F468864

General Info

Members Datasets Scaffolds Average Seq Length
609 258 1218 49

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11150866|Ga0114129_111508661
Length 55
Sequence MKRRRKMLWTIFVILMVMWLLGMVSSYTLGGFIHLLLVMAIAVVLIRIIQGRSPV

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
210 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 1.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 3.45
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 27.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_11150866 3300009147 Unclassified 969
2 Ga0058859_11511814 3300004798 Bacteria 716
3 Ga0058860_10026082 3300004801 Unclassified 565
4 Ga0058860_11772537 3300004801 Bacteria 612
5 Ga0065704_10720376 3300005289 Unclassified 553
6 Ga0065712_10001497 3300005290 Bacteria 9269
7 Ga0065712_10088296 3300005290 Bacteria 2528
8 Ga0065712_10391481 3300005290 Bacteria 710
9 Ga0065715_10000707 3300005293 Bacteria 13094
10 Ga0065715_10201777 3300005293 Bacteria 1358
11 Ga0065715_10445900 3300005293 Unclassified 831
12 Ga0065707_10315692 3300005295 Bacteria 976
13 Ga0065707_10321834 3300005295 Bacteria 960
14 Ga0065707_10382015 3300005295 Unclassified 876
15 Ga0065707_10792033 3300005295 Unclassified 602
16 Ga0065707_10844797 3300005295 Bacteria 584
17 Ga0070676_10107643 3300005328 Bacteria 1731
18 Ga0070670_100004594 3300005331 Bacteria 11585
19 Ga0070670_100737911 3300005331 Bacteria 887
20 Ga0070670_100832653 3300005331 Bacteria 834
21 Ga0068869_101102721 3300005334 Unclassified 694
22 Ga0070680_100564778 3300005336 Viruses 976
23 Ga0070680_100766018 3300005336 Bacteria 831
24 Ga0070680_101274907 3300005336 Bacteria 636
25 Ga0068868_100252680 3300005338 Unclassified 1484
26 Ga0068868_100541207 3300005338 Bacteria 1025
27 Ga0070689_100647273 3300005340 Unclassified 919
28 Ga0070691_10303359 3300005341 Bacteria 873
29 Ga0070692_10126937 3300005345 Unclassified 1429
30 Ga0070692_10320255 3300005345 Bacteria 953
31 Ga0070668_101201856 3300005347 Unclassified 687
32 Ga0070668_101786671 3300005347 Unclassified 565
33 Ga0070669_100056589 3300005353 Bacteria 2875
34 Ga0070669_101893132 3300005353 Unclassified 521
35 Ga0070675_100154914 3300005354 Bacteria 1967
36 Ga0070675_100598657 3300005354 Unclassified 1000
37 Ga0070675_100686498 3300005354 Bacteria 932
38 Ga0070675_100728059 3300005354 Unclassified 904
39 Ga0070675_100810899 3300005354 Bacteria 856
40 Ga0070675_101300323 3300005354 Bacteria 670
41 Ga0070675_101447628 3300005354 Unclassified 633
42 Ga0070675_101489976 3300005354 Bacteria 624
43 Ga0070675_101690238 3300005354 Unclassified 584
44 Ga0070671_100570603 3300005355 Bacteria 976
45 Ga0070671_101334661 3300005355 Bacteria 633
46 Ga0070671_101421754 3300005355 Unclassified 613
47 Ga0070674_100078492 3300005356 Bacteria 2353
48 Ga0070674_100316410 3300005356 Unclassified 1250
49 Ga0070674_100846937 3300005356 Unclassified 793
50 Ga0070674_101028670 3300005356 Bacteria 724
51 Ga0070674_101360104 3300005356 Bacteria 635
52 Ga0070673_100067564 3300005364 Bacteria 2859
53 Ga0070673_100430013 3300005364 Bacteria 1185
54 Ga0070667_100067238 3300005367 Bacteria 3046
55 Ga0070667_100445267 3300005367 Bacteria 1183
56 Ga0070703_10302690 3300005406 Bacteria 667
57 Ga0070709_10127655 3300005434 Unclassified 1732
58 Ga0070709_10877115 3300005434 Unclassified 708
59 Ga0070701_10179135 3300005438 Bacteria 1239
60 Ga0070701_10294282 3300005438 Bacteria 996
61 Ga0070711_100438046 3300005439 Unclassified 1068
62 Ga0070711_100951091 3300005439 Bacteria 735
63 Ga0070705_100088086 3300005440 Unclassified 1926
64 Ga0070705_100153590 3300005440 Unclassified 1530
65 Ga0070700_100034266 3300005441 Bacteria 3065
66 Ga0070700_100318189 3300005441 Unclassified 1142
67 Ga0070700_100645247 3300005441 Bacteria 835
68 Ga0070700_100693252 3300005441 Unclassified 809
69 Ga0070694_100297746 3300005444 Bacteria 1235
70 Ga0070694_100437742 3300005444 Bacteria 1030
71 Ga0070694_100787351 3300005444 Viruses 779
72 Ga0070694_100787730 3300005444 Unclassified 779
73 Ga0070694_101068711 3300005444 Bacteria 672
74 Ga0070694_101601595 3300005444 Bacteria 552
75 Ga0070708_100100076 3300005445 Bacteria 2653
76 Ga0070708_100153254 3300005445 Bacteria 2144
77 Ga0070708_100473790 3300005445 Bacteria 1181
78 Ga0070708_101260323 3300005445 Bacteria 691
79 Ga0070678_100237601 3300005456 Bacteria 1522
80 Ga0070678_100408520 3300005456 Bacteria 1181
81 Ga0070678_101349560 3300005456 Bacteria 665
82 Ga0070662_100430812 3300005457 Unclassified 1092
83 Ga0070662_100642112 3300005457 Bacteria 895
84 Ga0068867_100055251 3300005459 Bacteria 2935
85 Ga0068867_100257269 3300005459 Bacteria 1422
86 Ga0068867_100543618 3300005459 Bacteria 1005
87 Ga0068867_100625984 3300005459 Unclassified 941
88 Ga0068867_100890152 3300005459 Bacteria 800
89 Ga0070685_10001680 3300005466 Bacteria 11629
90 Ga0070685_10089957 3300005466 Bacteria 1856
91 Ga0070685_10257755 3300005466 Unclassified 1158
92 Ga0070685_10407486 3300005466 Bacteria 943
93 Ga0070706_100003496 3300005467 Bacteria 15438
94 Ga0070706_100522443 3300005467 Bacteria 1104
95 Ga0070706_101718255 3300005467 Unclassified 571
96 Ga0070707_100013416 3300005468 Bacteria 7665
97 Ga0070707_100016670 3300005468 Bacteria 6897
98 Ga0070707_100211318 3300005468 Bacteria 1891
99 Ga0070707_101091780 3300005468 Unclassified 764
100 Ga0070707_101129500 3300005468 Unclassified 750
101 Ga0070707_101232385 3300005468 Bacteria 714
102 Ga0070698_100019638 3300005471 Bacteria 7088
103 Ga0070698_100038798 3300005471 Bacteria 4907
104 Ga0070698_100075105 3300005471 Unclassified 3385
105 Ga0070698_100492502 3300005471 Bacteria 1163
106 Ga0070698_100589671 3300005471 Bacteria 1051
107 Ga0070699_100449494 3300005518 Bacteria 1168
108 Ga0070697_100006588 3300005536 Bacteria 9003
109 Ga0070697_100084018 3300005536 Bacteria 2626
110 Ga0070697_100293524 3300005536 Bacteria 1397
111 Ga0070697_101218987 3300005536 Unclassified 671
112 Ga0070697_101828147 3300005536 Bacteria 543
113 Ga0068853_100722445 3300005539 Bacteria 951
114 Ga0068853_101669701 3300005539 Unclassified 617
115 Ga0068853_102236832 3300005539 Bacteria 530
116 Ga0070672_100061437 3300005543 Bacteria 2962
117 Ga0070672_101331847 3300005543 Unclassified 641
118 Ga0070686_100316483 3300005544 Bacteria 1162
119 Ga0070695_100285544 3300005545 Bacteria 1214
120 Ga0070695_100356233 3300005545 Bacteria 1098
121 Ga0070695_100569562 3300005545 Bacteria 885
122 Ga0070695_100941370 3300005545 Bacteria 700
123 Ga0070696_100294118 3300005546 Unclassified 1242
124 Ga0070665_100001344 3300005548 Bacteria 29237
125 Ga0070665_100070617 3300005548 Bacteria 3499
126 Ga0070704_100043972 3300005549 Bacteria 3100
127 Ga0070704_100385352 3300005549 Bacteria 1192
128 Ga0070704_100442680 3300005549 Bacteria 1117
129 Ga0070704_100736672 3300005549 Bacteria 877
130 Ga0070704_100921224 3300005549 Bacteria 787
131 Ga0070704_101457798 3300005549 Bacteria 629
132 Ga0068854_100194720 3300005578 Bacteria 1590
133 Ga0070702_100071966 3300005615 Bacteria 2045
134 Ga0068852_100532556 3300005616 Bacteria 1173
135 Ga0068859_100069817 3300005617 Bacteria 3549
136 Ga0068859_100081473 3300005617 Bacteria 3279
137 Ga0068859_100275163 3300005617 Bacteria 1776
138 Ga0068859_101163921 3300005617 Unclassified 849
139 Ga0068859_101337106 3300005617 Bacteria 790
140 Ga0068864_100011753 3300005618 Bacteria 7230
141 Ga0068864_100209685 3300005618 Bacteria 1794
142 Ga0068864_100236418 3300005618 Unclassified 1691
143 Ga0068866_10183454 3300005718 Bacteria 1238
144 Ga0068866_10366566 3300005718 Bacteria 920
145 Ga0068866_10846711 3300005718 Bacteria 639
146 Ga0068861_100379124 3300005719 Bacteria 1249
147 Ga0068861_100577524 3300005719 Bacteria 1028
148 Ga0068870_11035520 3300005840 Unclassified 587
149 Ga0068863_100002607 3300005841 Bacteria 17878
150 Ga0068863_100046160 3300005841 Bacteria 4135
151 Ga0068863_100920717 3300005841 Unclassified 875
152 Ga0068858_100081008 3300005842 Bacteria 3017
153 Ga0068858_100381689 3300005842 Bacteria 1352
154 Ga0068858_100842309 3300005842 Bacteria 895
155 Ga0068860_100101980 3300005843 Bacteria 2738
156 Ga0068860_100752413 3300005843 Unclassified 986
157 Ga0068860_101890812 3300005843 Unclassified 618
158 Ga0068860_102142428 3300005843 Unclassified 580
159 Ga0068860_102422867 3300005843 Unclassified 545
160 Ga0068862_100898204 3300005844 Bacteria 871
161 Ga0068862_101241305 3300005844 Bacteria 745
162 Ga0068862_102492482 3300005844 Unclassified 529
163 Ga0081540_1101683 3300005983 Bacteria 1236
164 Ga0081540_1228143 3300005983 Unclassified 659
165 Ga0081539_10210697 3300005985 Bacteria 891
166 Ga0075365_10874529 3300006038 Unclassified 634
167 Ga0075364_11156842 3300006051 Unclassified 525
168 Ga0075432_10118430 3300006058 Bacteria 993
169 Ga0070715_10449258 3300006163 Unclassified 727
170 Ga0070716_100318652 3300006173 Bacteria 1089
171 Ga0070712_100048429 3300006175 Bacteria 2946
172 Ga0070712_100537527 3300006175 Bacteria 984
173 Ga0075362_10372540 3300006177 Bacteria 717
174 Ga0075362_10745583 3300006177 Bacteria 513
175 Ga0075367_10750177 3300006178 Bacteria 621
176 Ga0075366_10117033 3300006195 Bacteria 1605
177 Ga0097621_100005812 3300006237 Bacteria 8714
178 Ga0097621_100099348 3300006237 Bacteria 2446
179 Ga0097621_100525737 3300006237 Bacteria 1074
180 Ga0068871_100062193 3300006358 Unclassified 3050
181 Ga0068871_100134236 3300006358 Bacteria 2101
182 Ga0068871_100655086 3300006358 Bacteria 959
183 Ga0068871_101535049 3300006358 Bacteria 630
184 Ga0075428_100020502 3300006844 Bacteria 7319
185 Ga0075428_100181254 3300006844 Bacteria 2280
186 Ga0075428_100196720 3300006844 Unclassified 2180
187 Ga0075428_100404474 3300006844 Bacteria 1463
188 Ga0075428_100461998 3300006844 Bacteria 1359
189 Ga0075428_100467972 3300006844 Bacteria 1349
190 Ga0075428_101406810 3300006844 Unclassified 732
191 Ga0075428_101473931 3300006844 Bacteria 713
192 Ga0075428_101789479 3300006844 Unclassified 640
193 Ga0075430_100378334 3300006846 Bacteria 1169
194 Ga0075430_101027837 3300006846 Bacteria 679
195 Ga0075430_101404450 3300006846 Bacteria 574
196 Ga0075431_100562718 3300006847 Bacteria 1127
197 Ga0075431_100929134 3300006847 Bacteria 839
198 Ga0075433_10100370 3300006852 Unclassified 2562
199 Ga0075433_10678306 3300006852 Unclassified 903
200 Ga0075433_11165809 3300006852 Bacteria 669
201 Ga0075433_11257043 3300006852 Bacteria 642
202 Ga0075434_100010599 3300006871 Bacteria 8648
203 Ga0075434_100036586 3300006871 Plasmid 4856
204 Ga0075434_100070777 3300006871 Unclassified 3479
205 Ga0075434_100101417 3300006871 Bacteria 2885
206 Ga0075434_100479095 3300006871 Bacteria 1266
207 Ga0075434_100725548 3300006871 Bacteria 1011
208 Ga0075434_101559094 3300006871 Unclassified 669
209 Ga0075429_100084367 3300006880 Bacteria 2769
210 Ga0075429_100493221 3300006880 Bacteria 1073
211 Ga0075429_100651119 3300006880 Unclassified 923
212 Ga0075429_101315629 3300006880 Unclassified 630
213 Ga0075429_101512729 3300006880 Unclassified 584
214 Ga0075429_101749956 3300006880 Bacteria 539
215 Ga0068865_100131428 3300006881 Bacteria 1876
216 Ga0068865_100190995 3300006881 Bacteria 1584
217 Ga0068865_100292775 3300006881 Bacteria 1300
218 Ga0075436_100356155 3300006914 Bacteria 1055
219 Ga0075436_100375275 3300006914 Bacteria 1028
220 Ga0075436_100886841 3300006914 Bacteria 667
221 Ga0075436_101497417 3300006914 Unclassified 512
222 Ga0097620_100069817 3300006931 Bacteria 3549
223 Ga0097620_100081473 3300006931 Bacteria 3279
224 Ga0097620_100275178 3300006931 Bacteria 1776
225 Ga0097620_101163804 3300006931 Unclassified 849
226 Ga0097620_101337047 3300006931 Bacteria 790
227 Ga0075435_100027436 3300007076 Bacteria 4455
228 Ga0075435_100080000 3300007076 Bacteria 2683
229 Ga0075435_100609385 3300007076 Unclassified 947
230 Ga0075435_101166420 3300007076 Unclassified 674
231 Ga0111539_10008200 3300009094 Bacteria 13293
232 Ga0111539_10016426 3300009094 Bacteria 9177
233 Ga0111539_10029105 3300009094 Bacteria 6735
234 Ga0111539_10029772 3300009094 Bacteria 6644
235 Ga0111539_10165905 3300009094 Bacteria 2582
236 Ga0111539_10175159 3300009094 Bacteria 2506
237 Ga0111539_10785662 3300009094 Bacteria 1108
238 Ga0111539_10826759 3300009094 Viruses 1078
239 Ga0111539_10964090 3300009094 Bacteria 992
240 Ga0111539_11129008 3300009094 Unclassified 911
241 Ga0111539_11258834 3300009094 Unclassified 859
242 Ga0111539_11261633 3300009094 Bacteria 858
243 Ga0111539_11365888 3300009094 Bacteria 822
244 Ga0111539_11577798 3300009094 Unclassified 761
245 Ga0111539_13188945 3300009094 Unclassified 529
246 Ga0111539_13454912 3300009094 Unclassified 507
247 Ga0105245_10064291 3300009098 Bacteria 3315
248 Ga0105247_10106876 3300009101 Bacteria 1796
249 Ga0114129_10210094 3300009147 Bacteria 2632
250 Ga0114129_10443835 3300009147 Bacteria 1703
251 Ga0114129_10656557 3300009147 Bacteria 1353
252 Ga0114129_11038416 3300009147 Bacteria 1030
253 Ga0114129_11722321 3300009147 Bacteria 764
254 Ga0114129_12122687 3300009147 Unclassified 677
255 Ga0105243_10295804 3300009148 Bacteria 1465
256 Ga0105243_10410181 3300009148 Bacteria 1261
257 Ga0105241_11842701 3300009174 Bacteria 591
258 Ga0105248_10026176 3300009177 Bacteria 6490
259 Ga0105248_10171507 3300009177 Bacteria 2445
260 Ga0105248_10184988 3300009177 Bacteria 2348
261 Ga0105248_10365679 3300009177 Bacteria 1624
262 Ga0105248_10614168 3300009177 Bacteria 1227
263 Ga0105248_12165081 3300009177 Bacteria 633
264 Ga0105238_11063237 3300009551 Unclassified 831
265 Ga0105238_11601152 3300009551 Bacteria 681
266 Ga0105249_10051187 3300009553 Bacteria 3767
267 Ga0105249_12625885 3300009553 Bacteria 576
268 Ga0105239_10048798 3300010375 Bacteria 4641
269 Ga0105246_10413426 3300011119 Bacteria 1124
270 Ga0157374_10053053 3300013296 Bacteria 3779
271 Ga0157374_10128158 3300013296 Bacteria 2454
272 Ga0157374_10144824 3300013296 Bacteria 2308
273 Ga0157378_10007605 3300013297 Bacteria 9459
274 Ga0157378_10295233 3300013297 Unclassified 1567
275 Ga0163162_10038185 3300013306 Bacteria 4793
276 Ga0163162_12262491 3300013306 Unclassified 624
277 Ga0157375_10332340 3300013308 Bacteria 1685
278 Ga0157375_11849735 3300013308 Unclassified 716
279 Ga0157375_13727309 3300013308 Unclassified 507
280 Ga0163163_10015623 3300014325 Bacteria 7025
281 Ga0163163_10469624 3300014325 Bacteria 1319
282 Ga0163163_11825941 3300014325 Bacteria 668
283 Ga0157380_10008514 3300014326 Bacteria 7330
284 Ga0157380_10033609 3300014326 Bacteria 3950
285 Ga0157380_10096906 3300014326 Bacteria 2447
286 Ga0157380_10164678 3300014326 Unclassified 1931
287 Ga0157380_10246909 3300014326 Bacteria 1613
288 Ga0157380_10462857 3300014326 Bacteria 1221
289 Ga0157380_10491711 3300014326 Bacteria 1189
290 Ga0157380_12142883 3300014326 Bacteria 622
291 Ga0157380_13042457 3300014326 Unclassified 534
292 Ga0157379_10030457 3300014968 Unclassified 4803
293 Ga0157379_10419208 3300014968 Bacteria 1233
294 Ga0157379_11067435 3300014968 Bacteria 772
295 Ga0157376_10000017 3300014969 Bacteria 268501
296 Ga0157376_10000250 3300014969 Bacteria 37183
297 Ga0157376_10171005 3300014969 Bacteria 1979
298 Ga0157376_10321382 3300014969 Bacteria 1471
299 Ga0163161_11337739 3300017792 Unclassified 624
300 Ga0206350_10218674 3300020080 Bacteria 548
301 Ga0207697_10460051 3300025315 Bacteria 564
302 Ga0207682_10625717 3300025893 Unclassified 507
303 Ga0207642_10098242 3300025899 Bacteria 1463
304 Ga0207642_10345835 3300025899 Bacteria 876
305 Ga0207710_10076571 3300025900 Bacteria 1544
306 Ga0207685_10152109 3300025905 Unclassified 1048
307 Ga0207699_10271733 3300025906 Bacteria 1175
308 Ga0207645_10124012 3300025907 Bacteria 1678
309 Ga0207643_10307383 3300025908 Bacteria 988
310 Ga0207643_10778124 3300025908 Unclassified 620
311 Ga0207684_10006412 3300025910 Bacteria 10725
312 Ga0207684_10767782 3300025910 Unclassified 816
313 Ga0207663_10188580 3300025916 Bacteria 1479
314 Ga0207660_10116551 3300025917 Bacteria 2018
315 Ga0207660_10981278 3300025917 Bacteria 689
316 Ga0207646_10000005 3300025922 Bacteria 523896
317 Ga0207646_10000656 3300025922 Bacteria 44746
318 Ga0207646_10195261 3300025922 Bacteria 1828
319 Ga0207646_10469090 3300025922 Unclassified 1135
320 Ga0207646_10986934 3300025922 Bacteria 745
321 Ga0207646_11446021 3300025922 Unclassified 597
322 Ga0207681_10507654 3300025923 Bacteria 988
323 Ga0207694_11765439 3300025924 Unclassified 520
324 Ga0207650_10014041 3300025925 Bacteria 5561
325 Ga0207650_10484045 3300025925 Bacteria 1033
326 Ga0207650_10900134 3300025925 Bacteria 751
327 Ga0207650_11420849 3300025925 Unclassified 590
328 Ga0207650_11585662 3300025925 Bacteria 556
329 Ga0207659_11672094 3300025926 Unclassified 542
330 Ga0207644_10366928 3300025931 Bacteria 1172
331 Ga0207644_11760692 3300025931 Unclassified 519
332 Ga0207706_10277494 3300025933 Bacteria 1462
333 Ga0207686_10446524 3300025934 Bacteria 994
334 Ga0207709_10587974 3300025935 Bacteria 880
335 Ga0207670_10120215 3300025936 Unclassified 1908
336 Ga0207670_11005421 3300025936 Unclassified 702
337 Ga0207670_11138057 3300025936 Unclassified 660
338 Ga0207669_10191278 3300025937 Bacteria 1476
339 Ga0207669_10571681 3300025937 Bacteria 915
340 Ga0207669_10743677 3300025937 Bacteria 809
341 Ga0207669_11121418 3300025937 Unclassified 665
342 Ga0207704_10039357 3300025938 Bacteria 2752
343 Ga0207704_10644630 3300025938 Unclassified 872
344 Ga0207704_11170989 3300025938 Unclassified 655
345 Ga0207665_10054328 3300025939 Bacteria 2700
346 Ga0207691_10097193 3300025940 Bacteria 2632
347 Ga0207691_11477966 3300025940 Unclassified 556
348 Ga0207711_10011034 3300025941 Bacteria 7508
349 Ga0207711_10371237 3300025941 Bacteria 1327
350 Ga0207711_10506023 3300025941 Unclassified 1126
351 Ga0207711_10829721 3300025941 Bacteria 861
352 Ga0207689_10976298 3300025942 Unclassified 715
353 Ga0207689_11288253 3300025942 Bacteria 614
354 Ga0207679_11061322 3300025945 Bacteria 743
355 Ga0207651_10061154 3300025960 Bacteria 2618
356 Ga0207651_12071609 3300025960 Unclassified 511
357 Ga0207712_10021937 3300025961 Bacteria 4198
358 Ga0207712_10094884 3300025961 Bacteria 2205
359 Ga0207668_10504372 3300025972 Bacteria 1041
360 Ga0207668_10713933 3300025972 Unclassified 882
361 Ga0207640_10542174 3300025981 Bacteria 976
362 Ga0207658_10540928 3300025986 Bacteria 1041
363 Ga0207658_10945658 3300025986 Bacteria 785
364 Ga0207677_10484691 3300026023 Bacteria 1066
365 Ga0207703_10017943 3300026035 Bacteria 5526
366 Ga0207703_10352633 3300026035 Bacteria 1355
367 Ga0207703_10994117 3300026035 Unclassified 805
368 Ga0207639_10820806 3300026041 Bacteria 867
369 Ga0207678_11230305 3300026067 Bacteria 663
370 Ga0207708_10024553 3300026075 Bacteria 4560
371 Ga0207708_10266868 3300026075 Bacteria 1383
372 Ga0207708_10590888 3300026075 Bacteria 940
373 Ga0207702_11504835 3300026078 Bacteria 667
374 Ga0207641_10003032 3300026088 Bacteria 15136
375 Ga0207641_10217133 3300026088 Bacteria 1771
376 Ga0207641_11862304 3300026088 Unclassified 603
377 Ga0207648_10035292 3300026089 Bacteria 4406
378 Ga0207648_10291162 3300026089 Bacteria 1462
379 Ga0207648_10407288 3300026089 Unclassified 1233
380 Ga0207648_10418581 3300026089 Bacteria 1216
381 Ga0207648_10528298 3300026089 Unclassified 1082
382 Ga0207648_11631016 3300026089 Unclassified 606
383 Ga0207676_10001971 3300026095 Bacteria 14952
384 Ga0207676_10277900 3300026095 Bacteria 1519
385 Ga0207676_10839759 3300026095 Unclassified 898
386 Ga0207675_100243927 3300026118 Bacteria 1737
387 Ga0207675_101713422 3300026118 Bacteria 648
388 Ga0207675_102518394 3300026118 Unclassified 525
389 Ga0207683_10014719 3300026121 Bacteria 6662
390 Ga0207683_10180421 3300026121 Bacteria 1914
391 Ga0207683_10589139 3300026121 Unclassified 1029
392 Ga0207683_10927413 3300026121 Bacteria 809
393 Ga0207698_10678623 3300026142 Bacteria 1023
394 Ga0209970_1087204 3300027614 Unclassified 590
395 Ga0209971_1043954 3300027682 Unclassified 1077
396 Ga0209998_10013831 3300027717 Bacteria 1682
397 Ga0207428_10002865 3300027907 Bacteria 17096
398 Ga0207428_10018122 3300027907 Bacteria 6024
399 Ga0207428_10022736 3300027907 Bacteria 5286
400 Ga0207428_10025510 3300027907 Bacteria 4947
401 Ga0207428_10066583 3300027907 Bacteria 2838
402 Ga0207428_10210033 3300027907 Bacteria 1463
403 Ga0207428_10447894 3300027907 Bacteria 942
404 Ga0207428_10694797 3300027907 Bacteria 728
405 Ga0268266_10000367 3300028379 Bacteria 69371
406 Ga0268266_10070996 3300028379 Bacteria 3018
407 Ga0268265_10087776 3300028380 Bacteria 2476
408 Ga0268265_10527944 3300028380 Bacteria 1117
409 Ga0268265_11067889 3300028380 Bacteria 800
410 Ga0268265_11672340 3300028380 Bacteria 642
411 Ga0268264_10157874 3300028381 Bacteria 2040
412 Ga0268264_10247292 3300028381 Unclassified 1655
413 Ga0268264_10511851 3300028381 Bacteria 1172
414 Ga0307408_100038792 3300031548 Bacteria 3363
415 Ga0307408_100326366 3300031548 Unclassified 1295
416 Ga0307408_100341182 3300031548 Bacteria 1268
417 Ga0307408_101157320 3300031548 Unclassified 720
418 Ga0307405_10165250 3300031731 Unclassified 1572
419 Ga0307413_10021972 3300031824 Bacteria 3428
420 Ga0307413_10148681 3300031824 Bacteria 1629
421 Ga0307413_10355593 3300031824 Unclassified 1132
422 Ga0307410_10253811 3300031852 Unclassified 1368
423 Ga0307410_10615274 3300031852 Unclassified 907
424 Ga0307410_11429225 3300031852 Bacteria 608
425 Ga0307406_10136670 3300031901 Bacteria 1729
426 Ga0307406_10791385 3300031901 Bacteria 799
427 Ga0307412_10177321 3300031911 Unclassified 1599
428 Ga0307412_10207304 3300031911 Bacteria 1493
429 Ga0307412_11023367 3300031911 Unclassified 731
430 Ga0307409_100118135 3300031995 Bacteria 2239
431 Ga0307409_100223831 3300031995 Bacteria 1700
432 Ga0307409_100254687 3300031995 Unclassified 1607
433 Ga0307409_100739281 3300031995 Bacteria 987
434 Ga0307416_100041445 3300032002 Bacteria 3586
435 Ga0307416_101283899 3300032002 Unclassified 838
436 Ga0307416_101824793 3300032002 Unclassified 712
437 Ga0307414_10172612 3300032004 Unclassified 1730
438 Ga0307414_11157730 3300032004 Unclassified 715
439 Ga0307411_10053985 3300032005 Unclassified 2636
440 Ga0307411_11104229 3300032005 Bacteria 715
441 Ga0307415_100163054 3300032126 Unclassified 1730
442 Ga0307415_100467716 3300032126 Unclassified 1094
443 Ga0307415_101551116 3300032126 Bacteria 635
444 Ga0373932_0387641 3300035112 Bacteria 538
445 Ga0373962_0102747 3300035242 Unclassified 893
446 Ga0373931_0036226 3300035691 Bacteria 2571
447 Ga0373931_0271433 3300035691 Unclassified 1038
448 Ga0373937_0761786 3300036401 Bacteria 915
449 Ga0439461_0111498 3300041410 Bacteria 676
450 Ga0451797_0299694 3300041453 Bacteria 688
451 Ga0451800_1493401 3300041459 Unclassified 1018
452 Ga0451802_1875207 3300041460 Bacteria 763
453 Ga0451849_0277522 3300041505 Bacteria 583
454 Ga0451851_0244060 3300041507 Unclassified 576
455 Ga0451853_0091060 3300041512 Bacteria 1236
456 Ga0451853_2227270 3300041512 Bacteria 503
457 Ga0439431_0091642 3300041997 Bacteria 828
458 Ga0439462_0038887 3300042015 Bacteria 1267
459 Ga0450919_030868 3300042121 Unclassified 614
460 Ga0439446_0007665 3300042156 Bacteria 2844
461 Ga0439446_0374408 3300042156 Bacteria 511
462 Ga0439435_0332185 3300042436 Bacteria 525
463 Ga0451576_0570614 3300045051 Bacteria 1189
464 Ga0495641_0068575 3300046461 Unclassified 1595
465 Ga0495580_0001831 3300046472 Bacteria 18706
466 Ga0495582_0001365 3300046473 Bacteria 13736
467 Ga0495639_0465057 3300046475 Unclassified 643
468 Ga0495586_0832705 3300046535 Unclassified 532
469 Ga0495598_0350905 3300046537 Unclassified 568
470 Ga0495621_0006210 3300046539 Bacteria 3475
471 Ga0495646_0655692 3300046680 Bacteria 530
472 Ga0495647_0195045 3300046681 Bacteria 886
473 Ga0495658_0137291 3300046683 Unclassified 1493
474 Ga0495670_0642410 3300046691 Unclassified 578
475 Ga0495636_0353750 3300047318 Unclassified 694
476 Ga0495686_0175678 3300047472 Bacteria 1244
477 Ga0496101_0564733 3300048904 Bacteria 900
478 Ga0496102_1013906 3300048905 Bacteria 751
479 Ga0496104_0013792 3300048907 Bacteria 7290
480 Ga0496105_0105472 3300048908 Bacteria 2327
481 Ga0496105_0628285 3300048908 Bacteria 831
482 Ga0496106_0073520 3300048909 Bacteria 2615
483 Ga0496106_1002724 3300048909 Bacteria 657
484 Ga0496106_1403068 3300048909 Bacteria 540
485 Ga0496107_0216862 3300048910 Bacteria 1423
486 Ga0496108_0003941 3300048911 Bacteria 11917
487 Ga0496109_0014788 3300048912 Bacteria 6791
488 Ga0496110_0004180 3300048913 Bacteria 11150
489 Ga0496111_0047157 3300048914 Bacteria 3103
490 Ga0496112_0011635 3300048915 Bacteria 8047
491 Ga0496113_0025504 3300048916 Bacteria 4214
492 Ga0496113_0756178 3300048916 Unclassified 774
493 Ga0496114_0049814 3300048917 Unclassified 3485
494 Ga0496115_0008391 3300048918 Bacteria 7645
495 Ga0501291_037854 3300049514 Unclassified 838
496 Ga0501315_054280 3300049531 Bacteria 636
497 Ga0501316_069412 3300049532 Bacteria 532
498 Ga0501317_053223 3300049533 Bacteria 648
499 Ga0501318_041917 3300049534 Bacteria 657
500 Ga0501031_0162785 3300049568 Unclassified 1458
501 Ga0501032_0475759 3300049569 Bacteria 799
502 Ga0501033_0978092 3300049570 Bacteria 566
503 Ga0501036_0026177 3300049572 Bacteria 4924
504 Ga0501036_0135973 3300049572 Bacteria 2075
505 Ga0501036_1382965 3300049572 Bacteria 571
506 Ga0501038_0484733 3300049574 Bacteria 947
507 Ga0501040_1076552 3300049576 Bacteria 583
508 Ga0501041_0098944 3300049577 Bacteria 1804
509 Ga0501041_0353839 3300049577 Bacteria 928
510 Ga0501041_0938894 3300049577 Bacteria 556
511 Ga0501042_0104751 3300049578 Bacteria 2035
512 Ga0501042_0798942 3300049578 Bacteria 687
513 Ga0501048_0014437 3300049582 Bacteria 5848
514 Ga0501048_0333182 3300049582 Bacteria 1081
515 Ga0501048_0626760 3300049582 Unclassified 772
516 Ga0501068_0562006 3300049584 Bacteria 742
517 Ga0501068_1033318 3300049584 Bacteria 543
518 Ga0501069_0855819 3300049585 Bacteria 552
519 Ga0501071_0002810 3300049587 Bacteria 10712
520 Ga0501071_0127454 3300049587 Bacteria 1890
521 Ga0501072_0243020 3300049588 Bacteria 1434
522 Ga0501072_0247884 3300049588 Bacteria 1418
523 Ga0501073_0019822 3300049589 Bacteria 4853
524 Ga0501073_0072607 3300049589 Bacteria 2397
525 Ga0501073_1213926 3300049589 Bacteria 518
526 Ga0501074_0281649 3300049590 Bacteria 1182
527 Ga0501074_0491833 3300049590 Bacteria 869
528 Ga0501075_0005790 3300049591 Bacteria 8456
529 Ga0501075_0231960 3300049591 Bacteria 1407
530 Ga0501075_0422830 3300049591 Bacteria 1016
531 Ga0501075_0905500 3300049591 Unclassified 671
532 Ga0501075_0948829 3300049591 Unclassified 654
533 Ga0501076_0005017 3300049592 Bacteria 9472
534 Ga0501076_0133149 3300049592 Bacteria 2017
535 Ga0501076_0324885 3300049592 Bacteria 1262
536 Ga0501076_0350684 3300049592 Bacteria 1212
537 Ga0501076_1273850 3300049592 Unclassified 605
538 Ga0501076_1777962 3300049592 Unclassified 505
539 Ga0501077_0606592 3300049593 Bacteria 703
540 Ga0501079_0062636 3300049741 Bacteria 2869
541 Ga0501079_0260728 3300049741 Bacteria 1355
542 Ga0501079_1444213 3300049741 Unclassified 541
543 Ga0501080_0833770 3300049742 Unclassified 807
544 Ga0501080_1531345 3300049742 Unclassified 566
545 Ga0501081_0116603 3300049743 Bacteria 1899
546 Ga0501081_0610028 3300049743 Bacteria 817
547 Ga0501081_0954115 3300049743 Bacteria 647
548 Ga0501083_0379286 3300049744 Unclassified 920
549 Ga0501035_0845832 3300049822 Bacteria 728
550 Ga0501045_0029672 3300049824 Bacteria 3955
551 Ga0501045_0872406 3300049824 Bacteria 661
552 Ga0501045_1018254 3300049824 Unclassified 607
553 Ga0501045_1027825 3300049824 Bacteria 604
554 nmdc:mga03683_267898_c1 3300050489 Bacteria 796
555 nmdc:mga03683_654781_c1 3300050489 Bacteria 517
556 nmdc:mga0yw44_661898_c1 3300050492 Unclassified 709
557 nmdc:mga0k408_283280_c1 3300050493 Bacteria 989
558 nmdc:mga06z11_804532_c1 3300050494 Bacteria 573
559 nmdc:mga05p37_1030856_c1 3300050507 Unclassified 870
560 nmdc:mga05p37_1863184_c1 3300050507 Bacteria 577
561 nmdc:mga05p37_1866892_c1 3300050507 Unclassified 576
562 nmdc:mga05p37_333742_c1 3300050507 Bacteria 1790
563 nmdc:mga09592_1429347_c1 3300050508 Bacteria 565
564 nmdc:mga09592_240333_c1 3300050508 Bacteria 1569
565 nmdc:mga09592_454537_c1 3300050508 Bacteria 1105
566 nmdc:mga0qj67_34610_c1 3300050509 Bacteria 3946
567 nmdc:mga0qj67_603941_c1 3300050509 Bacteria 877
568 nmdc:mga0qj67_63646_c2 3300050509 Bacteria 1918
569 nmdc:mga0qj67_906930_c1 3300050509 Bacteria 694
570 nmdc:mga06r32_419695_c1 3300050510 Bacteria 1319
571 nmdc:mga08y16_107876_c1 3300050511 Bacteria 2899
572 nmdc:mga08y16_1327361_c1 3300050511 Bacteria 685
573 nmdc:mga08y16_1519373_c1 3300050511 Bacteria 630
574 nmdc:mga08y16_1794542_c1 3300050511 Unclassified 567
575 nmdc:mga08y16_1941893_c1 3300050511 Unclassified 539
576 nmdc:mga08y16_35454_c1 3300050511 Bacteria 5239
577 nmdc:mga08y16_38470_c1 3300050511 Bacteria 5023
578 nmdc:mga08y16_562825_c1 3300050511 Bacteria 1153
579 nmdc:mga08y16_683620_c1 3300050511 Bacteria 1028
580 nmdc:mga08y16_7273_c1 3300050511 Bacteria 11621
581 nmdc:mga08y16_971173_c1 3300050511 Bacteria 831
582 nmdc:mga0n895_1226116_c1 3300050512 Bacteria 723
583 nmdc:mga0n895_157134_c1 3300050512 Bacteria 2305
584 nmdc:mga0n895_31606_c1 3300050512 Bacteria 5071
585 nmdc:mga0n895_350616_c1 3300050512 Bacteria 1495
586 nmdc:mga0n895_639053_c1 3300050512 Bacteria 1064
587 nmdc:mga0n895_815699_c1 3300050512 Unclassified 923
588 nmdc:mga0n895_87034_c1 3300050512 Bacteria 3121
589 nmdc:mga0rr50_286954_c1 3300050513 Bacteria 1374
590 nmdc:mga0rr50_30342_c1 3300050513 Bacteria 3826
591 nmdc:mga0rr50_44185_c1 3300050513 Bacteria 3266
592 nmdc:mga0rr50_521172_c1 3300050513 Unclassified 1011
593 nmdc:mga0rr50_579797_c1 3300050513 Bacteria 956
594 nmdc:mga08x19_325862_c1 3300050514 Bacteria 1069
595 nmdc:mga0a205_121666_c1 3300050515 Bacteria 2509
596 nmdc:mga0a205_878714_c1 3300050515 Bacteria 743
597 Ga0500555_025756 3300053103 Bacteria 1683
598 Ga0500616_0362184 3300053153 Unclassified 587
599 Ga0501084_0451268 3300054114 Unclassified 1087
600 Ga0501084_0453976 3300054114 Bacteria 1083
601 Ga0501084_0617796 3300054114 Bacteria 915
602 Ga0587082_018466 3300059504 Bacteria 1110
603 Ga0587098_059194 3300059604 Bacteria 598
604 Ga0587119_067496 3300059658 Bacteria 562
605 Ga0501082_0069232 3300060353 Bacteria 3038
606 Ga0501082_0287269 3300060353 Bacteria 1432
607 Ga0501082_0564540 3300060353 Unclassified 996
608 Ga0501082_1169904 3300060353 Bacteria 672
609 Ga0530510_0351040 3300061734 Bacteria 1108
610 Ga0114129_11150866
611 Ga0058859_11511814
612 Ga0058860_10026082
613 Ga0058860_11772537
614 Ga0065704_10720376
615 Ga0065712_10001497
616 Ga0065712_10088296
617 Ga0065712_10391481
618 Ga0065715_10000707
619 Ga0065715_10201777
620 Ga0065715_10445900
621 Ga0065707_10315692
622 Ga0065707_10321834
623 Ga0065707_10382015
624 Ga0065707_10792033
625 Ga0065707_10844797
626 Ga0070676_10107643
627 Ga0070670_100004594
628 Ga0070670_100737911
629 Ga0070670_100832653
630 Ga0068869_101102721
631 Ga0070680_100564778
632 Ga0070680_100766018
633 Ga0070680_101274907
634 Ga0068868_100252680
635 Ga0068868_100541207
636 Ga0070689_100647273
637 Ga0070691_10303359
638 Ga0070692_10126937
639 Ga0070692_10320255
640 Ga0070668_101201856
641 Ga0070668_101786671
642 Ga0070669_100056589
643 Ga0070669_101893132
644 Ga0070675_100154914
645 Ga0070675_100598657
646 Ga0070675_100686498
647 Ga0070675_100728059
648 Ga0070675_100810899
649 Ga0070675_101300323
650 Ga0070675_101447628
651 Ga0070675_101489976
652 Ga0070675_101690238
653 Ga0070671_100570603
654 Ga0070671_101334661
655 Ga0070671_101421754
656 Ga0070674_100078492
657 Ga0070674_100316410
658 Ga0070674_100846937
659 Ga0070674_101028670
660 Ga0070674_101360104
661 Ga0070673_100067564
662 Ga0070673_100430013
663 Ga0070667_100067238
664 Ga0070667_100445267
665 Ga0070703_10302690
666 Ga0070709_10127655
667 Ga0070709_10877115
668 Ga0070701_10179135
669 Ga0070701_10294282
670 Ga0070711_100438046
671 Ga0070711_100951091
672 Ga0070705_100088086
673 Ga0070705_100153590
674 Ga0070700_100034266
675 Ga0070700_100318189
676 Ga0070700_100645247
677 Ga0070700_100693252
678 Ga0070694_100297746
679 Ga0070694_100437742
680 Ga0070694_100787351
681 Ga0070694_100787730
682 Ga0070694_101068711
683 Ga0070694_101601595
684 Ga0070708_100100076
685 Ga0070708_100153254
686 Ga0070708_100473790
687 Ga0070708_101260323
688 Ga0070678_100237601
689 Ga0070678_100408520
690 Ga0070678_101349560
691 Ga0070662_100430812
692 Ga0070662_100642112
693 Ga0068867_100055251
694 Ga0068867_100257269
695 Ga0068867_100543618
696 Ga0068867_100625984
697 Ga0068867_100890152
698 Ga0070685_10001680
699 Ga0070685_10089957
700 Ga0070685_10257755
701 Ga0070685_10407486
702 Ga0070706_100003496
703 Ga0070706_100522443
704 Ga0070706_101718255
705 Ga0070707_100013416
706 Ga0070707_100016670
707 Ga0070707_100211318
708 Ga0070707_101091780
709 Ga0070707_101129500
710 Ga0070707_101232385
711 Ga0070698_100019638
712 Ga0070698_100038798
713 Ga0070698_100075105
714 Ga0070698_100492502
715 Ga0070698_100589671
716 Ga0070699_100449494
717 Ga0070697_100006588
718 Ga0070697_100084018
719 Ga0070697_100293524
720 Ga0070697_101218987
721 Ga0070697_101828147
722 Ga0068853_100722445
723 Ga0068853_101669701
724 Ga0068853_102236832
725 Ga0070672_100061437
726 Ga0070672_101331847
727 Ga0070686_100316483
728 Ga0070695_100285544
729 Ga0070695_100356233
730 Ga0070695_100569562
731 Ga0070695_100941370
732 Ga0070696_100294118
733 Ga0070665_100001344
734 Ga0070665_100070617
735 Ga0070704_100043972
736 Ga0070704_100385352
737 Ga0070704_100442680
738 Ga0070704_100736672
739 Ga0070704_100921224
740 Ga0070704_101457798
741 Ga0068854_100194720
742 Ga0070702_100071966
743 Ga0068852_100532556
744 Ga0068859_100069817
745 Ga0068859_100081473
746 Ga0068859_100275163
747 Ga0068859_101163921
748 Ga0068859_101337106
749 Ga0068864_100011753
750 Ga0068864_100209685
751 Ga0068864_100236418
752 Ga0068866_10183454
753 Ga0068866_10366566
754 Ga0068866_10846711
755 Ga0068861_100379124
756 Ga0068861_100577524
757 Ga0068870_11035520
758 Ga0068863_100002607
759 Ga0068863_100046160
760 Ga0068863_100920717
761 Ga0068858_100081008
762 Ga0068858_100381689
763 Ga0068858_100842309
764 Ga0068860_100101980
765 Ga0068860_100752413
766 Ga0068860_101890812
767 Ga0068860_102142428
768 Ga0068860_102422867
769 Ga0068862_100898204
770 Ga0068862_101241305
771 Ga0068862_102492482
772 Ga0081540_1101683
773 Ga0081540_1228143
774 Ga0081539_10210697
775 Ga0075365_10874529
776 Ga0075364_11156842
777 Ga0075432_10118430
778 Ga0070715_10449258
779 Ga0070716_100318652
780 Ga0070712_100048429
781 Ga0070712_100537527
782 Ga0075362_10372540
783 Ga0075362_10745583
784 Ga0075367_10750177
785 Ga0075366_10117033
786 Ga0097621_100005812
787 Ga0097621_100099348
788 Ga0097621_100525737
789 Ga0068871_100062193
790 Ga0068871_100134236
791 Ga0068871_100655086
792 Ga0068871_101535049
793 Ga0075428_100020502
794 Ga0075428_100181254
795 Ga0075428_100196720
796 Ga0075428_100404474
797 Ga0075428_100461998
798 Ga0075428_100467972
799 Ga0075428_101406810
800 Ga0075428_101473931
801 Ga0075428_101789479
802 Ga0075430_100378334
803 Ga0075430_101027837
804 Ga0075430_101404450
805 Ga0075431_100562718
806 Ga0075431_100929134
807 Ga0075433_10100370
808 Ga0075433_10678306
809 Ga0075433_11165809
810 Ga0075433_11257043
811 Ga0075434_100010599
812 Ga0075434_100036586
813 Ga0075434_100070777
814 Ga0075434_100101417
815 Ga0075434_100479095
816 Ga0075434_100725548
817 Ga0075434_101559094
818 Ga0075429_100084367
819 Ga0075429_100493221
820 Ga0075429_100651119
821 Ga0075429_101315629
822 Ga0075429_101512729
823 Ga0075429_101749956
824 Ga0068865_100131428
825 Ga0068865_100190995
826 Ga0068865_100292775
827 Ga0075436_100356155
828 Ga0075436_100375275
829 Ga0075436_100886841
830 Ga0075436_101497417
831 Ga0097620_100069817
832 Ga0097620_100081473
833 Ga0097620_100275178
834 Ga0097620_101163804
835 Ga0097620_101337047
836 Ga0075435_100027436
837 Ga0075435_100080000
838 Ga0075435_100609385
839 Ga0075435_101166420
840 Ga0111539_10008200
841 Ga0111539_10016426
842 Ga0111539_10029105
843 Ga0111539_10029772
844 Ga0111539_10165905
845 Ga0111539_10175159
846 Ga0111539_10785662
847 Ga0111539_10826759
848 Ga0111539_10964090
849 Ga0111539_11129008
850 Ga0111539_11258834
851 Ga0111539_11261633
852 Ga0111539_11365888
853 Ga0111539_11577798
854 Ga0111539_13188945
855 Ga0111539_13454912
856 Ga0105245_10064291
857 Ga0105247_10106876
858 Ga0114129_10210094
859 Ga0114129_10443835
860 Ga0114129_10656557
861 Ga0114129_11038416
862 Ga0114129_11722321
863 Ga0114129_12122687
864 Ga0105243_10295804
865 Ga0105243_10410181
866 Ga0105241_11842701
867 Ga0105248_10026176
868 Ga0105248_10171507
869 Ga0105248_10184988
870 Ga0105248_10365679
871 Ga0105248_10614168
872 Ga0105248_12165081
873 Ga0105238_11063237
874 Ga0105238_11601152
875 Ga0105249_10051187
876 Ga0105249_12625885
877 Ga0105239_10048798
878 Ga0105246_10413426
879 Ga0157374_10053053
880 Ga0157374_10128158
881 Ga0157374_10144824
882 Ga0157378_10007605
883 Ga0157378_10295233
884 Ga0163162_10038185
885 Ga0163162_12262491
886 Ga0157375_10332340
887 Ga0157375_11849735
888 Ga0157375_13727309
889 Ga0163163_10015623
890 Ga0163163_10469624
891 Ga0163163_11825941
892 Ga0157380_10008514
893 Ga0157380_10033609
894 Ga0157380_10096906
895 Ga0157380_10164678
896 Ga0157380_10246909
897 Ga0157380_10462857
898 Ga0157380_10491711
899 Ga0157380_12142883
900 Ga0157380_13042457
901 Ga0157379_10030457
902 Ga0157379_10419208
903 Ga0157379_11067435
904 Ga0157376_10000017
905 Ga0157376_10000250
906 Ga0157376_10171005
907 Ga0157376_10321382
908 Ga0163161_11337739
909 Ga0206350_10218674
910 Ga0207697_10460051
911 Ga0207682_10625717
912 Ga0207642_10098242
913 Ga0207642_10345835
914 Ga0207710_10076571
915 Ga0207685_10152109
916 Ga0207699_10271733
917 Ga0207645_10124012
918 Ga0207643_10307383
919 Ga0207643_10778124
920 Ga0207684_10006412
921 Ga0207684_10767782
922 Ga0207663_10188580
923 Ga0207660_10116551
924 Ga0207660_10981278
925 Ga0207646_10000005
926 Ga0207646_10000656
927 Ga0207646_10195261
928 Ga0207646_10469090
929 Ga0207646_10986934
930 Ga0207646_11446021
931 Ga0207681_10507654
932 Ga0207694_11765439
933 Ga0207650_10014041
934 Ga0207650_10484045
935 Ga0207650_10900134
936 Ga0207650_11420849
937 Ga0207650_11585662
938 Ga0207659_11672094
939 Ga0207644_10366928
940 Ga0207644_11760692
941 Ga0207706_10277494
942 Ga0207686_10446524
943 Ga0207709_10587974
944 Ga0207670_10120215
945 Ga0207670_11005421
946 Ga0207670_11138057
947 Ga0207669_10191278
948 Ga0207669_10571681
949 Ga0207669_10743677
950 Ga0207669_11121418
951 Ga0207704_10039357
952 Ga0207704_10644630
953 Ga0207704_11170989
954 Ga0207665_10054328
955 Ga0207691_10097193
956 Ga0207691_11477966
957 Ga0207711_10011034
958 Ga0207711_10371237
959 Ga0207711_10506023
960 Ga0207711_10829721
961 Ga0207689_10976298
962 Ga0207689_11288253
963 Ga0207679_11061322
964 Ga0207651_10061154
965 Ga0207651_12071609
966 Ga0207712_10021937
967 Ga0207712_10094884
968 Ga0207668_10504372
969 Ga0207668_10713933
970 Ga0207640_10542174
971 Ga0207658_10540928
972 Ga0207658_10945658
973 Ga0207677_10484691
974 Ga0207703_10017943
975 Ga0207703_10352633
976 Ga0207703_10994117
977 Ga0207639_10820806
978 Ga0207678_11230305
979 Ga0207708_10024553
980 Ga0207708_10266868
981 Ga0207708_10590888
982 Ga0207702_11504835
983 Ga0207641_10003032
984 Ga0207641_10217133
985 Ga0207641_11862304
986 Ga0207648_10035292
987 Ga0207648_10291162
988 Ga0207648_10407288
989 Ga0207648_10418581
990 Ga0207648_10528298
991 Ga0207648_11631016
992 Ga0207676_10001971
993 Ga0207676_10277900
994 Ga0207676_10839759
995 Ga0207675_100243927
996 Ga0207675_101713422
997 Ga0207675_102518394
998 Ga0207683_10014719
999 Ga0207683_10180421
1000 Ga0207683_10589139
1001 Ga0207683_10927413
1002 Ga0207698_10678623
1003 Ga0209970_1087204
1004 Ga0209971_1043954
1005 Ga0209998_10013831
1006 Ga0207428_10002865
1007 Ga0207428_10018122
1008 Ga0207428_10022736
1009 Ga0207428_10025510
1010 Ga0207428_10066583
1011 Ga0207428_10210033
1012 Ga0207428_10447894
1013 Ga0207428_10694797
1014 Ga0268266_10000367
1015 Ga0268266_10070996
1016 Ga0268265_10087776
1017 Ga0268265_10527944
1018 Ga0268265_11067889
1019 Ga0268265_11672340
1020 Ga0268264_10157874
1021 Ga0268264_10247292
1022 Ga0268264_10511851
1023 Ga0307408_100038792
1024 Ga0307408_100326366
1025 Ga0307408_100341182
1026 Ga0307408_101157320
1027 Ga0307405_10165250
1028 Ga0307413_10021972
1029 Ga0307413_10148681
1030 Ga0307413_10355593
1031 Ga0307410_10253811
1032 Ga0307410_10615274
1033 Ga0307410_11429225
1034 Ga0307406_10136670
1035 Ga0307406_10791385
1036 Ga0307412_10177321
1037 Ga0307412_10207304
1038 Ga0307412_11023367
1039 Ga0307409_100118135
1040 Ga0307409_100223831
1041 Ga0307409_100254687
1042 Ga0307409_100739281
1043 Ga0307416_100041445
1044 Ga0307416_101283899
1045 Ga0307416_101824793
1046 Ga0307414_10172612
1047 Ga0307414_11157730
1048 Ga0307411_10053985
1049 Ga0307411_11104229
1050 Ga0307415_100163054
1051 Ga0307415_100467716
1052 Ga0307415_101551116
1053 Ga0373932_0387641
1054 Ga0373962_0102747
1055 Ga0373931_0036226
1056 Ga0373931_0271433
1057 Ga0373937_0761786
1058 Ga0439461_0111498
1059 Ga0451797_0299694
1060 Ga0451800_1493401
1061 Ga0451802_1875207
1062 Ga0451849_0277522
1063 Ga0451851_0244060
1064 Ga0451853_0091060
1065 Ga0451853_2227270
1066 Ga0439431_0091642
1067 Ga0439462_0038887
1068 Ga0450919_030868
1069 Ga0439446_0007665
1070 Ga0439446_0374408
1071 Ga0439435_0332185
1072 Ga0451576_0570614
1073 Ga0495641_0068575
1074 Ga0495580_0001831
1075 Ga0495582_0001365
1076 Ga0495639_0465057
1077 Ga0495586_0832705
1078 Ga0495598_0350905
1079 Ga0495621_0006210
1080 Ga0495646_0655692
1081 Ga0495647_0195045
1082 Ga0495658_0137291
1083 Ga0495670_0642410
1084 Ga0495636_0353750
1085 Ga0495686_0175678
1086 Ga0496101_0564733
1087 Ga0496102_1013906
1088 Ga0496104_0013792
1089 Ga0496105_0105472
1090 Ga0496105_0628285
1091 Ga0496106_0073520
1092 Ga0496106_1002724
1093 Ga0496106_1403068
1094 Ga0496107_0216862
1095 Ga0496108_0003941
1096 Ga0496109_0014788
1097 Ga0496110_0004180
1098 Ga0496111_0047157
1099 Ga0496112_0011635
1100 Ga0496113_0025504
1101 Ga0496113_0756178
1102 Ga0496114_0049814
1103 Ga0496115_0008391
1104 Ga0501291_037854
1105 Ga0501315_054280
1106 Ga0501316_069412
1107 Ga0501317_053223
1108 Ga0501318_041917
1109 Ga0501031_0162785
1110 Ga0501032_0475759
1111 Ga0501033_0978092
1112 Ga0501036_0026177
1113 Ga0501036_0135973
1114 Ga0501036_1382965
1115 Ga0501038_0484733
1116 Ga0501040_1076552
1117 Ga0501041_0098944
1118 Ga0501041_0353839
1119 Ga0501041_0938894
1120 Ga0501042_0104751
1121 Ga0501042_0798942
1122 Ga0501048_0014437
1123 Ga0501048_0333182
1124 Ga0501048_0626760
1125 Ga0501068_0562006
1126 Ga0501068_1033318
1127 Ga0501069_0855819
1128 Ga0501071_0002810
1129 Ga0501071_0127454
1130 Ga0501072_0243020
1131 Ga0501072_0247884
1132 Ga0501073_0019822
1133 Ga0501073_0072607
1134 Ga0501073_1213926
1135 Ga0501074_0281649
1136 Ga0501074_0491833
1137 Ga0501075_0005790
1138 Ga0501075_0231960
1139 Ga0501075_0422830
1140 Ga0501075_0905500
1141 Ga0501075_0948829
1142 Ga0501076_0005017
1143 Ga0501076_0133149
1144 Ga0501076_0324885
1145 Ga0501076_0350684
1146 Ga0501076_1273850
1147 Ga0501076_1777962
1148 Ga0501077_0606592
1149 Ga0501079_0062636
1150 Ga0501079_0260728
1151 Ga0501079_1444213
1152 Ga0501080_0833770
1153 Ga0501080_1531345
1154 Ga0501081_0116603
1155 Ga0501081_0610028
1156 Ga0501081_0954115
1157 Ga0501083_0379286
1158 Ga0501035_0845832
1159 Ga0501045_0029672
1160 Ga0501045_0872406
1161 Ga0501045_1018254
1162 Ga0501045_1027825
1163 nmdc:mga03683_267898_c1
1164 nmdc:mga03683_654781_c1
1165 nmdc:mga0yw44_661898_c1
1166 nmdc:mga0k408_283280_c1
1167 nmdc:mga06z11_804532_c1
1168 nmdc:mga05p37_1030856_c1
1169 nmdc:mga05p37_1863184_c1
1170 nmdc:mga05p37_1866892_c1
1171 nmdc:mga05p37_333742_c1
1172 nmdc:mga09592_1429347_c1
1173 nmdc:mga09592_240333_c1
1174 nmdc:mga09592_454537_c1
1175 nmdc:mga0qj67_34610_c1
1176 nmdc:mga0qj67_603941_c1
1177 nmdc:mga0qj67_63646_c2
1178 nmdc:mga0qj67_906930_c1
1179 nmdc:mga06r32_419695_c1
1180 nmdc:mga08y16_107876_c1
1181 nmdc:mga08y16_1327361_c1
1182 nmdc:mga08y16_1519373_c1
1183 nmdc:mga08y16_1794542_c1
1184 nmdc:mga08y16_1941893_c1
1185 nmdc:mga08y16_35454_c1
1186 nmdc:mga08y16_38470_c1
1187 nmdc:mga08y16_562825_c1
1188 nmdc:mga08y16_683620_c1
1189 nmdc:mga08y16_7273_c1
1190 nmdc:mga08y16_971173_c1
1191 nmdc:mga0n895_1226116_c1
1192 nmdc:mga0n895_157134_c1
1193 nmdc:mga0n895_31606_c1
1194 nmdc:mga0n895_350616_c1
1195 nmdc:mga0n895_639053_c1
1196 nmdc:mga0n895_815699_c1
1197 nmdc:mga0n895_87034_c1
1198 nmdc:mga0rr50_286954_c1
1199 nmdc:mga0rr50_30342_c1
1200 nmdc:mga0rr50_44185_c1
1201 nmdc:mga0rr50_521172_c1
1202 nmdc:mga0rr50_579797_c1
1203 nmdc:mga08x19_325862_c1
1204 nmdc:mga0a205_121666_c1
1205 nmdc:mga0a205_878714_c1
1206 Ga0500555_025756
1207 Ga0500616_0362184
1208 Ga0501084_0451268
1209 Ga0501084_0453976
1210 Ga0501084_0617796
1211 Ga0587082_018466
1212 Ga0587098_059194
1213 Ga0587119_067496
1214 Ga0501082_0069232
1215 Ga0501082_0287269
1216 Ga0501082_0564540
1217 Ga0501082_1169904
1218 Ga0530510_0351040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18919

DUF5670

Family of unknown function (DUF5670)

7

50

0.96

Map