025938 Bacteria 1182
225 Ga0207665_10011357 3300025939 Bacteria 5848
226 Ga0207665_10022596 3300025939 Bacteria 4139
227 Ga0207665_10036757 3300025939 Bacteria 3258
228 Ga0207691_10085876 3300025940 Bacteria 2824
229 Ga0207691_10165659 3300025940 Bacteria 1937
230 Ga0207711_10052825 3300025941 Bacteria 3484
231 Ga0207711_10284973 3300025941 Bacteria 1522
232 Ga0207689_10021486 3300025942 Bacteria 5426
233 Ga0207689_10054301 3300025942 Bacteria 3300
234 Ga0207661_10016991 3300025944 Bacteria 5374
235 Ga0207661_10096370 3300025944 Bacteria 2475
236 Ga0207679_10048933 3300025945 Bacteria 3080
237 Ga0207679_10726386 3300025945 Bacteria 902
238 Ga0207667_10309568 3300025949 Bacteria 1613
239 Ga0207651_10206382 3300025960 Bacteria 1579
240 Ga0207651_10257185 3300025960 Bacteria 1432
241 Ga0207712_10061177 3300025961 Bacteria 2672
242 Ga0207712_10108141 3300025961 Bacteria 2081
243 Ga0207668_10064675 3300025972 Bacteria 2586
244 Ga0207668_10068187 3300025972 Bacteria 2528
245 Ga0207640_10269200 3300025981 Bacteria 1332
246 Ga0207658_10429460 3300025986 Bacteria 1166
247 Ga0207703_10142758 3300026035 Bacteria 2080
248 Ga0207703_10412460 3300026035 Bacteria 1255
249 Ga0207639_10005626 3300026041 Bacteria 8480
250 Ga0207678_10048003 3300026067 Bacteria 3691
251 Ga0207678_10085463 3300026067 Bacteria 2697
252 Ga0207678_10102710 3300026067 Bacteria 2440
253 Ga0207708_10018081 3300026075 Bacteria 5304
254 Ga0207708_10025612 3300026075 Bacteria 4464
255 Ga0207702_10424777 3300026078 Bacteria 1286
256 Ga0207702_10644943 3300026078 Bacteria 1041
257 Ga0207641_10088605 3300026088 Bacteria 2703
258 Ga0207648_10032035 3300026089 Bacteria 4645
259 Ga0207648_10400436 3300026089 Bacteria 1244
260 Ga0207676_10169320 3300026095 Bacteria 1901
261 Ga0207674_10004002 3300026116 Bacteria 17899
262 Ga0207674_10033965 3300026116 Bacteria 5335
263 Ga0207674_10042157 3300026116 Bacteria 4716
264 Ga0207674_10073160 3300026116 Bacteria 3441
265 Ga0207674_10122308 3300026116 Bacteria 2568
266 Ga0207675_100016427 3300026118 Bacteria 6913
267 Ga0207675_100029751 3300026118 Bacteria 5086
268 Ga0207675_100043756 3300026118 Bacteria 4182
269 Ga0207675_100149624 3300026118 Bacteria 2221
270 Ga0207683_10013047 3300026121 Bacteria 7091
271 Ga0207683_10081946 3300026121 Bacteria 2865
272 Ga0207683_10269311 3300026121 Bacteria 1556
273 Ga0207683_10302759 3300026121 Bacteria 1463
274 Ga0209813_10044674 3300027866 Bacteria 1362
275 Ga0207428_10010157 3300027907 Bacteria 8418
276 Ga0207428_10432680 3300027907 Bacteria 961
277 Ga0268265_10059740 3300028380 Bacteria 2919
278 Ga0268265_10815125 3300028380 Bacteria 911
279 Ga0268264_10013616 3300028381 Bacteria 6694
280 Ga0268264_10139139 3300028381 Bacteria 2162
281 Ga0307515_10065338 3300028794 Bacteria 5066
282 Ga0265338_10224830 3300028800 Bacteria 1400
283 Ga0265325_10002222 3300031241 Bacteria 13183
284 Ga0265339_10001753 3300031249 Bacteria 15977
285 Ga0265327_10009118 3300031251 Bacteria 7224
286 Ga0307513_10013618 3300031456 Bacteria 9970
287 Ga0307408_100100059 3300031548 Bacteria 2207
288 Ga0265313_10004510 3300031595 Bacteria 10651
289 Ga0307508_10269174 3300031616 Bacteria 1298
290 Ga0265314_10236859 3300031711 Bacteria 1055
291 Ga0307405_10135465 3300031731 Bacteria 1709
292 Ga0307405_10252605 3300031731 Bacteria 1313
293 Ga0307413_10162664 3300031824 Bacteria 1570
294 Ga0307410_10084766 3300031852 Bacteria 2235
295 Ga0307406_10116416 3300031901 Bacteria 1849
296 Ga0307412_10164833 3300031911 Bacteria 1651
297 Ga0307409_100356708 3300031995 Bacteria 1382
298 Ga0307409_100796375 3300031995 Bacteria 952
299 Ga0307411_10101406 3300032005 Unclassified 2037
300 Ga0307415_100580505 3300032126 Bacteria 994
301 Ga0316216_1004824 3300033548 Bacteria 981
302 Ga0373959_0040576 3300034820 Bacteria 975
303 Ga0373938_0025800 3300034957 Bacteria 1226
304 Ga0373926_0000370 3300035083 Bacteria 11500
305 Ga0373926_0003844 3300035083 Bacteria 4902
306 Ga0373929_0036519 3300035085 Bacteria 1074
307 Ga0373944_0014075 3300035089 Bacteria 2228
308 Ga0373951_0030312 3300035091 Bacteria 1273
309 Ga0373923_0025368 3300035111 Bacteria 2349
310 Ga0373923_0026939 3300035111 Bacteria 2289
311 Ga0373936_0000513 3300035113 Bacteria 13185
312 Ga0373936_0001868 3300035113 Bacteria 7770
313 Ga0373936_0032731 3300035113 Bacteria 2057
314 Ga0373945_0000260 3300035116 Bacteria 14802
315 Ga0373945_0081471 3300035116 Bacteria 1240
316 Ga0373953_0127766 3300035117 Bacteria 1082
317 Ga0373954_0040072 3300035118 Bacteria 2182
318 Ga0373954_0277410 3300035118 Bacteria 826
319 Ga0373956_0019191 3300035119 Bacteria 2899
320 Ga0373956_0082373 3300035119 Bacteria 1477
321 Ga0373957_0012195 3300035120 Bacteria 2888
322 Ga0373943_0000528 3300035170 Bacteria 16530
323 Ga0373943_0009428 3300035170 Bacteria 4375
324 Ga0373946_0000477 3300035171 Bacteria 13256
325 Ga0373962_0060015 3300035242 Bacteria 1115
326 Ga0373924_0007121 3300035410 Bacteria 4031
327 Ga0373935_0000795 3300035692 Bacteria 16831
328 Ga0373935_0003234 3300035692 Bacteria 9414
329 Ga0373935_0035159 3300035692 Bacteria 3127
330 Ga0373935_0150626 3300035692 Bacteria 1578
331 Ga0373935_0236706 3300035692 Bacteria 1273
332 Ga0373927_0007109 3300035695 Bacteria 7594
333 Ga0373927_0016242 3300035695 Bacteria 4912
334 Ga0373927_0389146 3300035695 Bacteria 920
335 Ga0373933_0037379 3300035724 Bacteria 2847
336 Ga0373933_0038091 3300035724 Bacteria 2824
337 Ga0373947_0000547 3300035725 Bacteria 22035
338 Ga0373937_0001467 3300036401 Bacteria 19736
339 Ga0373937_0009941 3300036401 Bacteria 8295
340 Ga0373937_0014117 3300036401 Bacteria 7045
341 Ga0373937_0033741 3300036401 Bacteria 4651
342 Ga0373937_0071047 3300036401 Bacteria 3211
343 Ga0373937_0085006 3300036401 Bacteria 2928
344 Ga0373925_0001636 3300037068 Bacteria 18879
345 Ga0373925_0008760 3300037068 Bacteria 7369
346 Ga0373925_0027264 3300037068 Bacteria 4183
347 Ga0373925_0514363 3300037068 Bacteria 983
348 Ga0436364_0278916 3300037853 Bacteria 1104
349 Ga0436364_0896639 3300037853 Bacteria 7717
350 Ga0436364_0904395 3300037853 Bacteria 8301
351 Ga0436364_1380209 3300037853 Bacteria 4144
352 Ga0436365_0673635 3300039437 Bacteria 1003
353 Ga0436365_1321692 3300039437 Bacteria 1817
354 Ga0436365_1880251 3300039437 Bacteria 971
355 Ga0436363_0694266 3300039450 Bacteria 1458
356 Ga0436363_1175736 3300039450 Bacteria 986
357 Ga0436362_0407629 3300039453 Bacteria 6128
358 Ga0439433_0035639 3300041999 Bacteria 1148
359 Ga0439445_0026055 3300042004 Unclassified 1495
360 Ga0466965_0000002 3300044683 Bacteria 297957
361 Ga0466966_0030053 3300044684 Bacteria 3531
362 Ga0466961_0001321 3300044693 Bacteria 15313
363 Ga0466961_0062872 3300044693 Bacteria 2359
364 Ga0466963_0027644 3300044694 Bacteria 3635
365 Ga0466963_0110948 3300044694 Bacteria 1883
366 Ga0466964_0142969 3300044706 Bacteria 1102
367 Ga0466960_0010624 3300044901 Bacteria 3827
368 Ga0466959_0005885 3300045049 Bacteria 8447
369 Ga0451576_0026378 3300045051 Bacteria 6251
370 Ga0466958_0033213 3300045836 Bacteria 3073
371 Ga0466967_0005746 3300045976 Bacteria 8662
372 Ga0466967_0010937 3300045976 Bacteria 6840
373 Ga0466967_0314183 3300045976 Bacteria 1510
374 Ga0495592_0049178 3300046454 Bacteria 3134
375 Ga0495592_0207938 3300046454 Bacteria 1316
376 Ga0495603_0008271 3300046455 Bacteria 6288
377 Ga0495603_0150524 3300046455 Unclassified 1352
378 Ga0495629_0177865 3300046459 Bacteria 1475
379 Ga0495629_0178129 3300046459 Unclassified 1474
380 Ga0495641_0003438 3300046461 Bacteria 11852
381 Ga0495641_0009441 3300046461 Bacteria 5792
382 Ga0495651_0011715 3300046462 Bacteria 6738
383 Ga0495651_0026676 3300046462 Bacteria 4499
384 Ga0495651_0115724 3300046462 Bacteria 1976
385 Ga0495651_0268325 3300046462 Bacteria 1158
386 Ga0495653_0003685 3300046463 Bacteria 12380
387 Ga0495653_0031926 3300046463 Bacteria 4185
388 Ga0495653_0070785 3300046463 Bacteria 2609
389 Ga0495653_0179310 3300046463 Bacteria 1455
390 Ga0495580_0019732 3300046472 Bacteria 5004
391 Ga0495582_0043224 3300046473 Bacteria 2482
392 Ga0495639_0013134 3300046475 Bacteria 3573
393 Ga0495662_0000974 3300046476 Bacteria 14012
394 Ga0495664_0008718 3300046477 Bacteria 5661
395 Ga0495664_0016657 3300046477 Bacteria 4191
396 Ga0495664_0053716 3300046477 Bacteria 2395
397 Ga0495594_0142748 3300046499 Bacteria 1358
398 Ga0495608_0019907 3300046511 Bacteria 4615
399 Ga0495608_0022963 3300046511 Bacteria 4277
400 Ga0495608_0162025 3300046511 Bacteria 1422
401 Ga0495618_0026741 3300046514 Bacteria 3589
402 Ga0495618_0051803 3300046514 Bacteria 2594
403 Ga0495618_0126758 3300046514 Bacteria 1634
404 Ga0495628_0038429 3300046516 Bacteria 3832
405 Ga0495628_0134253 3300046516 Bacteria 1892
406 Ga0495628_0278267 3300046516 Bacteria 1243
407 Ga0495630_0002306 3300046517 Bacteria 13278
408 Ga0495630_0030786 3300046517 Bacteria 3994
409 Ga0495630_0093347 3300046517 Bacteria 2274
410 Ga0495666_0012070 3300046526 Bacteria 4312
411 Ga0495652_0018163 3300046529 Bacteria 6276
412 Ga0495652_0023604 3300046529 Bacteria 5452
413 Ga0495652_0041037 3300046529 Bacteria 3996
414 Ga0495652_0151582 3300046529 Bacteria 1811
415 Ga0495652_0386244 3300046529 Bacteria 995
416 Ga0495665_0018144 3300046531 Bacteria 3782
417 Ga0495665_0041700 3300046531 Bacteria 2443
418 Ga0495640_0061227 3300046533 Bacteria 2557
419 Ga0495587_0021737 3300046536 Bacteria 3959
420 Ga0495587_0032715 3300046536 Bacteria 3142
421 Ga0495587_0176482 3300046536 Bacteria 1212
422 Ga0495598_0005735 3300046537 Bacteria 2771
423 Ga0495621_0010070 3300046539 Bacteria 2885
424 Ga0495645_0040865 3300046543 Bacteria 3381
425 Ga0495645_0274193 3300046543 Bacteria 1112
426 Ga0495622_0108270 3300046557 Bacteria 1273
427 Ga0495667_0004158 3300046559 Bacteria 9738
428 Ga0495667_0013654 3300046559 Bacteria 5491
429 Ga0495667_0116713 3300046559 Bacteria 1724
430 Ga0495634_0019691 3300046642 Bacteria 4792
431 Ga0495634_0034588 3300046642 Bacteria 3467
432 Ga0495635_0001354 3300046663 Bacteria 16309
433 Ga0495635_0050862 3300046663 Bacteria 2855
434 Ga0495635_0055652 3300046663 Bacteria 2725
435 Ga0495657_0007289 3300046675 Bacteria 8558
436 Ga0495657_0009596 3300046675 Bacteria 7330
437 Ga0495657_0024436 3300046675 Bacteria 4304
438 Ga0495657_0148026 3300046675 Bacteria 1460
439 Ga0495657_0226723 3300046675 Bacteria 1131
440 Ga0495599_0079677 3300046678 Bacteria 2045
441 Ga0495599_0097360 3300046678 Bacteria 1834
442 Ga0495646_0005878 3300046680 Bacteria 7776
443 Ga0495647_0085308 3300046681 Bacteria 1286
444 Ga0495613_0006356 3300046689 Bacteria 8835
445 Ga0495613_0275702 3300046689 Bacteria 1169
446 Ga0495624_0005908 3300046690 Bacteria 8749
447 Ga0495624_0056579 3300046690 Bacteria 2467
448 Ga0495670_0272127 3300046691 Bacteria 905
449 Ga0495600_0108397 3300046809 Bacteria 1809
450 Ga0495581_0029131 3300047315 Bacteria 3201
451 Ga0495581_0063180 3300047315 Bacteria 2139
452 Ga0495604_0049094 3300047317 Bacteria 3280
453 Ga0495604_0095634 3300047317 Bacteria 2194
454 Ga0495674_0002219 3300047319 Bacteria 19098
455 Ga0495674_0044103 3300047319 Bacteria 3966
456 Ga0495674_0526216 3300047319 Bacteria 943
457 Ga0495676_0000626 3300047321 Bacteria 29241
458 Ga0495680_0006729 3300047322 Bacteria 10628
459 Ga0495680_0011490 3300047322 Bacteria 7833
460 Ga0495680_0018424 3300047322 Bacteria 5929
461 Ga0495680_0043186 3300047322 Bacteria 3571
462 Ga0495675_0023236 3300047444 Bacteria 3951
463 Ga0495675_0074366 3300047444 Bacteria 2141
464 Ga0495684_0012424 3300047471 Bacteria 6567
465 Ga0495684_0026490 3300047471 Bacteria 4457
466 Ga0495684_0066183 3300047471 Bacteria 2747
467 Ga0495602_0018598 3300048088 Bacteria 6930
468 Ga0495602_0220738 3300048088 Bacteria 1431
469 Ga0495614_0006775 3300048089 Bacteria 5126
470 Ga0496100_0007132 3300048903 Bacteria 6139
471 Ga0496100_0436056 3300048903 Bacteria 1002
472 Ga0496100_0524169 3300048903 Bacteria 915
473 Ga0496101_0008429 3300048904 Bacteria 6735
474 Ga0496101_0188155 3300048904 Bacteria 1592
475 Ga0496101_0483013 3300048904 Bacteria 978
476 Ga0496102_0355031 3300048905 Bacteria 1380
477 Ga0496102_0382923 3300048905 Bacteria 1324
478 Ga0496103_0025871 3300048906 Bacteria 3549
479 Ga0496103_0038460 3300048906 Bacteria 2936
480 Ga0496104_0008371 3300048907 Bacteria 9190
481 Ga0496104_0112800 3300048907 Bacteria 2607
482 Ga0496104_0182289 3300048907 Bacteria 2010
483 Ga0496105_0019945 3300048908 Bacteria 5411
484 Ga0496105_0130886 3300048908 Bacteria 2068
485 Ga0496106_0095305 3300048909 Bacteria 2302
486 Ga0496106_0129051 3300048909 Bacteria 1981
487 Ga0496106_0410257 3300048909 Bacteria 1089
488 Ga0496107_0147398 3300048910 Bacteria 1740
489 Ga0496107_0299401 3300048910 Bacteria 1197
490 Ga0496107_0412283 3300048910 Bacteria 1005
491 Ga0496108_0601901 3300048911 Bacteria 958
492 Ga0496108_0604384 3300048911 Bacteria 956
493 Ga0496109_0432079 3300048912 Bacteria 1244
494 Ga0496109_0497378 3300048912 Bacteria 1151
495 Ga0496109_0642289 3300048912 Bacteria 998
496 Ga0496110_0097375 3300048913 Bacteria 2636
497 Ga0496110_0204307 3300048913 Bacteria 1795
498 Ga0496110_0385523 3300048913 Bacteria 1277
499 Ga0496110_0495421 3300048913 Bacteria 1113
500 Ga0496112_0062029 3300048915 Bacteria 3687
501 Ga0496112_0398611 3300048915 Bacteria 1316
502 Ga0496113_0028389 3300048916 Bacteria 4024
503 Ga0496113_0110545 3300048916 Bacteria 2139
504 Ga0496114_0002956 3300048917 Bacteria 13030
505 Ga0496114_0151594 3300048917 Bacteria 2011
506 Ga0496114_0221988 3300048917 Bacteria 1659
507 Ga0496114_0433914 3300048917 Bacteria 1163
508 Ga0496119_0000061 3300048922 Bacteria 171442
509 Ga0496120_0010310 3300048923 Bacteria 6533
510 Ga0501032_0004434 3300049569 Bacteria 10581
511 Ga0501032_0018869 3300049569 Bacteria 4826
512 Ga0501033_0014667 3300049570 Bacteria 5949
513 Ga0501034_0003163 3300049571 Bacteria 18924
514 Ga0501034_0033467 3300049571 Bacteria 5214
515 Ga0501034_0130606 3300049571 Bacteria 2495
516 Ga0501036_0120549 3300049572 Bacteria 2215
517 Ga0501037_0010588 3300049573 Bacteria 6774
518 Ga0501037_0070204 3300049573 Bacteria 2549
519 Ga0501039_0128494 3300049575 Bacteria 1988
520 Ga0501040_0052698 3300049576 Bacteria 2786
521 Ga0501043_0104643 3300049579 Bacteria 2224
522 Ga0501043_0158983 3300049579 Bacteria 1766
523 Ga0501046_0001136 3300049580 Bacteria 25942
524 Ga0501047_0004152 3300049581 Bacteria 13627
525 Ga0501047_0005646 3300049581 Bacteria 11781
526 Ga0501048_0001774 3300049582 Bacteria 16425
527 Ga0501048_0407059 3300049582 Bacteria 973
528 Ga0501070_0000622 3300049586 Bacteria 32559
529 Ga0501072_0017284 3300049588 Bacteria 5543
530 Ga0501072_0051428 3300049588 Bacteria 3244
531 Ga0501075_0069742 3300049591 Bacteria 2656
532 Ga0501076_0186455 3300049592 Bacteria 1692
533 Ga0501216_007407 3300049660 Bacteria 1708
534 Ga0501233_014495 3300049668 Bacteria 1612
535 Ga0501079_0109611 3300049741 Bacteria 2144
536 Ga0501079_0526420 3300049741 Bacteria 929
537 Ga0501080_0082165 3300049742 Bacteria 2993
538 Ga0501081_0284108 3300049743 Unclassified 1212
539 Ga0501083_0012038 3300049744 Bacteria 6057
540 Ga0501035_0031982 3300049822 Bacteria 4791
541 Ga0501035_0255696 3300049822 Bacteria 1486
542 Ga0501035_0432062 3300049822 Bacteria 1092
543 Ga0501044_0000033 3300049823 Bacteria 167177
544 Ga0501044_0001366 3300049823 Bacteria 28620
545 Ga0501044_0266724 3300049823 Bacteria 1649
546 Ga0501045_0192454 3300049824 Bacteria 1520
547 nmdc:mga03n38_11539_c1 3300050490 Bacteria 3296
548 nmdc:mga03n38_234369_c1 3300050490 Bacteria 963
549 nmdc:mga00v17_148997_c1 3300050491 Bacteria 1503
550 nmdc:mga00v17_65345_c1 3300050491 Bacteria 2244
551 nmdc:mga0k408_184909_c1 3300050493 Bacteria 1243
552 nmdc:mga0k408_20716_c1 3300050493 Bacteria 3688
553 nmdc:mga0k408_71777_c1 3300050493 Bacteria 2021
554 nmdc:mga06z11_53745_c1 3300050494 Bacteria 2073
555 nmdc:mga04h51_118488_c1 3300050495 Bacteria 984
556 nmdc:mga04h51_19232_c1 3300050495 Bacteria 2022
557 nmdc:mga07m45_127921_c1 3300050496 Bacteria 1469
558 nmdc:mga05p37_353210_c1 3300050507 Bacteria 1730
559 nmdc:mga09592_577001_c1 3300050508 Bacteria 965
560 nmdc:mga06r32_291540_c1 3300050510 Unclassified 1618
561 nmdc:mga06r32_99894_c1 3300050510 Bacteria 2846
562 nmdc:mga08y16_127862_c1 3300050511 Bacteria 2643
563 nmdc:mga08y16_137856_c1 3300050511 Bacteria 2536
564 nmdc:mga08y16_224328_c1 3300050511 Bacteria 1945
565 nmdc:mga08y16_830_c1 3300050511 Bacteria 29664
566 nmdc:mga0n895_142952_c1 3300050512 Bacteria 2422
567 nmdc:mga0n895_18209_c1 3300050512 Bacteria 6494
568 nmdc:mga0n895_258551_c1 3300050512 Bacteria 1767
569 nmdc:mga0n895_30840_c1 3300050512 Bacteria 5128
570 nmdc:mga0n895_554738_c1 3300050512 Unclassified 1155
571 nmdc:mga0rr50_105057_c1 3300050513 Bacteria 2226
572 nmdc:mga0rr50_3102_c1 3300050513 Bacteria 9500
573 nmdc:mga0rr50_326248_c1 3300050513 Bacteria 1288
574 nmdc:mga0rr50_51497_c1 3300050513 Bacteria 3055
575 nmdc:mga0rr50_617151_c1 3300050513 Bacteria 925
576 nmdc:mga0a205_104963_c1 3300050515 Bacteria 2725
577 nmdc:mga0a205_22197_c1 3300050515 Bacteria 6008
578 nmdc:mga0a205_82501_c1 3300050515 Bacteria 3105
579 Ga0495601_0073103 3300053077 Bacteria 2191
580 Ga0495601_0143181 3300053077 Bacteria 1560
581 Ga0495595_0000865 3300053084 Bacteria 11629
582 Ga0495595_0169179 3300053084 Bacteria 1081
583 Ga0495619_0002121 3300053085 Bacteria 13143
584 Ga0495619_0016743 3300053085 Bacteria 4641
585 Ga0495619_0056188 3300053085 Bacteria 2609
586 Ga0495619_0115258 3300053085 Bacteria 1839
587 Ga0500583_0060932 3300053092 Bacteria 1780
588 Ga0500641_0004584 3300053096 Bacteria 4884
589 Ga0500641_0042802 3300053096 Bacteria 1836
590 Ga0500573_0038186 3300053140 Bacteria 2775
591 Ga0501084_0400054 3300054114 Bacteria 1161
592 Ga0501084_0705164 3300054114 Bacteria 851
593 Ga0466962_0062516 3300061719 Bacteria 1778
594 2554260742 2554235005 Bacteria 6457341
595 2644609050 2643221711 Bacteria 4865335
596 2776371811 2775506925 Bacteria 7237746
597 2812374201 2811994882 Bacteria 4688362
598 2819426900 2818991318 Bacteria 5266538
599 2819665895 2818991458 Bacteria 4794049
600 2819692592 2818991462 Bacteria 4320267
601 2819728835 2818991469 Bacteria 4644110
602 2861525626 2861520306 Bacteria 8348283
603 2862706802 2862705112 Bacteria 6563286
604 2863070060 2863067949 Bacteria 8541735
605 2990049055 2990044586 Bacteria 6603797
606 8001790264 8001781756 Bacteria 9586736
607 8008489853 8008485437 Bacteria 7198341
608 8025529415 8025524527 Bacteria 7197316
609 8056667291 8056667051 Bacteria 6953971
610 nmdc:mga08x19_6170_c1
611 JGI24740J21852_10030184
612 JGI24739J22299_10018639
613 JGI24737J22298_10006841
614 JGI25406J46586_10045119
615 Ga0006562J51391_1166945
616 Ga0065715_10002475
617 Ga0065715_10103894
618 Ga0065715_10262667
619 Ga0065707_10082505
620 Ga0070676_10024226
621 Ga0070676_10190840
622 Ga0070676_10198882
623 Ga0070683_100006608
624 Ga0070683_100097930
625 Ga0070683_100273519
626 Ga0070670_100015499
627 Ga0070670_100200977
628 Ga0070670_100212433
629 Ga0068869_100011829
630 Ga0070680_100148284
631 Ga0070682_100073140
632 Ga0068868_100139181
633 Ga0070660_100030278
634 Ga0070689_100143011
635 Ga0070691_10070776
636 Ga0070687_100069161
637 Ga0070661_100120877
638 Ga0070692_10057727
639 Ga0070668_100072546
640 Ga0070668_100458468
641 Ga0070669_100034095
642 Ga0070669_100069057
643 Ga0070675_100006704
644 Ga0070675_100284204
645 Ga0070671_100016920
646 Ga0070671_100077026
647 Ga0070671_100132383
648 Ga0070674_100457324
649 Ga0070674_100566570
650 Ga0070673_100042028
651 Ga0070673_100042254
652 Ga0070659_100336491
653 Ga0070667_100078308
654 Ga0070709_10307324
655 Ga0070714_100141634
656 Ga0070713_100020634
657 Ga0070713_100374940
658 Ga0070710_10077632
659 Ga0070710_10119316
660 Ga0070710_10134283
661 Ga0070711_100019159
662 Ga0070705_100034879
663 Ga0070705_100103973
664 Ga0070700_100059596
665 Ga0070708_100028167
666 Ga0070708_100028565
667 Ga0070708_100230810
668 Ga0070663_100077715
669 Ga0070663_100324242
670 Ga0070678_100070087
671 Ga0070678_100139410
672 Ga0070678_100183103
673 Ga0070681_10023881
674 Ga0068867_100085710
675 Ga0070706_100016819
676 Ga0070707_100010259
677 Ga0070698_100015482
678 Ga0070698_100024846
679 Ga0070698_100152396
680 Ga0070699_100003390
681 Ga0070699_100004078
682 Ga0070699_100042284
683 Ga0070684_100051700
684 Ga0070684_100057409
685 Ga0070697_100004904
686 Ga0068853_100004950
687 Ga0070686_100499291
688 Ga0070695_100007021
689 Ga0070695_100080840
690 Ga0070695_100130845
691 Ga0070695_100136570
692 Ga0070696_100132699
693 Ga0070704_100051466
694 Ga0070664_100113799
695 Ga0068857_100004953
696 Ga0068857_100040372
697 Ga0068857_100077717
698 Ga0068857_100264590
699 Ga0068854_100358555
700 Ga0068856_100099743
701 Ga0068856_100292383
702 Ga0070702_100005214
703 Ga0070702_100100318
704 Ga0070702_100147599
705 Ga0068859_100133741
706 Ga0068864_100247204
707 Ga0068861_100083879
708 Ga0068861_100491419
709 Ga0068851_10119806
710 Ga0068863_100133360
711 Ga0068863_100345221
712 Ga0068858_100114152
713 Ga0068860_100017540
714 Ga0068862_100097692
715 Ga0081455_10166351
716 Ga0081540_1033734
717 Ga0081539_10012581
718 Ga0070717_10101115
719 Ga0075368_10008406
720 Ga0075363_100023301
721 Ga0075363_100127485
722 Ga0075364_10040530
723 Ga0070716_100078835
724 Ga0070716_100127466
725 Ga0070716_100408458
726 Ga0070712_100193918
727 Ga0075367_10037616
728 Ga0075367_10044895
729 Ga0075367_10164900
730 Ga0075367_10198096
731 Ga0075366_10020484
732 Ga0075366_10039569
733 Ga0097621_100051026
734 Ga0097621_100213364
735 Ga0075370_10196700
736 Ga0068871_100223084
737 Ga0075428_100020203
738 Ga0075428_100378439
739 Ga0075430_100420570
740 Ga0075431_100061721
741 Ga0075433_10121814
742 Ga0075433_10304000
743 Ga0075434_100020026
744 Ga0075434_100195814
745 Ga0075434_100218962
746 Ga0075434_100613790
747 Ga0068865_100097616
748 Ga0068865_100098612
749 Ga0068865_100278504
750 Ga0075436_100032269
751 Ga0075436_100041933
752 Ga0075436_100126942
753 Ga0097620_100133748
754 Ga0111539_10124657
755 Ga0111539_10223621
756 Ga0111539_10285612
757 Ga0105245_10004307
758 Ga0105245_10022812
759 Ga0105245_10406107
760 Ga0114129_10310382
761 Ga0105243_10207881
762 Ga0105241_10447988
763 Ga0105242_10012366
764 Ga0105242_10603492
765 Ga0105248_10040519
766 Ga0105248_10042758
767 Ga0105248_10087139
768 Ga0105248_10937763
769 Ga0105249_10435554
770 Ga0105239_10352800
771 Ga0105239_10675954
772 Ga0105239_10747571
773 Ga0105246_10016195
774 Ga0105246_10031911
775 Ga0105246_10067873
776 Ga0157371_10049167
777 Ga0157378_10164080
778 Ga0163162_10110888
779 Ga0157372_10379908
780 Ga0157375_10176110
781 Ga0157375_10245759
782 Ga0157375_10355217
783 Ga0163163_10233720
784 Ga0163163_10502742
785 Ga0163163_10990118
786 Ga0157380_10005475
787 Ga0157380_10051694
788 Ga0157380_10887927
789 Ga0157377_10027930
790 Ga0157377_10107071
791 Ga0206354_11191814
792 Ga0213876_10003446
793 Ga0213875_10012960
794 Ga0213875_10051477
795 Ga0213875_10173830
796 Ga0207692_10010883
797 Ga0207692_10352491
798 Ga0207688_10031032
799 Ga0207647_10033304
800 Ga0207699_10039726
801 Ga0207699_10386505
802 Ga0207643_10029768
803 Ga0207684_10100627
804 Ga0207707_10193399
805 Ga0207693_10103009
806 Ga0207663_10198836
807 Ga0207663_10286875
808 Ga0207660_10567800
809 Ga0207662_10006185
810 Ga0207657_10005312
811 Ga0207649_10070688
812 Ga0207646_10045461
813 Ga0207646_10128624
814 Ga0207681_10139478
815 Ga0207650_10026591
816 Ga0207650_10059987
817 Ga0207650_10080194
818 Ga0207659_10003271
819 Ga0207659_10288042
820 Ga0207664_10019215
821 Ga0207664_10145915
822 Ga0207664_10198059
823 Ga0207664_10291178
824 Ga0207644_10035077
825 Ga0207644_10406331
826 Ga0207690_10027617
827 Ga0207706_10069048
828 Ga0207686_10043828
829 Ga0207709_10110333
830 Ga0207670_10272003
831 Ga0207669_10139619
832 Ga0207704_10099550
833 Ga0207704_10328577
834 Ga0207665_10011357
835 Ga0207665_10022596
836 Ga0207665_10036757
837 Ga0207691_10085876
838 Ga0207691_10165659
839 Ga0207711_10052825
840 Ga0207711_10284973
841 Ga0207689_10021486
842 Ga0207689_10054301
843 Ga0207661_10016991
844 Ga0207661_10096370
845 Ga0207679_10048933
846 Ga0207679_10726386
847 Ga0207667_10309568
848 Ga0207651_10206382
849 Ga0207651_10257185
850 Ga0207712_10061177
851 Ga0207712_10108141
852 Ga0207668_10064675
853 Ga0207668_10068187
854 Ga0207640_10269200
855 Ga0207658_10429460
856 Ga0207703_10142758
857 Ga0207703_10412460
858 Ga0207639_10005626
859 Ga0207678_10048003
860 Ga0207678_10085463
861 Ga0207678_10102710
862 Ga0207708_10018081
863 Ga0207708_10025612
864 Ga0207702_10424777
865 Ga0207702_10644943
866 Ga0207641_10088605
867 Ga0207648_10032035
868 Ga0207648_10400436
869 Ga0207676_10169320
870 Ga0207674_10004002
871 Ga0207674_10033965
872 Ga0207674_10042157
873 Ga0207674_10073160
874 Ga0207674_10122308
875 Ga0207675_100016427
876 Ga0207675_100029751
877 Ga0207675_100043756
878 Ga0207675_100149624
879 Ga0207683_10013047
880 Ga0207683_10081946
881 Ga0207683_10269311
882 Ga0207683_10302759
883 Ga0209813_10044674
884 Ga0207428_10010157
885 Ga0207428_10432680
886 Ga0268265_10059740
887 Ga0268265_10815125
888 Ga0268264_10013616
889 Ga0268264_10139139
890 Ga0307515_10065338
891 Ga0265338_10224830
892 Ga0265325_10002222
893 Ga0265339_10001753
894 Ga0265327_10009118
895 Ga0307513_10013618
896 Ga0307408_100100059
897 Ga0265313_10004510
898 Ga0307508_10269174
899 Ga0265314_10236859
900 Ga0307405_10135465
901 Ga0307405_10252605
902 Ga0307413_10162664
903 Ga0307410_10084766
904 Ga0307406_10116416
905 Ga0307412_10164833
906 Ga0307409_100356708
907 Ga0307409_100796375
908 Ga0307411_10101406
909 Ga0307415_100580505
910 Ga0316216_1004824
911 Ga0373959_0040576
912 Ga0373938_0025800
913 Ga0373926_0000370
914 Ga0373926_0003844
915 Ga0373929_0036519
916 Ga0373944_0014075
917 Ga0373951_0030312
918 Ga0373923_0025368
919 Ga0373923_0026939
920 Ga0373936_0000513
921 Ga0373936_0001868
922 Ga0373936_0032731
923 Ga0373945_0000260
924 Ga0373945_0081471
925 Ga0373953_0127766
926 Ga0373954_0040072
927 Ga0373954_0277410
928 Ga0373956_0019191
929 Ga0373956_0082373
930 Ga0373957_0012195
931 Ga0373943_0000528
932 Ga0373943_0009428
933 Ga0373946_0000477
934 Ga0373962_0060015
935 Ga0373924_0007121
936 Ga0373935_0000795
937 Ga0373935_0003234
938 Ga0373935_0035159
939 Ga0373935_0150626
940 Ga0373935_0236706
941 Ga0373927_0007109
942 Ga0373927_0016242
943 Ga0373927_0389146
944 Ga0373933_0037379
945 Ga0373933_0038091
946 Ga0373947_0000547
947 Ga0373937_0001467
948 Ga0373937_0009941
949 Ga0373937_0014117
950 Ga0373937_0033741
951 Ga0373937_0071047
952 Ga0373937_0085006
953 Ga0373925_0001636
954 Ga0373925_0008760
955 Ga0373925_0027264
956 Ga0373925_0514363
957 Ga0436364_0278916
958 Ga0436364_0896639
959 Ga0436364_0904395
960 Ga0436364_1380209
961 Ga0436365_0673635
962 Ga0436365_1321692
963 Ga0436365_1880251
964 Ga0436363_0694266
965 Ga0436363_1175736
966 Ga0436362_0407629
967 Ga0439433_0035639
968 Ga0439445_0026055
969 Ga0466965_0000002
970 Ga0466966_0030053
971 Ga0466961_0001321
972 Ga0466961_0062872
973 Ga0466963_0027644
974 Ga0466963_0110948
975 Ga0466964_0142969
976 Ga0466960_0010624
977 Ga0466959_0005885
978 Ga0451576_0026378
979 Ga0466958_0033213
980 Ga0466967_0005746
981 Ga0466967_0010937
982 Ga0466967_0314183
983 Ga0495592_0049178
984 Ga0495592_0207938
985 Ga0495603_0008271
986 Ga0495603_0150524
987 Ga0495629_0177865
988 Ga0495629_0178129
989 Ga0495641_0003438
990 Ga0495641_0009441
991 Ga0495651_0011715
992 Ga0495651_0026676
993 Ga0495651_0115724
994 Ga0495651_0268325
995 Ga0495653_0003685
996 Ga0495653_0031926
997 Ga0495653_0070785
998 Ga0495653_0179310
999 Ga0495580_0019732
1000 Ga0495582_0043224
1001 Ga0495639_0013134
1002 Ga0495662_0000974
1003 Ga0495664_0008718
1004 Ga0495664_0016657
1005 Ga0495664_0053716
1006 Ga0495594_0142748
1007 Ga0495608_0019907
1008 Ga0495608_0022963
1009 Ga0495608_0162025
1010 Ga0495618_0026741
1011 Ga0495618_0051803
1012 Ga0495618_0126758
1013 Ga0495628_0038429
1014 Ga0495628_0134253
1015 Ga0495628_0278267
1016 Ga0495630_0002306
1017 Ga0495630_0030786
1018 Ga0495630_0093347
1019 Ga0495666_0012070
1020 Ga0495652_0018163
1021 Ga0495652_0023604
1022 Ga0495652_0041037
1023 Ga0495652_0151582
1024 Ga0495652_0386244
1025 Ga0495665_0018144
1026 Ga0495665_0041700
1027 Ga0495640_0061227
1028 Ga0495587_0021737
1029 Ga0495587_0032715
1030 Ga0495587_0176482
1031 Ga0495598_0005735
1032 Ga0495621_0010070
1033 Ga0495645_0040865
1034 Ga0495645_0274193
1035 Ga0495622_0108270
1036 Ga0495667_0004158
1037 Ga0495667_0013654
1038 Ga0495667_0116713
1039 Ga0495634_0019691
1040 Ga0495634_0034588
1041 Ga0495635_0001354
1042 Ga0495635_0050862
1043 Ga0495635_0055652
1044 Ga0495657_0007289
1045 Ga0495657_0009596
1046 Ga0495657_0024436
1047 Ga0495657_0148026
1048 Ga0495657_0226723
1049 Ga0495599_0079677
1050 Ga0495599_0097360
1051 Ga0495646_0005878
1052 Ga0495647_0085308
1053 Ga0495613_0006356
1054 Ga0495613_0275702
1055 Ga0495624_0005908
1056 Ga0495624_0056579
1057 Ga0495670_0272127
1058 Ga0495600_0108397
1059 Ga0495581_0029131
1060 Ga0495581_0063180
1061 Ga0495604_0049094
1062 Ga0495604_0095634
1063 Ga0495674_0002219
1064 Ga0495674_0044103
1065 Ga0495674_0526216
1066 Ga0495676_0000626
1067 Ga0495680_0006729
1068 Ga0495680_0011490
1069 Ga0495680_0018424
1070 Ga0495680_0043186
1071 Ga0495675_0023236
1072 Ga0495675_0074366
1073 Ga0495684_0012424
1074 Ga0495684_0026490
1075 Ga0495684_0066183
1076 Ga0495602_0018598
1077 Ga0495602_0220738
1078 Ga0495614_0006775
1079 Ga0496100_0007132
1080 Ga0496100_0436056
1081 Ga0496100_0524169
1082 Ga0496101_0008429
1083 Ga0496101_0188155
1084 Ga0496101_0483013
1085 Ga0496102_0355031
1086 Ga0496102_0382923
1087 Ga0496103_0025871
1088 Ga0496103_0038460
1089 Ga0496104_0008371
1090 Ga0496104_0112800
1091 Ga0496104_0182289
1092 Ga0496105_0019945
1093 Ga0496105_0130886
1094 Ga0496106_0095305
1095 Ga0496106_0129051
1096 Ga0496106_0410257
1097 Ga0496107_0147398
1098 Ga0496107_0299401
1099 Ga0496107_0412283
1100 Ga0496108_0601901
1101 Ga0496108_0604384
1102 Ga0496109_0432079
1103 Ga0496109_0497378
1104 Ga0496109_0642289
1105 Ga0496110_0097375
1106 Ga0496110_0204307
1107 Ga0496110_0385523
1108 Ga0496110_0495421
1109 Ga0496112_0062029
1110 Ga0496112_0398611
1111 Ga0496113_0028389
1112 Ga0496113_0110545
1113 Ga0496114_0002956
1114 Ga0496114_0151594
1115 Ga0496114_0221988
1116 Ga0496114_0433914
1117 Ga0496119_0000061
1118 Ga0496120_0010310
1119 Ga0501032_0004434
1120 Ga0501032_0018869
1121 Ga0501033_0014667
1122 Ga0501034_0003163
1123 Ga0501034_0033467
1124 Ga0501034_0130606
1125 Ga0501036_0120549
1126 Ga0501037_0010588
1127 Ga0501037_0070204
1128 Ga0501039_0128494
1129 Ga0501040_0052698
1130 Ga0501043_0104643
1131 Ga0501043_0158983
1132 Ga0501046_0001136
1133 Ga0501047_0004152
1134 Ga0501047_0005646
1135 Ga0501048_0001774
1136 Ga0501048_0407059
1137 Ga0501070_0000622
1138 Ga0501072_0017284
1139 Ga0501072_0051428
1140 Ga0501075_0069742
1141 Ga0501076_0186455
1142 Ga0501216_007407
1143 Ga0501233_014495
1144 Ga0501079_0109611
1145 Ga0501079_0526420
1146 Ga0501080_0082165
1147 Ga0501081_0284108
1148 Ga0501083_0012038
1149 Ga0501035_0031982
1150 Ga0501035_0255696
1151 Ga0501035_0432062
1152 Ga0501044_0000033
1153 Ga0501044_0001366
1154 Ga0501044_0266724
1155 Ga0501045_0192454
1156 nmdc:mga03n38_11539_c1
1157 nmdc:mga03n38_234369_c1
1158 nmdc:mga00v17_148997_c1
1159 nmdc:mga00v17_65345_c1
1160 nmdc:mga0k408_184909_c1
1161 nmdc:mga0k408_20716_c1
1162 nmdc:mga0k408_71777_c1
1163 nmdc:mga06z11_53745_c1
1164 nmdc:mga04h51_118488_c1
1165 nmdc:mga04h51_19232_c1
1166 nmdc:mga07m45_127921_c1
1167 nmdc:mga05p37_353210_c1
1168 nmdc:mga09592_577001_c1
1169 nmdc:mga06r32_291540_c1
1170 nmdc:mga06r32_99894_c1
1171 nmdc:mga08y16_127862_c1
1172 nmdc:mga08y16_137856_c1
1173 nmdc:mga08y16_224328_c1
1174 nmdc:mga08y16_830_c1
1175 nmdc:mga0n895_142952_c1
1176 nmdc:mga0n895_18209_c1
1177 nmdc:mga0n895_258551_c1
1178 nmdc:mga0n895_30840_c1
1179 nmdc:mga0n895_554738_c1
1180 nmdc:mga0rr50_105057_c1
1181 nmdc:mga0rr50_3102_c1
1182 nmdc:mga0rr50_326248_c1
1183 nmdc:mga0rr50_51497_c1
1184 nmdc:mga0rr50_617151_c1
1185 nmdc:mga0a205_104963_c1
1186 nmdc:mga0a205_22197_c1
1187 nmdc:mga0a205_82501_c1
1188 Ga0495601_0073103
1189 Ga0495601_0143181
1190 Ga0495595_0000865
1191 Ga0495595_0169179
1192 Ga0495619_0002121
1193 Ga0495619_0016743
1194 Ga0495619_0056188
1195 Ga0495619_0115258
1196 Ga0500583_0060932
1197 Ga0500641_0004584
1198 Ga0500641_0042802
1199 Ga0500573_0038186
1200 Ga0501084_0400054
1201 Ga0501084_0705164
1202 Ga0466962_0062516
1203 2554260742
1204 2644609050
1205 2776371811
1206 2812374201
1207 2819426900
1208 2819665895
1209 2819692592
1210 2819728835
1211 2861525626
1212 2862706802
1213 2863070060
1214 2990049055
1215 8001790264
1216 8008489853
1217 8025529415
1218 8056667291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

93

189

0.98

PF08242

Methyltransf_12

Methyltransferase domain

93

187

0.98

PF13649

Methyltransf_25

Methyltransferase domain

92

185

0.95

PF13847

Methyltransf_31

Methyltransferase domain

86

221

0.91

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

64

191

0.85

PF05175

MTS

Methyltransferase small domain

67

160

0.83

PF07021

MetW

Methionine biosynthesis protein MetW

77

200

0.79

PF13489

Methyltransf_23

Methyltransferase domain

67

243

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8795 35 264
1ve3-assembly1.cif.gz_A-3 crystal structure of ph0226 protein from pyrococcus horikoshii ot3 0.8755 22 143
6mro-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina acetivorans at 1.6 angstroms resolution, northeast structural genomics consortium (nesg) target mvr53. 0.8655 27 138
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.8572 33 140
6wlf-assembly1.cif.gz_A phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8383 25 140
ID Description Score Start End Superfamily
af_I6X9X6_5_255_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9836 1 249 3.40.50.150
af_I6X9X6_5_255_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9721 1 249 3.40.50.150
af_O13871_19_175_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9105 16 163 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8994 23 137 3.40.50.150
3mggA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8833 23 193 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2T7K782-F1-model_v4 deleted 0.981 1 263
AF-A0A4D4JAW4-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9782 94 264 GO:0008757
AF-A0A2T7K782-F1-model_v4 deleted 0.9737 1 263
AF-A0A2V6WQ22-F1-model_v4 SAM-dependent methyltransferase 0.9689 119 263
AF-A0A1Y2FG11-F1-model_v4 UbiE/COQ5 family methyltransferase 0.9671 1 264 GO:0008168
GO:0032259

Map