F468835

General Info

Members Datasets Scaffolds Average Seq Length
608 461 280 305

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2888337043|2888343699
Length 368
Sequence DYYEILDPRFARLFNGSAQVEKLFTGCRWAEGPAWFAAGRYVVWSDIPNNRMLRYDETDGSVSVFRQPSGNSNGNTVDRQGRLVTCEHSGRRVSRTEHDGSVTTIAAKWKGKRLNSPNDVVVKSDGSVWFTDPSYGIDTDYEGDKAESEIGACHVYRVDPDTGEVEAVITDMVRPNGLAFSLDESLLYVVDTGRTHGAQNPAHMRVFNVGKHGKKVSGDKVFADCTSGLFDGFRLDAEGRIWTSAFDGIHCYDPDGTLIGKVKVPEVTANCVFGGAKLNCLYIAGTTSLYSVRLMVNGAKTFEAARNFSLAALGGASADSCGACFAAASAAAIICSAGAEFEAVRRWYQAQIKGRTSCHSSTSASSRK

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
14 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
15 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
16 2643221557 Ensifer sp. Root558 Isolate Unclassified
17 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
18 2643221610 Ensifer sp. Root74 Isolate Unclassified
19 2643221618 Ensifer sp. Root231 Isolate Unclassified
20 2643221626 Ensifer sp. Root31 Isolate Unclassified
21 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
22 2643221655 Ensifer sp. Root1252 Isolate Unclassified
23 2643221659 Ensifer sp. Root127 Isolate Unclassified
24 2643221668 Ensifer sp. Root423 Isolate Unclassified
25 2643221675 Ensifer sp. Root1298 Isolate Unclassified
26 2643221680 Ensifer sp. Root1312 Isolate Unclassified
27 2643221698 Ensifer sp. Root142 Isolate Unclassified
28 2643221712 Ensifer sp. Root258 Isolate Unclassified
29 2643221723 Ensifer sp. Root278 Isolate Unclassified
30 2643221726 Ensifer sp. Root954 Isolate Unclassified
31 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
32 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
33 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
34 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
35 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
36 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
37 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
38 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
39 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
40 2844163670 Ensifer sp. 1H6 Isolate Unclassified
41 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
42 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
43 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
44 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
45 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
46 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
47 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
48 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
49 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
50 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
51 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
52 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
53 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
54 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
55 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
56 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
57 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
58 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
59 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
60 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
61 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
62 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
63 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
64 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
65 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
66 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
67 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
68 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
69 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
70 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
71 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
72 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
73 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
74 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
75 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
76 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
77 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
78 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
79 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
80 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
81 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
82 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
83 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
84 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
85 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
86 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
87 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
88 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
89 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
90 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
91 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
92 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
93 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
94 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
95 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
96 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
97 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
98 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
99 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
100 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
101 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
102 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
103 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
104 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
105 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
106 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
107 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
108 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
109 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
110 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
111 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
112 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
113 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
114 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
115 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
116 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
117 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
118 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
119 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
120 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
121 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
122 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
123 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
124 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
125 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
126 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
127 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
128 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
129 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
130 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
131 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
132 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
133 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
134 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
135 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
136 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
137 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
138 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
139 2909042592 Labrys sp. LIt4 Isolate Nodule
140 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
141 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
142 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
143 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
144 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
145 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
146 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
147 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
148 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
149 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
150 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
151 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
152 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
153 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
154 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
155 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
156 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
157 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
158 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
159 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
160 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
161 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
162 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
163 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
164 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
165 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
166 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
167 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
168 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
169 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
170 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
171 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
172 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
173 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
174 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
175 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
176 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
177 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
178 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
179 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
180 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
181 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
182 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
183 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
184 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
185 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
186 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
187 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
188 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
189 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
190 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
191 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
192 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
193 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
194 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
195 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
196 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
197 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
198 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
199 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
200 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
201 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
202 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
203 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
204 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
205 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
206 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
207 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
208 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
209 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
210 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
211 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
212 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
213 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
214 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
215 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
216 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
217 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
218 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
219 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
220 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
221 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
222 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
223 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
224 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
225 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
226 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
227 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
228 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
229 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
230 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
231 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
232 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
233 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
234 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
235 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
236 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
237 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
238 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
239 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
240 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
241 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
242 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
243 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
244 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
245 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
246 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
247 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
248 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
249 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
250 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
251 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
252 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
253 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
254 3004167301 Mesorhizobium loti 582 Isolate Unclassified
255 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
256 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
257 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
258 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
259 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
260 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
261 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
262 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
263 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
264 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
265 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
266 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
267 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
268 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
269 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
270 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
271 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
272 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
273 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
274 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
275 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
276 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
277 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
278 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
279 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
280 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
281 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
282 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
283 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
284 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
285 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
286 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
287 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
288 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
289 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
290 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
291 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
292 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
293 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
294 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
295 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
296 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
297 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
298 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
299 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
300 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
301 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
302 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
303 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
304 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
305 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
306 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
307 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
308 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
309 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
310 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
311 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
312 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
313 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
314 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
315 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
316 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
317 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
318 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
319 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
320 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
321 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
322 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
323 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
324 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
325 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
326 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
327 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
328 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
329 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
330 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
331 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
333 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
336 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
337 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
338 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
340 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
366 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
367 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
368 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
369 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
370 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
371 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
372 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
373 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
374 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
375 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
376 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
377 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
378 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
379 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
380 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
381 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
382 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
383 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
384 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
385 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
386 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
387 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
388 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
389 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
390 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
391 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
392 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
393 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
394 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
395 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
396 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
397 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
398 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
399 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
400 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
403 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
404 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
407 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
408 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
409 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
410 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
411 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
412 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
427 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
428 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
430 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
431 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
432 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
433 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
434 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
435 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
436 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
437 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
438 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
439 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
442 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
444 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
445 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
446 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
447 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
448 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
449 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
450 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
451 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
452 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
453 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
454 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
455 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
456 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
457 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
458 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
459 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
460 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
461 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.05
Metatranscriptomes 0
Isolates 53.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.22
Nodule 45.56
Rhizoplane 0.99
Rhizosphere 34.05
Stem 0
Stem Tuber 0
Unclassified 11.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005086 3300001979 Bacteria 5584
2 JGI24739J22299_10000830 3300001989 Bacteria 11347
3 JGI24739J22299_10025680 3300001989 Bacteria 2071
4 JGI24737J22298_10000132 3300001990 Bacteria 22883
5 JGI24735J21928_10000391 3300002067 Bacteria 15267
6 JGI24735J21928_10022772 3300002067 Bacteria 1904
7 JGI24738J21930_10000059 3300002075 Bacteria 22623
8 JGI25156J39149_1011851 3300002705 Bacteria 1951
9 JGI25157J39369_1001275 3300002741 Bacteria 10205
10 JGI25151J46595_10001032 3300003187 Bacteria 20828
11 JGI25406J46586_10011914 3300003203 Bacteria 3793
12 JGI25165J46597_1000052 3300003214 Bacteria 236064
13 rootH1_10031147 3300003316 Bacteria 5129
14 rootH1_10085515 3300003316 Bacteria 1710
15 rootH1_10082485 3300003323 Bacteria 1979
16 rootH1_10244772 3300003323 Bacteria 2891
17 Ga0055542_1003407 3300003762 Bacteria 4321
18 Ga0055524_1000446 3300003775 Bacteria 34169
19 Ga0055536_1001554 3300003781 Bacteria 13762
20 Ga0055530_10010197 3300003791 Bacteria 3502
21 Ga0055531_10012128 3300003794 Bacteria 4081
22 Ga0070658_10000658 3300005327 Bacteria 29811
23 Ga0070658_10001698 3300005327 Bacteria 18587
24 Ga0070676_10129304 3300005328 Bacteria 1595
25 Ga0070670_100000971 3300005331 Bacteria 22507
26 Ga0070660_100189313 3300005339 Bacteria 1666
27 Ga0070660_100276728 3300005339 Bacteria 1373
28 Ga0070661_100008681 3300005344 Bacteria 7032
29 Ga0070668_100239462 3300005347 Bacteria 1502
30 Ga0070671_100293103 3300005355 Bacteria 1385
31 Ga0070674_100174998 3300005356 Bacteria 1639
32 Ga0070659_100085113 3300005366 Bacteria 2529
33 Ga0070659_100341880 3300005366 Bacteria 1254
34 Ga0070667_100038222 3300005367 Bacteria 4024
35 Ga0070663_100197129 3300005455 Bacteria 1570
36 Ga0070662_100140421 3300005457 Bacteria 1871
37 Ga0070707_100104890 3300005468 Bacteria 2740
38 Ga0068853_100005800 3300005539 Bacteria 9728
39 Ga0068853_100027777 3300005539 Bacteria 4756
40 Ga0068853_100033210 3300005539 Bacteria 4376
41 Ga0068853_100070656 3300005539 Bacteria 3039
42 Ga0068853_100088628 3300005539 Bacteria 2717
43 Ga0070665_100032675 3300005548 Bacteria 5237
44 Ga0070665_100303719 3300005548 Bacteria 1599
45 Ga0070665_100412690 3300005548 Bacteria 1359
46 Ga0068855_100225716 3300005563 Bacteria 2099
47 Ga0068855_100479266 3300005563 Bacteria 1354
48 Ga0068857_100063828 3300005577 Bacteria 3274
49 Ga0068857_100364118 3300005577 Bacteria 1341
50 Ga0068854_100066873 3300005578 Bacteria 2617
51 Ga0068856_100005612 3300005614 Bacteria 12344
52 Ga0068856_100243280 3300005614 Bacteria 1814
53 Ga0068852_100001347 3300005616 Bacteria 16484
54 Ga0068852_100042337 3300005616 Bacteria 3855
55 Ga0068852_100097123 3300005616 Bacteria 2649
56 Ga0068852_100101836 3300005616 Bacteria 2594
57 Ga0068852_100162796 3300005616 Bacteria 2084
58 Ga0068851_10105199 3300005834 Bacteria 1502
59 Ga0081540_1023776 3300005983 Bacteria 3572
60 Ga0081539_10000856 3300005985 Bacteria 58246
61 Ga0075365_10005336 3300006038 Bacteria 6921
62 Ga0075365_10006556 3300006038 Bacteria 6417
63 Ga0075365_10026350 3300006038 Bacteria 3690
64 Ga0075368_10063136 3300006042 Bacteria 1485
65 Ga0075364_10037397 3300006051 Bacteria 3143
66 Ga0075364_10090070 3300006051 Bacteria 2034
67 Ga0075362_10028380 3300006177 Bacteria 2403
68 Ga0075367_10008182 3300006178 Bacteria 5403
69 Ga0075367_10089619 3300006178 Bacteria 1870
70 Ga0075369_10021914 3300006186 Bacteria 2631
71 Ga0075369_10070717 3300006186 Bacteria 1535
72 Ga0075370_10063493 3300006353 Bacteria 2106
73 Ga0075370_10125729 3300006353 Bacteria 1494
74 Ga0075434_100087586 3300006871 Bacteria 3115
75 Ga0099794_10056169 3300007265 Bacteria 1904
76 Ga0105240_10050254 3300009093 Bacteria 5258
77 Ga0105240_10565715 3300009093 Bacteria 1256
78 Ga0105240_10725569 3300009093 Bacteria 1083
79 Ga0105245_10315034 3300009098 Bacteria 1540
80 Ga0105245_10512200 3300009098 Bacteria 1217
81 Ga0105241_10109587 3300009174 Bacteria 2208
82 Ga0105241_10178853 3300009174 Bacteria 1758
83 Ga0105237_10116882 3300009545 Bacteria 2660
84 Ga0105237_10172351 3300009545 Bacteria 2164
85 Ga0105237_10199150 3300009545 Bacteria 2002
86 Ga0105237_10348068 3300009545 Bacteria 1486
87 Ga0105237_10508384 3300009545 Bacteria 1211
88 Ga0105238_10003959 3300009551 Bacteria 14695
89 Ga0105238_10285082 3300009551 Bacteria 1633
90 Ga0105238_10353586 3300009551 Bacteria 1458
91 Ga0105239_10028999 3300010375 Bacteria 6084
92 Ga0105239_10040433 3300010375 Bacteria 5108
93 Ga0105239_10083930 3300010375 Bacteria 3508
94 Ga0105239_10168379 3300010375 Bacteria 2450
95 Ga0157371_10001278 3300013102 Bacteria 26557
96 Ga0157370_10069127 3300013104 Bacteria 3336
97 Ga0157369_10033621 3300013105 Bacteria 5634
98 Ga0163162_10914421 3300013306 Bacteria 990
99 Ga0157372_10018028 3300013307 Bacteria 7589
100 Ga0157372_10034402 3300013307 Bacteria 5570
101 Ga0157372_10075963 3300013307 Bacteria 3792
102 Ga0157372_10257094 3300013307 Bacteria 2028
103 Ga0182007_10031121 3300015262 Bacteria 1820
104 Ga0182005_1003645 3300015265 Bacteria 5171
105 Ga0213876_10002743 3300021384 Bacteria 10255
106 Ga0207425_1010431 3300025245 Bacteria 2261
107 Ga0209026_1000071 3300025250 Bacteria 205592
108 Ga0209148_1000111 3300025254 Bacteria 198095
109 Ga0209233_1000118 3300025261 Bacteria 236172
110 Ga0209455_1000223 3300025272 Bacteria 77481
111 Ga0209676_1001945 3300025292 Bacteria 16638
112 Ga0209025_1002267 3300025294 Bacteria 21060
113 Ga0209564_1000341 3300025295 Bacteria 89262
114 Ga0209758_1005653 3300025297 Bacteria 9469
115 Ga0209050_1006757 3300025298 Bacteria 6688
116 Ga0209256_1000286 3300025299 Bacteria 88880
117 Ga0209256_1000534 3300025299 Bacteria 55095
118 Ga0209051_1031230 3300025303 Bacteria 2053
119 Ga0209257_1004065 3300025304 Bacteria 11743
120 Ga0209257_1008947 3300025304 Bacteria 5508
121 Ga0207647_10003232 3300025904 Bacteria 12223
122 Ga0207647_10189670 3300025904 Bacteria 1191
123 Ga0207705_10178394 3300025909 Bacteria 1602
124 Ga0207654_10054425 3300025911 Bacteria 2312
125 Ga0207654_10179118 3300025911 Bacteria 1382
126 Ga0207695_10114643 3300025913 Bacteria 2670
127 Ga0207671_10016840 3300025914 Bacteria 5663
128 Ga0207671_10038262 3300025914 Bacteria 3555
129 Ga0207671_10267628 3300025914 Bacteria 1346
130 Ga0207657_10010574 3300025919 Bacteria 9201
131 Ga0207694_10031413 3300025924 Bacteria 4056
132 Ga0207694_10218278 3300025924 Bacteria 1555
133 Ga0207694_10312244 3300025924 Bacteria 1296
134 Ga0207650_10013560 3300025925 Bacteria 5646
135 Ga0207650_10053951 3300025925 Bacteria 2980
136 Ga0207664_10136259 3300025929 Bacteria 2072
137 Ga0207690_10092469 3300025932 Bacteria 2141
138 Ga0207706_10034615 3300025933 Bacteria 4493
139 Ga0207669_10148512 3300025937 Bacteria 1638
140 Ga0207667_10009154 3300025949 Bacteria 11697
141 Ga0207668_10098939 3300025972 Bacteria 2162
142 Ga0207640_10066824 3300025981 Bacteria 2403
143 Ga0207640_10104833 3300025981 Bacteria 1991
144 Ga0207639_10017655 3300026041 Bacteria 5059
145 Ga0207639_10330222 3300026041 Bacteria 1357
146 Ga0207639_10410179 3300026041 Bacteria 1222
147 Ga0207678_10145300 3300026067 Bacteria 2024
148 Ga0207678_10336556 3300026067 Bacteria 1300
149 Ga0207702_10041788 3300026078 Bacteria 3844
150 Ga0207702_10072661 3300026078 Bacteria 2965
151 Ga0207702_10334884 3300026078 Bacteria 1444
152 Ga0207641_10453533 3300026088 Bacteria 1240
153 Ga0207674_10108167 3300026116 Bacteria 2757
154 Ga0207674_10112873 3300026116 Bacteria 2691
155 Ga0207674_10164418 3300026116 Bacteria 2173
156 Ga0207683_10183450 3300026121 Bacteria 1898
157 Ga0207698_10000147 3300026142 Bacteria 44861
158 Ga0207698_10018436 3300026142 Bacteria 4755
159 Ga0207698_10080185 3300026142 Bacteria 2628
160 Ga0207698_10731776 3300026142 Bacteria 987
161 Ga0268266_10016459 3300028379 Bacteria 6322
162 Ga0268266_10081626 3300028379 Bacteria 2820
163 Ga0268266_10166193 3300028379 Bacteria 1999
164 Ga0268266_10229632 3300028379 Bacteria 1709
165 Ga0268266_10556051 3300028379 Bacteria 1100
166 Ga0307515_10000136 3300028794 Bacteria 174265
167 Ga0265338_10007705 3300028800 Bacteria 13252
168 Ga0265328_10081916 3300031239 Bacteria 1189
169 Ga0265325_10099315 3300031241 Bacteria 1426
170 Ga0265325_10135433 3300031241 Bacteria 1176
171 Ga0265340_10001823 3300031247 Bacteria 12180
172 Ga0265340_10027040 3300031247 Bacteria 2894
173 Ga0265339_10007319 3300031249 Bacteria 7149
174 Ga0265316_10050595 3300031344 Bacteria 3267
175 Ga0307513_10000302 3300031456 Bacteria 70793
176 Ga0307513_10268005 3300031456 Bacteria 1493
177 Ga0307408_100474769 3300031548 Bacteria 1090
178 Ga0265313_10000517 3300031595 Bacteria 40394
179 Ga0265313_10000962 3300031595 Bacteria 28567
180 Ga0307508_10029284 3300031616 Bacteria 4979
181 Ga0307508_10051894 3300031616 Bacteria 3645
182 Ga0307508_10232934 3300031616 Bacteria 1440
183 Ga0265314_10072044 3300031711 Bacteria 2310
184 Ga0265342_10013432 3300031712 Bacteria 5494
185 Ga0307412_10170186 3300031911 Bacteria 1628
186 Ga0307409_100162165 3300031995 Bacteria 1957
187 Ga0307411_10041955 3300032005 Bacteria 2916
188 Ga0395899_0059696 3300037312 Bacteria 2811
189 Ga0395900_0036416 3300037418 Bacteria 5073
190 Ga0395900_0084846 3300037418 Bacteria 3255
191 Ga0395900_0200039 3300037418 Bacteria 2022
192 Ga0395900_0403026 3300037418 Bacteria 1331
193 Ga0395900_0424264 3300037418 Bacteria 1290
194 Ga0395905_0054524 3300037471 Bacteria 3741
195 Ga0395905_0103890 3300037471 Bacteria 2667
196 Ga0395905_0275237 3300037471 Bacteria 1569
197 Ga0436364_0423603 3300037853 Bacteria 1626
198 Ga0395901_0025851 3300038443 Bacteria 6029
199 Ga0395901_0050835 3300038443 Bacteria 4306
200 Ga0395901_0182738 3300038443 Bacteria 2199
201 Ga0395901_0218982 3300038443 Bacteria 1990
202 Ga0436365_1936450 3300039437 Bacteria 28674
203 Ga0436361_0105140 3300039447 Bacteria 8104
204 Ga0439465_0070021 3300041413 Bacteria 1174
205 Ga0439445_0010670 3300042004 Bacteria 2179
206 Ga0439458_0016468 3300042157 Bacteria 1682
207 Ga0439459_0008243 3300042438 Bacteria 1777
208 Ga0466969_0078153 3300044656 Bacteria 1583
209 Ga0466972_0005564 3300044658 Bacteria 6309
210 Ga0466963_0091102 3300044694 Bacteria 2076
211 Ga0466964_0002410 3300044706 Bacteria 6648
212 Ga0466971_0014285 3300044719 Bacteria 3492
213 Ga0466960_0022865 3300044901 Bacteria 2799
214 Ga0466967_0130739 3300045976 Bacteria 2330
215 Ga0495638_0005109 3300046460 Bacteria 9828
216 Ga0495638_0078893 3300046460 Bacteria 2003
217 Ga0495596_0052652 3300046500 Bacteria 1594
218 Ga0495643_0061015 3300046522 Bacteria 2000
219 Ga0495687_077771 3300047443 Bacteria 1309
220 Ga0495686_0116637 3300047472 Bacteria 1596
221 Ga0495626_0051310 3300048091 Bacteria 1903
222 Ga0496107_0148972 3300048910 Bacteria 1731
223 Ga0496112_0152570 3300048915 Bacteria 2277
224 Ga0496112_0309209 3300048915 Bacteria 1525
225 Ga0496113_0179990 3300048916 Bacteria 1676
226 Ga0496118_0048433 3300048921 Bacteria 3283
227 Ga0496118_0248221 3300048921 Bacteria 1013
228 Ga0496120_0002000 3300048923 Bacteria 22168
229 Ga0496120_0075732 3300048923 Bacteria 1836
230 Ga0496121_0065305 3300048924 Bacteria 2962
231 Ga0496121_0116293 3300048924 Bacteria 2029
232 Ga0496124_0247241 3300048927 Bacteria 1322
233 Ga0496126_0365601 3300048929 Bacteria 1177
234 Ga0501031_0000007 3300049568 Bacteria 166008
235 Ga0501032_0000007 3300049569 Bacteria 253881
236 Ga0501033_0000040 3300049570 Bacteria 142586
237 Ga0501034_0000029 3300049571 Bacteria 253881
238 Ga0501034_0158179 3300049571 Bacteria 2238
239 Ga0501036_0000004 3300049572 Bacteria 253881
240 Ga0501036_0195908 3300049572 Bacteria 1700
241 Ga0501037_0000004 3300049573 Bacteria 253989
242 Ga0501038_0000005 3300049574 Bacteria 253881
243 Ga0501038_0280658 3300049574 Bacteria 1311
244 Ga0501039_0000009 3300049575 Bacteria 253881
245 Ga0501040_0036028 3300049576 Bacteria 3356
246 Ga0501043_0000595 3300049579 Bacteria 32044
247 Ga0501047_0000895 3300049581 Bacteria 30440
248 Ga0501047_0009318 3300049581 Bacteria 9270
249 Ga0501068_0068209 3300049584 Bacteria 2168
250 Ga0501070_0009159 3300049586 Bacteria 8373
251 Ga0501070_0089590 3300049586 Bacteria 2546
252 Ga0501073_0242036 3300049589 Bacteria 1246
253 Ga0501080_0056593 3300049742 Bacteria 3651
254 Ga0501080_0234267 3300049742 Bacteria 1678
255 Ga0501035_0000014 3300049822 Bacteria 253874
256 Ga0501035_0058448 3300049822 Bacteria 3436
257 Ga0501035_0484456 3300049822 Bacteria 1020
258 Ga0501044_0000012 3300049823 Bacteria 253881
259 Ga0501044_0137621 3300049823 Bacteria 2432
260 Ga0501044_0324093 3300049823 Bacteria 1464
261 nmdc:mga00v17_61964_c2 3300050491 Bacteria 1951
262 nmdc:mga0yw44_41808_c1 3300050492 Bacteria 2730
263 nmdc:mga0yw44_4386_c1 3300050492 Bacteria 6459
264 nmdc:mga0yw44_5848_c1 3300050492 Bacteria 5872
265 nmdc:mga0yw44_991_c1 3300050492 Bacteria 10827
266 nmdc:mga06z11_30788_c1 3300050494 Bacteria 2600
267 nmdc:mga06z11_97431_c1 3300050494 Bacteria 1608
268 nmdc:mga07m45_21285_c1 3300050496 Bacteria 3529
269 nmdc:mga0n895_671316_c1 3300050512 Bacteria 1034
270 nmdc:mga0sz30_74010_c1 3300050516 Bacteria 1469
271 Ga0500610_0072575 3300053079 Bacteria 1795
272 Ga0495655_0015618 3300053083 Bacteria 1617
273 Ga0500595_013981 3300053119 Bacteria 3059
274 Ga0500568_0000090 3300053139 Bacteria 86645
275 Ga0500616_0034854 3300053153 Bacteria 2740
276 Ga0500616_0061017 3300053153 Bacteria 1953
277 Ga0500620_000076 3300053155 Bacteria 18956
278 Ga0500627_0027361 3300053158 Bacteria 2359
279 Ga0466962_0079603 3300061719 Bacteria 1566
280 Ga0466962_0184686 3300061719 Bacteria 1017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2924726620 2924731509 274
2 3300049572 Ga0501036_0195908 Ga0501036_0195908_71_1000 277
3 3300005327 Ga0070658_10000658 Ga0070658_1000065822 297
4 iso_pu_bacteria 2917699015 2917703490 298
5 3300048924 Ga0496121_0065305 Ga0496121_0065305_837_1736 299
6 iso_pu_bacteria 2599185352 2600197737 299
7 iso_pu_bacteria 2643221557 2643807881 299
8 iso_pu_bacteria 2643221610 2644068033 299
9 iso_pu_bacteria 2643221618 2644106885 299
10 iso_pu_bacteria 2643221626 2644149667 299
11 iso_pu_bacteria 2643221655 2644311274 299
12 iso_pu_bacteria 2643221659 2644331882 299
13 iso_pu_bacteria 2643221668 2644378222 299
14 iso_pu_bacteria 2643221675 2644418896 299
15 iso_pu_bacteria 2643221680 2644452323 299
16 iso_pu_bacteria 2643221698 2644543638 299
17 iso_pu_bacteria 2643221712 2644615813 299
18 iso_pu_bacteria 2643221723 2644674553 299
19 iso_pu_bacteria 2643221726 2644687067 299
20 iso_pu_bacteria 2844163670 2844169376 299
21 iso_pu_bacteria 2894232714 2894238135 299
22 iso_pu_bacteria 2909042592 2909046719 299
23 iso_pu_bacteria 2939669807 2939669924 299
24 iso_pu_bacteria 8054563764 8054568704 299
25 iso_pu_bacteria 8056681323 8056686312 299
26 iso_pu_bacteria 2847930680 2847933119 300
27 iso_pu_bacteria 3000135777 3000137685 300
28 3300006871 Ga0075434_100087586 Ga0075434_1000875862 301
29 3300050512 nmdc:mga0n895_671316_c1 nmdc:mga0n895_671316_c1_17_937 301
30 iso_pu_bacteria 2508501127 2509143167 301
31 iso_pu_bacteria 2597489875 2597811958 301
32 iso_pu_bacteria 2841734538 2841736683 301
33 iso_pu_bacteria 2856342000 2856343497 301
34 iso_pu_bacteria 2869162929 2869168880 301
35 iso_pu_bacteria 2871444079 2871449109 301
36 iso_pu_bacteria 2871474448 2871480789 301
37 iso_pu_bacteria 2871495908 2871497131 301
38 iso_pu_bacteria 2874102143 2874103205 301
39 iso_pu_bacteria 2874123672 2874130075 301
40 iso_pu_bacteria 2876369609 2876374712 301
41 iso_pu_bacteria 2876392853 2876399196 301
42 iso_pu_bacteria 2878760144 2878761352 301
43 iso_pu_bacteria 2878767105 2878768319 301
44 iso_pu_bacteria 2881147464 2881148512 301
45 iso_pu_bacteria 2881155292 2881159594 301
46 iso_pu_bacteria 2881161766 2881165294 301
47 iso_pu_bacteria 2885305155 2885307156 301
48 iso_pu_bacteria 2885326080 2885330534 301
49 iso_pu_bacteria 2885334103 2885338189 301
50 iso_pu_bacteria 2885342637 2885346097 301
51 iso_pu_bacteria 2903540706 2903541926 301
52 iso_pu_bacteria 2904659560 2904665723 301
53 iso_pu_bacteria 2906328253 2906333924 301
54 iso_pu_bacteria 2922158528 2922161538 301
55 iso_pu_bacteria 2924726620 2924728347 301
56 iso_pu_bacteria 2924754689 2924758670 301
57 iso_pu_bacteria 2937836603 2937839265 301
58 iso_pu_bacteria 2937891427 2937896653 301
59 iso_pu_bacteria 2937994558 2937995782 301
60 iso_pu_bacteria 2958071322 2958074337 301
61 iso_pu_bacteria 2958115193 2958120388 301
62 iso_pu_bacteria 2958165035 2958166254 301
63 iso_pu_bacteria 2961114664 2961121066 301
64 iso_pu_bacteria 2961163497 2961164716 301
65 iso_pu_bacteria 2965018300 2965019542 301
66 iso_pu_bacteria 2968091066 2968093499 301
67 iso_pu_bacteria 2968097103 2968100217 301
68 iso_pu_bacteria 2968110612 2968117216 301
69 iso_pu_bacteria 2968128360 2968129622 301
70 iso_pu_bacteria 2968171901 2968173118 301
71 iso_pu_bacteria 2970524798 2970526399 301
72 iso_pu_bacteria 2970540015 2970541815 301
73 iso_pu_bacteria 2970554993 2970556208 301
74 iso_pu_bacteria 2977858184 2977862090 301
75 iso_pu_bacteria 2977864932 2977865550 301
76 iso_pu_bacteria 2979779861 2979784501 301
77 iso_pu_bacteria 2987659509 2987660725 301
78 iso_pu_bacteria 2996341866 2996343995 301
79 iso_pu_bacteria 3004188549 3004189773 301
80 iso_pu_bacteria 8004395343 8004401671 301
81 iso_pu_bacteria 8004445564 8004450823 301
82 iso_pu_bacteria 8004633249 8004635824 301
83 iso_pu_bacteria 8004703790 8004706455 301
84 iso_pu_bacteria 8055617313 8055618220 301
85 3300025929 Ga0207664_10136259 Ga0207664_101362593 302
86 3300031548 Ga0307408_100474769 Ga0307408_1004747691 302
87 3300031616 Ga0307508_10051894 Ga0307508_100518943 302
88 3300032005 Ga0307411_10041955 Ga0307411_100419552 302
89 iso_pu_bacteria 2503198000 2503199016 302
90 iso_pu_bacteria 2508501123 2509117713 302
91 iso_pu_bacteria 2509276018 2509372838 302
92 iso_pu_bacteria 2509276022 2509393969 302
93 iso_pu_bacteria 2510065059 2510318358 302
94 iso_pu_bacteria 2512875016 2512933583 302
95 iso_pu_bacteria 2512875024 2512961722 302
96 iso_pu_bacteria 2513237090 2513613933 302
97 iso_pu_bacteria 2513237164 2514035596 302
98 iso_pu_bacteria 2513237305 2514419558 302
99 iso_pu_bacteria 2588253730 2588519660 302
100 iso_pu_bacteria 2599185301 2599936953 302
101 iso_pu_bacteria 2643221595 2643988538 302
102 iso_pu_bacteria 2643221627 2644154546 302
103 iso_pu_bacteria 2687453392 2688596290 302
104 iso_pu_bacteria 2693429783 2694631631 302
105 iso_pu_bacteria 2693429784 2694638315 302
106 iso_pu_bacteria 2721755686 2723573414 302
107 iso_pu_bacteria 2756170246 2756673682 302
108 iso_pu_bacteria 2791355123 2792747542 302
109 iso_pu_bacteria 2844002411 2844003141 302
110 iso_pu_bacteria 2844009547 2844011119 302
111 iso_pu_bacteria 2847670302 2847673744 302
112 iso_pu_bacteria 2856314179 2856320605 302
113 iso_pu_bacteria 2856320880 2856327163 302
114 iso_pu_bacteria 2856328259 2856329780 302
115 iso_pu_bacteria 2856334872 2856336584 302
116 iso_pu_bacteria 2856356410 2856362283 302
117 iso_pu_bacteria 2856364286 2856365084 302
118 iso_pu_bacteria 2857349434 2857353239 302
119 iso_pu_bacteria 2857367948 2857372228 302
120 iso_pu_bacteria 2869169390 2869176114 302
121 iso_pu_bacteria 2869234852 2869241017 302
122 iso_pu_bacteria 2869242130 2869245503 302
123 iso_pu_bacteria 2869249662 2869252003 302
124 iso_pu_bacteria 2869256925 2869258515 302
125 iso_pu_bacteria 2869264136 2869264746 302
126 iso_pu_bacteria 2869271264 2869273722 302
127 iso_pu_bacteria 2869278585 2869279606 302
128 iso_pu_bacteria 2869285874 2869286292 302
129 iso_pu_bacteria 2871429161 2871430261 302
130 iso_pu_bacteria 2871435913 2871442743 302
131 iso_pu_bacteria 2871451962 2871458694 302
132 iso_pu_bacteria 2871459585 2871464860 302
133 iso_pu_bacteria 2871466892 2871468667 302
134 iso_pu_bacteria 2871481445 2871482662 302
135 iso_pu_bacteria 2871488783 2871494968 302
136 iso_pu_bacteria 2874109183 2874110668 302
137 iso_pu_bacteria 2874116593 2874118929 302
138 iso_pu_bacteria 2874131515 2874134213 302
139 iso_pu_bacteria 2874139085 2874139402 302
140 iso_pu_bacteria 2874146452 2874146678 302
141 iso_pu_bacteria 2874155637 2874155752 302
142 iso_pu_bacteria 2874162495 2874167823 302
143 iso_pu_bacteria 2874168670 2874170657 302
144 iso_pu_bacteria 2876363079 2876364163 302
145 iso_pu_bacteria 2876386047 2876387004 302
146 iso_pu_bacteria 2876399893 2876402428 302
147 iso_pu_bacteria 2876406927 2876410165 302
148 iso_pu_bacteria 2876413966 2876414081 302
149 iso_pu_bacteria 2876420981 2876422763 302
150 iso_pu_bacteria 2878035449 2878039020 302
151 iso_pu_bacteria 2878730984 2878735557 302
152 iso_pu_bacteria 2878738818 2878742133 302
153 iso_pu_bacteria 2878745973 2878746457 302
154 iso_pu_bacteria 2878753008 2878760093 302
155 iso_pu_bacteria 2878774303 2878775986 302
156 iso_pu_bacteria 2878781027 2878786647 302
157 iso_pu_bacteria 2881845957 2881848740 302
158 iso_pu_bacteria 2882632389 2882640384 302
159 iso_pu_bacteria 2882912400 2882913237 302
160 iso_pu_bacteria 2885312484 2885313833 302
161 iso_pu_bacteria 2885318864 2885321443 302
162 iso_pu_bacteria 2888337043 2888343699 302
163 iso_pu_bacteria 2888350351 2888353509 302
164 iso_pu_bacteria 2889010040 2889015225 302
165 iso_pu_bacteria 2889016732 2889019696 302
166 iso_pu_bacteria 2903448605 2903453733 302
167 iso_pu_bacteria 2903492973 2903494327 302
168 iso_pu_bacteria 2903492973 2903499834 302
169 iso_pu_bacteria 2903513507 2903514679 302
170 iso_pu_bacteria 2903521522 2903525677 302
171 iso_pu_bacteria 2903528002 2903532776 302
172 iso_pu_bacteria 2906308376 2906308858 302
173 iso_pu_bacteria 2906321335 2906322138 302
174 iso_pu_bacteria 2906354277 2906361671 302
175 iso_pu_bacteria 2906363423 2906363429 302
176 iso_pu_bacteria 2906370794 2906377470 302
177 iso_pu_bacteria 2906378014 2906386021 302
178 iso_pu_bacteria 2906401398 2906408075 302
179 iso_pu_bacteria 2906408224 2906408455 302
180 iso_pu_bacteria 2906414383 2906421384 302
181 iso_pu_bacteria 2906427513 2906434135 302
182 iso_pu_bacteria 2922151315 2922158464 302
183 iso_pu_bacteria 2922172374 2922176081 302
184 iso_pu_bacteria 2922185730 2922190345 302
185 iso_pu_bacteria 2924710171 2924715805 302
186 iso_pu_bacteria 2924733363 2924737280 302
187 iso_pu_bacteria 2924741084 2924747620 302
188 iso_pu_bacteria 2924748358 2924750705 302
189 iso_pu_bacteria 2924762789 2924768594 302
190 iso_pu_bacteria 2924776078 2924779817 302
191 iso_pu_bacteria 2924784321 2924790896 302
192 iso_pu_bacteria 2937813078 2937822197 302
193 iso_pu_bacteria 2937822353 2937823867 302
194 iso_pu_bacteria 2937848649 2937851680 302
195 iso_pu_bacteria 2937861824 2937865679 302
196 iso_pu_bacteria 2937868953 2937871114 302
197 iso_pu_bacteria 2937877337 2937880595 302
198 iso_pu_bacteria 2937972304 2937974225 302
199 iso_pu_bacteria 2937980651 2937985243 302
200 iso_pu_bacteria 2958034702 2958035184 302
201 iso_pu_bacteria 2958041894 2958044216 302
202 iso_pu_bacteria 2958041894 2958055681 302
203 iso_pu_bacteria 2958064165 2958065684 302
204 iso_pu_bacteria 2958084443 2958087728 302
205 iso_pu_bacteria 2958100919 2958102807 302
206 iso_pu_bacteria 2958108152 2958115105 302
207 iso_pu_bacteria 2958122699 2958130209 302
208 iso_pu_bacteria 2958130278 2958130691 302
209 iso_pu_bacteria 2958137437 2958140498 302
210 iso_pu_bacteria 2958144490 2958149273 302
211 iso_pu_bacteria 2958158011 2958161198 302
212 iso_pu_bacteria 2958172287 2958175890 302
213 iso_pu_bacteria 2958179912 2958180030 302
214 iso_pu_bacteria 2961077736 2961077857 302
215 iso_pu_bacteria 2961127735 2961128639 302
216 iso_pu_bacteria 2961136820 2961142415 302
217 iso_pu_bacteria 2961170736 2961177362 302
218 iso_pu_bacteria 2961183825 2961185091 302
219 iso_pu_bacteria 2963644680 2963645621 302
220 iso_pu_bacteria 2965025482 2965026675 302
221 iso_pu_bacteria 2965032056 2965036113 302
222 iso_pu_bacteria 2965040258 2965040530 302
223 iso_pu_bacteria 2965047637 2965047924 302
224 iso_pu_bacteria 2965089291 2965093541 302
225 iso_pu_bacteria 2965102966 2965110428 302
226 iso_pu_bacteria 2965119406 2965121099 302
227 iso_pu_bacteria 2967996073 2968002467 302
228 iso_pu_bacteria 2968003550 2968009698 302
229 iso_pu_bacteria 2968016561 2968023604 302
230 iso_pu_bacteria 2968083720 2968085043 302
231 iso_pu_bacteria 2968117919 2968122355 302
232 iso_pu_bacteria 2968138860 2968144743 302
233 iso_pu_bacteria 2970469710 2970476186 302
234 iso_pu_bacteria 2970489779 2970490841 302
235 iso_pu_bacteria 2970503327 2970510036 302
236 iso_pu_bacteria 2970510686 2970517311 302
237 iso_pu_bacteria 2970532167 2970534506 302
238 iso_pu_bacteria 2970547951 2970551951 302
239 iso_pu_bacteria 2970593180 2970594206 302
240 iso_pu_bacteria 2970619444 2970621884 302
241 iso_pu_bacteria 2970627176 2970631314 302
242 iso_pu_bacteria 2977821940 2977828614 302
243 iso_pu_bacteria 2977843712 2977844306 302
244 iso_pu_bacteria 2977851361 2977854349 302
245 iso_pu_bacteria 2977872689 2977874337 302
246 iso_pu_bacteria 2977898635 2977898783 302
247 iso_pu_bacteria 2977915119 2977915677 302
248 iso_pu_bacteria 2977922695 2977929537 302
249 iso_pu_bacteria 2977935797 2977938952 302
250 iso_pu_bacteria 2977942078 2977942429 302
251 iso_pu_bacteria 2977950692 2977953550 302
252 iso_pu_bacteria 2977957713 2977964943 302
253 iso_pu_bacteria 2977971508 2977975390 302
254 iso_pu_bacteria 2977986579 2977987995 302
255 iso_pu_bacteria 2979710463 2979712946 302
256 iso_pu_bacteria 2979764755 2979767627 302
257 iso_pu_bacteria 2979772303 2979778390 302
258 iso_pu_bacteria 2979793036 2979798301 302
259 iso_pu_bacteria 2979808191 2979814912 302
260 iso_pu_bacteria 2987636660 2987641831 302
261 iso_pu_bacteria 2987645492 2987649228 302
262 iso_pu_bacteria 2987652177 2987657878 302
263 iso_pu_bacteria 2987666974 2987673323 302
264 iso_pu_bacteria 2987673487 2987676485 302
265 iso_pu_bacteria 2996348954 2996354770 302
266 iso_pu_bacteria 2996386984 2996389824 302
267 iso_pu_bacteria 3004167301 3004173617 302
268 iso_pu_bacteria 3004195979 3004200075 302
269 iso_pu_bacteria 3004203850 3004209357 302
270 iso_pu_bacteria 3004211236 3004218390 302
271 iso_pu_bacteria 3004218560 3004219513 302
272 iso_pu_bacteria 3004232784 3004233712 302
273 iso_pu_bacteria 3004239961 3004245386 302
274 iso_pu_bacteria 3004248173 3004252168 302
275 iso_pu_bacteria 3004268573 3004269424 302
276 iso_pu_bacteria 3004275668 3004281418 302
277 iso_pu_bacteria 3004334049 3004336983 302
278 iso_pu_bacteria 637000159 637076691 302
279 iso_pu_bacteria 649633066 649870844 302
280 iso_pu_bacteria 8004300914 8004301664 302
281 iso_pu_bacteria 8004312739 8004316219 302
282 iso_pu_bacteria 8004361976 8004362591 302
283 iso_pu_bacteria 8004374579 8004381591 302
284 iso_pu_bacteria 8004387939 8004388682 302
285 iso_pu_bacteria 8004640170 8004646521 302
286 iso_pu_bacteria 8004695233 8004703074 302
287 iso_pu_bacteria 8004714634 8004715114 302
288 iso_pu_bacteria 8004727605 8004729353 302
289 3300003187 JGI25151J46595_10001032 JGI25151J46595_1000103219 303
290 3300003316 rootH1_10085515 rootH1_100855152 303
291 3300003775 Ga0055524_1000446 Ga0055524_100044632 303
292 3300003781 Ga0055536_1001554 Ga0055536_100155412 303
293 3300003791 Ga0055530_10010197 Ga0055530_100101973 303
294 3300003794 Ga0055531_10012128 Ga0055531_100121283 303
295 3300005577 Ga0068857_100063828 Ga0068857_1000638283 303
296 3300005616 Ga0068852_100001347 Ga0068852_1000013476 303
297 3300006186 Ga0075369_10021914 Ga0075369_100219144 303
298 3300009098 Ga0105245_10315034 Ga0105245_103150341 303
299 3300009545 Ga0105237_10348068 Ga0105237_103480682 303
300 3300010375 Ga0105239_10168379 Ga0105239_101683792 303
301 3300015265 Ga0182005_1003645 Ga0182005_10036453 303
302 3300021384 Ga0213876_10002743 Ga0213876_100027436 303
303 3300025245 Ga0207425_1010431 Ga0207425_10104311 303
304 3300025292 Ga0209676_1001945 Ga0209676_10019459 303
305 3300025294 Ga0209025_1002267 Ga0209025_10022677 303
306 3300025295 Ga0209564_1000341 Ga0209564_100034193 303
307 3300025298 Ga0209050_1006757 Ga0209050_10067573 303
308 3300025299 Ga0209256_1000286 Ga0209256_100028659 303
309 3300025299 Ga0209256_1000534 Ga0209256_10005349 303
310 3300025303 Ga0209051_1031230 Ga0209051_10312303 303
311 3300025304 Ga0209257_1004065 Ga0209257_10040656 303
312 3300025304 Ga0209257_1008947 Ga0209257_10089478 303
313 3300025914 Ga0207671_10267628 Ga0207671_102676282 303
314 3300026116 Ga0207674_10108167 Ga0207674_101081672 303
315 3300026142 Ga0207698_10000147 Ga0207698_1000014725 303
316 3300031616 Ga0307508_10029284 Ga0307508_100292847 303
317 3300037853 Ga0436364_0423603 Ga0436364_0423603_222_1142 303
318 3300039437 Ga0436365_1936450 Ga0436365_1936450_22762_23673 303
319 3300039447 Ga0436361_0105140 Ga0436361_0105140_725_1645 303
320 3300041413 Ga0439465_0070021 Ga0439465_0070021_131_1045 303
321 3300042004 Ga0439445_0010670 Ga0439445_0010670_603_1517 303
322 3300044656 Ga0466969_0078153 Ga0466969_0078153_13_924 303
323 3300044658 Ga0466972_0005564 Ga0466972_0005564_4034_4945 303
324 3300044694 Ga0466963_0091102 Ga0466963_0091102_381_1292 303
325 3300044706 Ga0466964_0002410 Ga0466964_0002410_5251_6162 303
326 3300044719 Ga0466971_0014285 Ga0466971_0014285_834_1745 303
327 3300044901 Ga0466960_0022865 Ga0466960_0022865_313_1224 303
328 3300045976 Ga0466967_0130739 Ga0466967_0130739_519_1430 303
329 3300049568 Ga0501031_0000007 Ga0501031_0000007_110459_111370 303
330 3300049569 Ga0501032_0000007 Ga0501032_0000007_54639_55550 303
331 3300049570 Ga0501033_0000040 Ga0501033_0000040_87037_87948 303
332 3300049571 Ga0501034_0000029 Ga0501034_0000029_198332_199243 303
333 3300049572 Ga0501036_0000004 Ga0501036_0000004_198332_199243 303
334 3300049573 Ga0501037_0000004 Ga0501037_0000004_54639_55550 303
335 3300049574 Ga0501038_0000005 Ga0501038_0000005_198332_199243 303
336 3300049575 Ga0501039_0000009 Ga0501039_0000009_198332_199243 303
337 3300049576 Ga0501040_0036028 Ga0501040_0036028_1252_2163 303
338 3300049579 Ga0501043_0000595 Ga0501043_0000595_26833_27744 303
339 3300049581 Ga0501047_0000895 Ga0501047_0000895_19299_20210 303
340 3300049586 Ga0501070_0009159 Ga0501070_0009159_3512_4423 303
341 3300049822 Ga0501035_0000014 Ga0501035_0000014_198332_199243 303
342 3300049822 Ga0501035_0484456 Ga0501035_0484456_25_936 303
343 3300049823 Ga0501044_0000012 Ga0501044_0000012_54639_55550 303
344 3300053153 Ga0500616_0034854 Ga0500616_0034854_1098_2009 303
345 3300061719 Ga0466962_0079603 Ga0466962_0079603_47_958 303
346 3300061719 Ga0466962_0184686 Ga0466962_0184686_60_971 303
347 iso_pu_bacteria 2503198000 2503200913 303
348 iso_pu_bacteria 2510065059 2510319608 303
349 iso_pu_bacteria 2513237090 2513611507 303
350 iso_pu_bacteria 2513237164 2514035301 303
351 iso_pu_bacteria 2847670302 2847674451 303
352 iso_pu_bacteria 2856314179 2856317633 303
353 iso_pu_bacteria 2856349417 2856356217 303
354 iso_pu_bacteria 2856356410 2856362616 303
355 iso_pu_bacteria 2871444079 2871446916 303
356 iso_pu_bacteria 2871488783 2871489152 303
357 iso_pu_bacteria 2878035449 2878038692 303
358 iso_pu_bacteria 2878753008 2878754626 303
359 iso_pu_bacteria 2881155292 2881160466 303
360 iso_pu_bacteria 2881845957 2881850837 303
361 iso_pu_bacteria 2881853255 2881857841 303
362 iso_pu_bacteria 2881861095 2881864899 303
363 iso_pu_bacteria 2882912400 2882917495 303
364 iso_pu_bacteria 2885318864 2885324293 303
365 iso_pu_bacteria 2885342637 2885346850 303
366 iso_pu_bacteria 2885350715 2885351547 303
367 iso_pu_bacteria 2903492973 2903495839 303
368 iso_pu_bacteria 2906328253 2906333440 303
369 iso_pu_bacteria 2906414383 2906417698 303
370 iso_pu_bacteria 2922158528 2922163766 303
371 iso_pu_bacteria 2924784321 2924790343 303
372 iso_pu_bacteria 2937822353 2937829427 303
373 iso_pu_bacteria 2937891427 2937898260 303
374 iso_pu_bacteria 2958115193 2958115994 303
375 iso_pu_bacteria 2961127735 2961134539 303
376 iso_pu_bacteria 2961170736 2961171280 303
377 iso_pu_bacteria 2965062239 2965067659 303
378 iso_pu_bacteria 2967996073 2967996214 303
379 iso_pu_bacteria 2968003550 2968004450 303
380 iso_pu_bacteria 2968091066 2968091589 303
381 iso_pu_bacteria 2968097103 2968097426 303
382 iso_pu_bacteria 2968128360 2968133440 303
383 iso_pu_bacteria 2970503327 2970503877 303
384 iso_pu_bacteria 2977821940 2977823843 303
385 iso_pu_bacteria 2977828996 2977834847 303
386 iso_pu_bacteria 2977858184 2977863100 303
387 iso_pu_bacteria 2979779861 2979783330 303
388 iso_pu_bacteria 2979808191 2979808510 303
389 iso_pu_bacteria 2996341866 2996342898 303
390 iso_pu_bacteria 3000135777 3000141526 303
391 iso_pu_bacteria 8004374579 8004376206 303
392 iso_pu_bacteria 8004445564 8004446721 303
393 iso_pu_bacteria 8004703790 8004704360 303
394 3300002067 JGI24735J21928_10022772 JGI24735J21928_100227722 304
395 3300003203 JGI25406J46586_10011914 JGI25406J46586_100119142 304
396 3300003316 rootH1_10031147 rootH1_100311476 304
397 3300003323 rootH1_10082485 rootH1_100824853 304
398 3300003323 rootH1_10244772 rootH1_102447722 304
399 3300005327 Ga0070658_10001698 Ga0070658_100016989 304
400 3300005331 Ga0070670_100000971 Ga0070670_10000097117 304
401 3300005339 Ga0070660_100189313 Ga0070660_1001893131 304
402 3300005339 Ga0070660_100276728 Ga0070660_1002767281 304
403 3300005344 Ga0070661_100008681 Ga0070661_1000086816 304
404 3300005355 Ga0070671_100293103 Ga0070671_1002931032 304
405 3300005366 Ga0070659_100085113 Ga0070659_1000851132 304
406 3300005366 Ga0070659_100341880 Ga0070659_1003418801 304
407 3300005455 Ga0070663_100197129 Ga0070663_1001971292 304
408 3300005457 Ga0070662_100140421 Ga0070662_1001404212 304
409 3300005468 Ga0070707_100104890 Ga0070707_1001048904 304
410 3300005539 Ga0068853_100005800 Ga0068853_1000058006 304
411 3300005539 Ga0068853_100070656 Ga0068853_1000706562 304
412 3300005539 Ga0068853_100088628 Ga0068853_1000886282 304
413 3300005548 Ga0070665_100303719 Ga0070665_1003037192 304
414 3300005563 Ga0068855_100225716 Ga0068855_1002257162 304
415 3300005578 Ga0068854_100066873 Ga0068854_1000668732 304
416 3300005614 Ga0068856_100005612 Ga0068856_1000056129 304
417 3300005614 Ga0068856_100243280 Ga0068856_1002432802 304
418 3300005616 Ga0068852_100042337 Ga0068852_1000423372 304
419 3300005616 Ga0068852_100097123 Ga0068852_1000971232 304
420 3300005616 Ga0068852_100162796 Ga0068852_1001627962 304
421 3300005834 Ga0068851_10105199 Ga0068851_101051993 304
422 3300005983 Ga0081540_1023776 Ga0081540_10237761 304
423 3300005985 Ga0081539_10000856 Ga0081539_100008562 304
424 3300006038 Ga0075365_10006556 Ga0075365_100065564 304
425 3300006177 Ga0075362_10028380 Ga0075362_100283801 304
426 3300006186 Ga0075369_10070717 Ga0075369_100707173 304
427 3300006353 Ga0075370_10125729 Ga0075370_101257292 304
428 3300007265 Ga0099794_10056169 Ga0099794_100561692 304
429 3300009093 Ga0105240_10050254 Ga0105240_100502542 304
430 3300009093 Ga0105240_10565715 Ga0105240_105657151 304
431 3300009174 Ga0105241_10178853 Ga0105241_101788532 304
432 3300009545 Ga0105237_10116882 Ga0105237_101168822 304
433 3300009545 Ga0105237_10508384 Ga0105237_105083842 304
434 3300009551 Ga0105238_10003959 Ga0105238_100039594 304
435 3300009551 Ga0105238_10285082 Ga0105238_102850822 304
436 3300010375 Ga0105239_10028999 Ga0105239_100289992 304
437 3300010375 Ga0105239_10040433 Ga0105239_100404335 304
438 3300013102 Ga0157371_10001278 Ga0157371_100012787 304
439 3300013104 Ga0157370_10069127 Ga0157370_100691272 304
440 3300013105 Ga0157369_10033621 Ga0157369_100336215 304
441 3300013307 Ga0157372_10018028 Ga0157372_100180282 304
442 3300013307 Ga0157372_10075963 Ga0157372_100759633 304
443 3300013307 Ga0157372_10257094 Ga0157372_102570942 304
444 3300025904 Ga0207647_10189670 Ga0207647_101896701 304
445 3300025911 Ga0207654_10179118 Ga0207654_101791182 304
446 3300025913 Ga0207695_10114643 Ga0207695_101146432 304
447 3300025914 Ga0207671_10016840 Ga0207671_100168404 304
448 3300025919 Ga0207657_10010574 Ga0207657_100105748 304
449 3300025924 Ga0207694_10312244 Ga0207694_103122441 304
450 3300025925 Ga0207650_10013560 Ga0207650_100135604 304
451 3300025925 Ga0207650_10053951 Ga0207650_100539511 304
452 3300025933 Ga0207706_10034615 Ga0207706_100346153 304
453 3300025949 Ga0207667_10009154 Ga0207667_100091549 304
454 3300025981 Ga0207640_10066824 Ga0207640_100668242 304
455 3300026041 Ga0207639_10017655 Ga0207639_100176553 304
456 3300026067 Ga0207678_10145300 Ga0207678_101453002 304
457 3300026078 Ga0207702_10041788 Ga0207702_100417883 304
458 3300026078 Ga0207702_10072661 Ga0207702_100726613 304
459 3300026116 Ga0207674_10112873 Ga0207674_101128734 304
460 3300026142 Ga0207698_10018436 Ga0207698_100184364 304
461 3300026142 Ga0207698_10080185 Ga0207698_100801852 304
462 3300028379 Ga0268266_10166193 Ga0268266_101661932 304
463 3300028800 Ga0265338_10007705 Ga0265338_100077059 304
464 3300031241 Ga0265325_10099315 Ga0265325_100993151 304
465 3300031249 Ga0265339_10007319 Ga0265339_100073198 304
466 3300031344 Ga0265316_10050595 Ga0265316_100505953 304
467 3300031595 Ga0265313_10000962 Ga0265313_1000096219 304
468 3300031712 Ga0265342_10013432 Ga0265342_100134326 304
469 3300037312 Ga0395899_0059696 Ga0395899_0059696_738_1652 304
470 3300037418 Ga0395900_0036416 Ga0395900_0036416_580_1503 304
471 3300037418 Ga0395900_0084846 Ga0395900_0084846_993_1907 304
472 3300037418 Ga0395900_0200039 Ga0395900_0200039_995_1918 304
473 3300037418 Ga0395900_0403026 Ga0395900_0403026_337_1251 304
474 3300037471 Ga0395905_0054524 Ga0395905_0054524_2253_3176 304
475 3300038443 Ga0395901_0050835 Ga0395901_0050835_3021_3944 304
476 3300038443 Ga0395901_0182738 Ga0395901_0182738_631_1545 304
477 3300038443 Ga0395901_0218982 Ga0395901_0218982_977_1900 304
478 3300048915 Ga0496112_0152570 Ga0496112_0152570_817_1740 304
479 3300048915 Ga0496112_0309209 Ga0496112_0309209_118_1041 304
480 3300049571 Ga0501034_0158179 Ga0501034_0158179_1268_2197 304
481 3300049586 Ga0501070_0089590 Ga0501070_0089590_45_995 304
482 3300049742 Ga0501080_0234267 Ga0501080_0234267_188_1102 304
483 3300050492 nmdc:mga0yw44_991_c1 nmdc:mga0yw44_991_c1_6027_6950 304
484 3300050516 nmdc:mga0sz30_74010_c1 nmdc:mga0sz30_74010_c1_217_1140 304
485 3300001989 JGI24739J22299_10000830 JGI24739J22299_100008308 305
486 3300001990 JGI24737J22298_10000132 JGI24737J22298_1000013216 305
487 3300002067 JGI24735J21928_10000391 JGI24735J21928_100003913 305
488 3300002075 JGI24738J21930_10000059 JGI24738J21930_100000597 305
489 3300005328 Ga0070676_10129304 Ga0070676_101293041 305
490 3300005347 Ga0070668_100239462 Ga0070668_1002394622 305
491 3300005356 Ga0070674_100174998 Ga0070674_1001749982 305
492 3300005367 Ga0070667_100038222 Ga0070667_1000382223 305
493 3300005548 Ga0070665_100032675 Ga0070665_1000326756 305
494 3300005548 Ga0070665_100412690 Ga0070665_1004126901 305
495 3300009093 Ga0105240_10725569 Ga0105240_107255691 305
496 3300013307 Ga0157372_10034402 Ga0157372_100344022 305
497 3300025904 Ga0207647_10003232 Ga0207647_100032329 305
498 3300025937 Ga0207669_10148512 Ga0207669_101485121 305
499 3300025972 Ga0207668_10098939 Ga0207668_100989392 305
500 3300026088 Ga0207641_10453533 Ga0207641_104535332 305
501 3300026121 Ga0207683_10183450 Ga0207683_101834501 305
502 3300028379 Ga0268266_10016459 Ga0268266_100164597 305
503 3300028379 Ga0268266_10229632 Ga0268266_102296322 305
504 3300028794 Ga0307515_10000136 Ga0307515_1000013641 305
505 3300031239 Ga0265328_10081916 Ga0265328_100819162 305
506 3300031241 Ga0265325_10135433 Ga0265325_101354331 305
507 3300031247 Ga0265340_10001823 Ga0265340_1000182311 305
508 3300031247 Ga0265340_10027040 Ga0265340_100270403 305
509 3300031456 Ga0307513_10000302 Ga0307513_100003025 305
510 3300031595 Ga0265313_10000517 Ga0265313_1000051733 305
511 3300031711 Ga0265314_10072044 Ga0265314_100720442 305
512 3300042438 Ga0439459_0008243 Ga0439459_0008243_747_1664 305
513 3300046460 Ga0495638_0005109 Ga0495638_0005109_6345_7388 305
514 3300048910 Ga0496107_0148972 Ga0496107_0148972_263_1180 305
515 3300049574 Ga0501038_0280658 Ga0501038_0280658_106_1032 305
516 3300049581 Ga0501047_0009318 Ga0501047_0009318_7148_8245 305
517 3300049584 Ga0501068_0068209 Ga0501068_0068209_240_1337 305
518 3300049589 Ga0501073_0242036 Ga0501073_0242036_284_1210 305
519 3300049742 Ga0501080_0056593 Ga0501080_0056593_1212_2225 305
520 3300049822 Ga0501035_0058448 Ga0501035_0058448_1070_2083 305
521 3300049823 Ga0501044_0137621 Ga0501044_0137621_1166_2263 305
522 3300049823 Ga0501044_0324093 Ga0501044_0324093_194_1120 305
523 3300053139 Ga0500568_0000090 Ga0500568_0000090_37556_38542 305
524 3300053153 Ga0500616_0061017 Ga0500616_0061017_43_960 305
525 3300053158 Ga0500627_0027361 Ga0500627_0027361_33_1040 305
526 3300001979 JGI24740J21852_10005086 JGI24740J21852_100050865 306
527 3300001989 JGI24739J22299_10025680 JGI24739J22299_100256802 306
528 3300002705 JGI25156J39149_1011851 JGI25156J39149_10118512 306
529 3300002741 JGI25157J39369_1001275 JGI25157J39369_10012754 306
530 3300003214 JGI25165J46597_1000052 JGI25165J46597_1000052200 306
531 3300003762 Ga0055542_1003407 Ga0055542_10034071 306
532 3300005539 Ga0068853_100027777 Ga0068853_1000277774 306
533 3300005539 Ga0068853_100033210 Ga0068853_1000332102 306
534 3300005563 Ga0068855_100479266 Ga0068855_1004792662 306
535 3300005577 Ga0068857_100364118 Ga0068857_1003641182 306
536 3300005616 Ga0068852_100101836 Ga0068852_1001018361 306
537 3300006038 Ga0075365_10005336 Ga0075365_100053363 306
538 3300006038 Ga0075365_10026350 Ga0075365_100263504 306
539 3300006042 Ga0075368_10063136 Ga0075368_100631362 306
540 3300006051 Ga0075364_10037397 Ga0075364_100373973 306
541 3300006051 Ga0075364_10090070 Ga0075364_100900702 306
542 3300006178 Ga0075367_10008182 Ga0075367_100081825 306
543 3300006178 Ga0075367_10089619 Ga0075367_100896193 306
544 3300006353 Ga0075370_10063493 Ga0075370_100634933 306
545 3300009098 Ga0105245_10512200 Ga0105245_105122001 306
546 3300009174 Ga0105241_10109587 Ga0105241_101095872 306
547 3300009545 Ga0105237_10172351 Ga0105237_101723513 306
548 3300009545 Ga0105237_10199150 Ga0105237_101991502 306
549 3300009551 Ga0105238_10353586 Ga0105238_103535861 306
550 3300010375 Ga0105239_10083930 Ga0105239_100839305 306
551 3300013306 Ga0163162_10914421 Ga0163162_109144211 306
552 3300015262 Ga0182007_10031121 Ga0182007_100311212 306
553 3300025250 Ga0209026_1000071 Ga0209026_1000071166 306
554 3300025254 Ga0209148_1000111 Ga0209148_1000111190 306
555 3300025261 Ga0209233_1000118 Ga0209233_100011866 306
556 3300025272 Ga0209455_1000223 Ga0209455_100022361 306
557 3300025297 Ga0209758_1005653 Ga0209758_10056536 306
558 3300025909 Ga0207705_10178394 Ga0207705_101783941 306
559 3300025911 Ga0207654_10054425 Ga0207654_100544253 306
560 3300025914 Ga0207671_10038262 Ga0207671_100382624 306
561 3300025924 Ga0207694_10031413 Ga0207694_100314131 306
562 3300025924 Ga0207694_10218278 Ga0207694_102182781 306
563 3300025932 Ga0207690_10092469 Ga0207690_100924692 306
564 3300025981 Ga0207640_10104833 Ga0207640_101048332 306
565 3300026041 Ga0207639_10330222 Ga0207639_103302221 306
566 3300026041 Ga0207639_10410179 Ga0207639_104101791 306
567 3300026067 Ga0207678_10336556 Ga0207678_103365561 306
568 3300026078 Ga0207702_10334884 Ga0207702_103348841 306
569 3300026116 Ga0207674_10164418 Ga0207674_101644182 306
570 3300026142 Ga0207698_10731776 Ga0207698_107317761 306
571 3300028379 Ga0268266_10081626 Ga0268266_100816263 306
572 3300028379 Ga0268266_10556051 Ga0268266_105560511 306
573 3300031456 Ga0307513_10268005 Ga0307513_102680051 306
574 3300031616 Ga0307508_10232934 Ga0307508_102329341 306
575 3300031911 Ga0307412_10170186 Ga0307412_101701863 306
576 3300031995 Ga0307409_100162165 Ga0307409_1001621652 306
577 3300037418 Ga0395900_0424264 Ga0395900_0424264_192_1112 306
578 3300037471 Ga0395905_0103890 Ga0395905_0103890_1142_2062 306
579 3300037471 Ga0395905_0275237 Ga0395905_0275237_228_1148 306
580 3300038443 Ga0395901_0025851 Ga0395901_0025851_763_1683 306
581 3300042157 Ga0439458_0016468 Ga0439458_0016468_520_1440 306
582 3300046460 Ga0495638_0078893 Ga0495638_0078893_252_1172 306
583 3300046500 Ga0495596_0052652 Ga0495596_0052652_457_1377 306
584 3300046522 Ga0495643_0061015 Ga0495643_0061015_967_1887 306
585 3300047443 Ga0495687_077771 Ga0495687_077771_112_1032 306
586 3300047472 Ga0495686_0116637 Ga0495686_0116637_45_977 306
587 3300048091 Ga0495626_0051310 Ga0495626_0051310_841_1761 306
588 3300048916 Ga0496113_0179990 Ga0496113_0179990_364_1329 306
589 3300048921 Ga0496118_0048433 Ga0496118_0048433_1890_2810 306
590 3300048921 Ga0496118_0248221 Ga0496118_0248221_54_974 306
591 3300048923 Ga0496120_0002000 Ga0496120_0002000_2504_3424 306
592 3300048923 Ga0496120_0075732 Ga0496120_0075732_347_1267 306
593 3300048924 Ga0496121_0116293 Ga0496121_0116293_257_1177 306
594 3300048927 Ga0496124_0247241 Ga0496124_0247241_269_1189 306
595 3300048929 Ga0496126_0365601 Ga0496126_0365601_28_948 306
596 3300050491 nmdc:mga00v17_61964_c2 nmdc:mga00v17_61964_c2_337_1257 306
597 3300050492 nmdc:mga0yw44_41808_c1 nmdc:mga0yw44_41808_c1_1470_2390 306
598 3300050492 nmdc:mga0yw44_4386_c1 nmdc:mga0yw44_4386_c1_4467_5387 306
599 3300050492 nmdc:mga0yw44_5848_c1 nmdc:mga0yw44_5848_c1_4367_5287 306
600 3300050494 nmdc:mga06z11_30788_c1 nmdc:mga06z11_30788_c1_531_1451 306
601 3300050494 nmdc:mga06z11_97431_c1 nmdc:mga06z11_97431_c1_451_1371 306
602 3300050496 nmdc:mga07m45_21285_c1 nmdc:mga07m45_21285_c1_2272_3192 306
603 3300053079 Ga0500610_0072575 Ga0500610_0072575_205_1125 306
604 3300053083 Ga0495655_0015618 Ga0495655_0015618_402_1322 306
605 3300053119 Ga0500595_013981 Ga0500595_013981_1876_2796 306
606 3300053155 Ga0500620_000076 Ga0500620_000076_2574_3494 306
607 iso_pu_bacteria 2888343758 2888344670 306
608 iso_pu_bacteria 2977828996 2977832595 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

29

287

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9721 5 298
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9633 2 298
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9535 7 304
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.944 7 304
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9221 2 298
ID Description Score Start End Superfamily
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9721 5 298 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9506 7 304 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9409 7 304 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.918 5 298 2.120.10.30
af_F1RAG3_871_1134_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8489 34 274 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A529SE60-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9971 157 262
AF-A0A2N7SAI7-F1-model_v4 deleted 0.9969 56 306
AF-A0A3S1HRK2-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9948 174 306 GO:0016787
AF-A0A7Y0DX53-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.993 25 302 GO:0016787
GO:0046872
AF-A0A2N7SAI7-F1-model_v4 deleted 0.9929 56 306

Feature Viewer

pLDDT pTM Quality
96.1 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map