F468802

General Info

Members Datasets Scaffolds Average Seq Length
608 259 574 319

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000226|Ga0395899_0000226_35783_36754
Length 323
Sequence MLAMKLANPFILNRADPFVGRHDGHYHFTASVPEYDRIILRRSATLEGLATAEEFVLWRAPASGAASALIWAPEIHRFEDAWYIYFAAAPSRDIKDGLFQHRMYALRNPAADPTTGEWQFVGQVDSGIDAFCLDATSFRHRGQNYYVWAQKHPDIPGNSNLYIAPLATPTTLAAAPVLLTRPELDWEVQGFAVNEGPAVLIRHGKVFITYSASATDERYAMGLLWADAEADLLDARNWHKSPTPVFVTDVERQVFGPGHNSFTVDGDTDLMIYHARDYREIEGDPLWNADRHARVHLLSWDAQGMPVFGRPQREVEWSAGVTA

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2643221684 Massilia sp. Root133 Isolate Unclassified
8 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
9 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
10 2738541280 Massilia sp. GV090 Isolate Unclassified
11 2738541297 Duganella sp. GV083 Isolate Unclassified
12 2738541300 Massilia sp. GV016 Isolate Unclassified
13 2738541357 Duganella sp. GV053 Isolate Unclassified
14 2738543003 Duganella sp. GV066 Isolate Unclassified
15 2738543018 Massilia sp. GV045 Isolate Unclassified
16 2738543026 Duganella sp. GV089 Isolate Unclassified
17 2738543029 Duganella sp. GV039 Isolate Unclassified
18 2738543030 Massilia sp. GV097 Isolate Unclassified
19 2842711865 Duganella sp. R-73148 Isolate Unclassified
20 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
21 2857553236 Duganella sp. R-74557 Isolate Unclassified
22 2857564685 Duganella sp. R-74599 Isolate Unclassified
23 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
24 2904424332 Duganella sp. 1411 Isolate Rhizosphere
25 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
26 2919476304 Duganella sp. 3397 Isolate Unclassified
27 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
28 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
29 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
30 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
31 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
32 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
33 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
34 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
35 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
36 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
41 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
42 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
43 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
49 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
50 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
51 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
52 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
53 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
56 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
57 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
58 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
59 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
129 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
148 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
244 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
247 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
248 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
249 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
250 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
251 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
255 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
256 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
257 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
259 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0.66
Isolates 5.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.05
Nodule 0.66
Rhizoplane 1.81
Rhizosphere 65.13
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1003241 3300002705 Bacteria 5417
2 JGI25156J39149_1007056 3300002705 Bacteria 3001
3 JGI25162J39368_1003969 3300002737 Bacteria 3768
4 JGI25154J39366_1000503 3300002738 Bacteria 19923
5 JGI25154J39366_1004732 3300002738 Bacteria 2344
6 JGI25158J39367_1004471 3300002739 Bacteria 2099
7 JGI25157J39369_1000256 3300002741 Bacteria 39240
8 JGI25157J39369_1002177 3300002741 Bacteria 5417
9 JGI25164J39214_1000064 3300002772 Bacteria 107073
10 JGI25152J39213_1000026 3300002773 Bacteria 101759
11 JGI25152J39213_1004392 3300002773 Bacteria 4451
12 JGI25150J39212_1000478 3300002774 Bacteria 16992
13 JGI25150J39212_1004201 3300002774 Bacteria 3241
14 JGI25150J39212_1005449 3300002774 Bacteria 2713
15 JGI25159J45721_1000676 3300002987 Bacteria 15043
16 JGI25159J45721_1002470 3300002987 Bacteria 7008
17 JGI25159J45721_1014739 3300002987 Bacteria 1747
18 JGI25165J46597_1000278 3300003214 Bacteria 65807
19 rootH1_10015702 3300003316 Bacteria 7606
20 rootH2_10011530 3300003320 Bacteria 1147
21 rootL2_10001989 3300003322 Bacteria 3909
22 rootL2_10002151 3300003322 Bacteria 70803
23 rootL2_10070531 3300003322 Bacteria 7438
24 rootL2_10136594 3300003322 Bacteria 10983
25 rootH1_10002339 3300003323 Bacteria 35435
26 rootH1_10042111 3300003323 Bacteria 8238
27 rootH1_10069919 3300003323 Bacteria 7127
28 rootH1_10126298 3300003323 Bacteria 3360
29 JGI25160J50197_1006539 3300003354 Bacteria 4702
30 JGI25161J50226_1000201 3300003374 Bacteria 39071
31 JGI25161J50226_1004252 3300003374 Bacteria 3040
32 Ga0055539_1007205 3300003752 Bacteria 1411
33 Ga0055533_1006262 3300003756 Bacteria 1779
34 Ga0055533_1008429 3300003756 Bacteria 1306
35 Ga0055525_1000006 3300003759 Bacteria 642912
36 Ga0055525_1000043 3300003759 Bacteria 268656
37 Ga0055527_1000305 3300003760 Bacteria 27630
38 Ga0055527_1000393 3300003760 Bacteria 18682
39 Ga0055527_1001316 3300003760 Bacteria 5369
40 Ga0055535_1000652 3300003761 Bacteria 27630
41 Ga0055535_1000974 3300003761 Bacteria 18682
42 Ga0055542_1000393 3300003762 Bacteria 43699
43 Ga0055542_1000672 3300003762 Bacteria 27630
44 Ga0055542_1000970 3300003762 Bacteria 18685
45 Ga0055529_1000032 3300003763 Bacteria 255895
46 Ga0055529_1000409 3300003763 Bacteria 45120
47 Ga0055529_1000620 3300003763 Bacteria 26580
48 Ga0055529_1000818 3300003763 Bacteria 18682
49 Ga0055526_1000018 3300003771 Bacteria 198838
50 Ga0055526_1000053 3300003771 Bacteria 114820
51 Ga0055526_1003053 3300003771 Bacteria 10879
52 Ga0055526_1018147 3300003771 Bacteria 2642
53 Ga0055537_1000027 3300003773 Bacteria 102244
54 Ga0055537_1006491 3300003773 Bacteria 2956
55 Ga0055524_1002546 3300003775 Bacteria 9318
56 Ga0055524_1002925 3300003775 Bacteria 8521
57 Ga0055524_1003014 3300003775 Bacteria 8346
58 Ga0055524_1003992 3300003775 Bacteria 6961
59 Ga0055534_1000051 3300003784 Bacteria 92183
60 Ga0055528_1000731 3300003790 Bacteria 23155
61 Ga0055528_1019049 3300003790 Bacteria 2296
62 Ga0055530_10002749 3300003791 Bacteria 10883
63 Ga0055531_10000025 3300003794 Bacteria 161475
64 Ga0055531_10002488 3300003794 Bacteria 12289
65 Ga0055531_10048507 3300003794 Bacteria 1144
66 Ga0055543_1000103 3300004625 Bacteria 73828
67 Ga0065165_1001082 3300005262 Bacteria 32470
68 Ga0065165_1001148 3300005262 Bacteria 30990
69 Ga0070658_10043212 3300005327 Bacteria 3641
70 Ga0070658_10095341 3300005327 Bacteria 2456
71 Ga0070660_100006208 3300005339 Bacteria 8271
72 Ga0070660_100013161 3300005339 Bacteria 5929
73 Ga0070660_100063787 3300005339 Bacteria 2864
74 Ga0070659_100024228 3300005366 Bacteria 4651
75 Ga0070659_100063112 3300005366 Bacteria 2930
76 Ga0070662_100126404 3300005457 Bacteria 1966
77 Ga0070662_100353923 3300005457 Bacteria 1204
78 Ga0068855_100065376 3300005563 Bacteria 4240
79 Ga0070664_100106815 3300005564 Bacteria 2439
80 Ga0068865_100430674 3300006881 Bacteria 1087
81 Ga0099823_1000046 3300006944 Bacteria 60074
82 Ga0079104_1024665 3300006946 Bacteria 1580
83 Ga0105244_10001201 3300009036 Bacteria 21301
84 Ga0105244_10040268 3300009036 Bacteria 2428
85 Ga0105243_10011176 3300009148 Bacteria 6791
86 Ga0105241_10016143 3300009174 Bacteria 5474
87 Ga0105242_10011548 3300009176 Bacteria 6793
88 Ga0105242_10584387 3300009176 Bacteria 1076
89 Ga0157371_10000014 3300013102 Bacteria 347490
90 Ga0157369_10319743 3300013105 Bacteria 1613
91 Ga0157374_10346819 3300013296 Bacteria 1475
92 Ga0157378_10204432 3300013297 Bacteria 1870
93 Ga0157372_10318841 3300013307 Bacteria 1810
94 Ga0182008_10001070 3300014497 Bacteria 18895
95 Ga0182006_1000007 3300015261 Bacteria 452190
96 Ga0182006_1000040 3300015261 Bacteria 209209
97 Ga0182007_10000068 3300015262 Bacteria 82301
98 Ga0182005_1000010 3300015265 Bacteria 434103
99 Ga0182005_1000051 3300015265 Bacteria 114808
100 Ga0163161_10191791 3300017792 Bacteria 1571
101 Ga0213872_10000040 3300021361 Bacteria 122419
102 Ga0213872_10052139 3300021361 Bacteria 1856
103 Ga0209436_100301 3300025208 Bacteria 22729
104 Ga0209436_103138 3300025208 Bacteria 4539
105 Ga0209674_100059 3300025226 Bacteria 282517
106 Ga0209674_102211 3300025226 Bacteria 4316
107 Ga0209672_100004 3300025228 Bacteria 1467504
108 Ga0209672_100008 3300025228 Bacteria 946876
109 Ga0209672_100121 3300025228 Bacteria 83609
110 Ga0209563_100022 3300025230 Bacteria 643318
111 Ga0209563_100036 3300025230 Bacteria 448275
112 Ga0207427_100037 3300025231 Bacteria 303108
113 Ga0209437_100213 3300025233 Bacteria 107087
114 Ga0209258_100003 3300025242 Bacteria 1467504
115 Ga0209258_100004 3300025242 Bacteria 1376422
116 Ga0209258_100008 3300025242 Bacteria 1009355
117 Ga0209258_100106 3300025242 Bacteria 206622
118 Ga0207425_1000017 3300025245 Bacteria 423851
119 Ga0207425_1000085 3300025245 Bacteria 95577
120 Ga0207425_1000326 3300025245 Bacteria 33697
121 Ga0207425_1008410 3300025245 Bacteria 2645
122 Ga0209646_1000051 3300025246 Bacteria 296525
123 Ga0209646_1001473 3300025246 Bacteria 6272
124 Ga0209026_1000045 3300025250 Bacteria 263431
125 Ga0209026_1003347 3300025250 Bacteria 5321
126 Ga0209026_1015914 3300025250 Bacteria 1226
127 Ga0209677_101205 3300025253 Bacteria 11774
128 Ga0209677_102629 3300025253 Bacteria 6527
129 Ga0209677_107599 3300025253 Bacteria 2266
130 Ga0209148_1000025 3300025254 Bacteria 663262
131 Ga0209148_1000042 3300025254 Bacteria 464111
132 Ga0209148_1000053 3300025254 Bacteria 373506
133 Ga0209148_1000678 3300025254 Bacteria 28482
134 Ga0209759_1000185 3300025256 Bacteria 100505
135 Ga0209759_1000212 3300025256 Bacteria 89756
136 Ga0209129_1000162 3300025258 Bacteria 101248
137 Ga0209233_1000096 3300025261 Bacteria 303482
138 Ga0209565_1000017 3300025263 Bacteria 462438
139 Ga0209565_1000452 3300025263 Bacteria 31667
140 Ga0209565_1002359 3300025263 Bacteria 6878
141 Ga0209565_1002832 3300025263 Bacteria 5971
142 Ga0209565_1020281 3300025263 Bacteria 1405
143 Ga0209455_1000004 3300025272 Bacteria 1467504
144 Ga0209455_1000007 3300025272 Bacteria 1157983
145 Ga0209455_1000016 3300025272 Bacteria 753097
146 Ga0209455_1000043 3300025272 Bacteria 413928
147 Ga0209673_1000007 3300025273 Bacteria 634477
148 Ga0209673_1015546 3300025273 Bacteria 2884
149 Ga0209130_1000078 3300025284 Bacteria 169374
150 Ga0209130_1000188 3300025284 Bacteria 86963
151 Ga0209130_1008273 3300025284 Bacteria 3088
152 Ga0209675_1000009 3300025291 Bacteria 562872
153 Ga0209675_1002209 3300025291 Bacteria 10181
154 Ga0209675_1010711 3300025291 Bacteria 3106
155 Ga0209025_1024135 3300025294 Bacteria 3152
156 Ga0209564_1000011 3300025295 Bacteria 822327
157 Ga0209564_1000036 3300025295 Bacteria 423455
158 Ga0209564_1000055 3300025295 Bacteria 343782
159 Ga0209564_1000068 3300025295 Bacteria 311171
160 Ga0209564_1000343 3300025295 Bacteria 89036
161 Ga0209564_1002854 3300025295 Bacteria 12705
162 Ga0209564_1011336 3300025295 Bacteria 4006
163 Ga0209758_1000250 3300025297 Bacteria 109992
164 Ga0209758_1001409 3300025297 Bacteria 28501
165 Ga0209050_1000316 3300025298 Bacteria 98257
166 Ga0209050_1000612 3300025298 Bacteria 56207
167 Ga0209050_1001361 3300025298 Bacteria 26758
168 Ga0209050_1001479 3300025298 Bacteria 25051
169 Ga0209050_1001484 3300025298 Bacteria 24939
170 Ga0209050_1015304 3300025298 Bacteria 3230
171 Ga0209256_1000167 3300025299 Bacteria 133419
172 Ga0209256_1000184 3300025299 Bacteria 121336
173 Ga0209256_1000841 3300025299 Bacteria 38507
174 Ga0209256_1003010 3300025299 Bacteria 12470
175 Ga0209256_1006853 3300025299 Bacteria 5857
176 Ga0207426_1007269 3300025302 Bacteria 4662
177 Ga0207426_1025391 3300025302 Bacteria 1995
178 Ga0209051_1000869 3300025303 Bacteria 30576
179 Ga0209051_1005230 3300025303 Bacteria 7663
180 Ga0209257_1000032 3300025304 Bacteria 680354
181 Ga0209257_1000123 3300025304 Bacteria 219092
182 Ga0209257_1003015 3300025304 Bacteria 15235
183 Ga0207705_10027711 3300025909 Bacteria 4041
184 Ga0207705_10141331 3300025909 Bacteria 1798
185 Ga0207695_10212725 3300025913 Bacteria 1843
186 Ga0207657_10005165 3300025919 Bacteria 13694
187 Ga0207649_10077810 3300025920 Bacteria 2138
188 Ga0207690_10079757 3300025932 Bacteria 2282
189 Ga0207706_10067011 3300025933 Bacteria 3158
190 Ga0207686_10057360 3300025934 Bacteria 2451
191 Ga0207679_10076590 3300025945 Bacteria 2542
192 Ga0207667_10266283 3300025949 Bacteria 1752
193 Ga0207678_10477564 3300026067 Bacteria 1085
194 Ga0207702_10000654 3300026078 Bacteria 37703
195 Ga0209281_1005021 3300027111 Bacteria 3776
196 Ga0209389_1013868 3300027296 Bacteria 7326
197 Ga0265338_10000331 3300028800 Bacteria 85997
198 Ga0265338_10008840 3300028800 Bacteria 12153
199 Ga0316182_1011444 3300030745 Bacteria 1939
200 Ga0316182_1278328 3300030745 Bacteria 4284
201 Ga0307513_10403823 3300031456 Bacteria 1100
202 Ga0307408_100000092 3300031548 Bacteria 98953
203 Ga0307408_100000286 3300031548 Bacteria 50236
204 Ga0307408_100000419 3300031548 Bacteria 38162
205 Ga0307408_100003582 3300031548 Bacteria 10582
206 Ga0307408_100005970 3300031548 Bacteria 8110
207 Ga0307408_100021916 3300031548 Bacteria 4332
208 Ga0307408_100216164 3300031548 Bacteria 1561
209 Ga0307408_100364314 3300031548 Bacteria 1231
210 Ga0316576_10000921 3300031727 Bacteria 15034
211 Ga0316576_10040422 3300031727 Bacteria 3353
212 Ga0316576_10170457 3300031727 Bacteria 1643
213 Ga0316578_10050384 3300031728 Bacteria 2436
214 Ga0307518_10099607 3300031838 Bacteria 2082
215 Ga0307406_10028255 3300031901 Bacteria 3387
216 Ga0307409_100022485 3300031995 Bacteria 4349
217 Ga0307416_100197720 3300032002 Bacteria 1904
218 Ga0307416_100284591 3300032002 Bacteria 1632
219 Ga0307414_10061003 3300032004 Bacteria 2670
220 Ga0395899_0000226 3300037312 Bacteria 76657
221 Ga0395899_0000293 3300037312 Bacteria 64438
222 Ga0395899_0003754 3300037312 Bacteria 11998
223 Ga0395899_0214669 3300037312 Bacteria 1335
224 Ga0395900_0000011 3300037418 Bacteria 421926
225 Ga0395900_0010023 3300037418 Bacteria 9696
226 Ga0395900_0036179 3300037418 Bacteria 5088
227 Ga0395900_0186020 3300037418 Bacteria 2108
228 Ga0395900_0196590 3300037418 Bacteria 2042
229 Ga0395898_0000029 3300037466 Bacteria 370667
230 Ga0395898_0039140 3300037466 Bacteria 4694
231 Ga0395898_0251856 3300037466 Bacteria 1684
232 Ga0395905_0326109 3300037471 Bacteria 1425
233 Ga0395901_0000019 3300038443 Bacteria 317063
234 Ga0395901_0024509 3300038443 Bacteria 6193
235 Ga0436361_0424561 3300039447 Bacteria 11268
236 Ga0436361_0617438 3300039447 Bacteria 1668
237 Ga0436361_1177289 3300039447 Bacteria 9479
238 Ga0450890_000853 3300042127 Bacteria 4391
239 Ga0450891_002414 3300042129 Bacteria 1883
240 Ga0439446_0010941 3300042156 Bacteria 2454
241 Ga0439458_0028525 3300042157 Bacteria 1321
242 Ga0451577_0000642 3300042876 Bacteria 55654
243 Ga0466969_0047280 3300044656 Bacteria 2130
244 Ga0466972_0009564 3300044658 Bacteria 4866
245 Ga0466982_0066678 3300044672 Bacteria 2220
246 Ga0466965_0007237 3300044683 Bacteria 5086
247 Ga0466965_0015756 3300044683 Bacteria 3592
248 Ga0466965_0045762 3300044683 Bacteria 2165
249 Ga0466966_0006384 3300044684 Bacteria 7795
250 Ga0466966_0011051 3300044684 Bacteria 5993
251 Ga0466966_0126037 3300044684 Bacteria 1570
252 Ga0466961_0000272 3300044693 Bacteria 34599
253 Ga0466961_0000299 3300044693 Bacteria 32965
254 Ga0466961_0004718 3300044693 Bacteria 8574
255 Ga0466961_0013395 3300044693 Bacteria 5250
256 Ga0466961_0135886 3300044693 Bacteria 1540
257 Ga0466961_0175105 3300044693 Bacteria 1333
258 Ga0466964_0025245 3300044706 Bacteria 2319
259 Ga0466968_0004950 3300044735 Bacteria 4989
260 Ga0466970_0000201 3300044765 Bacteria 28963
261 Ga0466970_0012603 3300044765 Bacteria 4325
262 Ga0466957_0000104 3300044842 Bacteria 34466
263 Ga0466957_0067208 3300044842 Bacteria 2211
264 Ga0466957_0079841 3300044842 Bacteria 2036
265 Ga0466959_0000006 3300045049 Bacteria 192678
266 Ga0466959_0003643 3300045049 Bacteria 10159
267 Ga0466959_0077725 3300045049 Bacteria 2394
268 Ga0466959_0208225 3300045049 Bacteria 1359
269 Ga0451576_0000098 3300045051 Bacteria 220454
270 Ga0451576_0016173 3300045051 Bacteria 8242
271 Ga0466958_0032112 3300045836 Bacteria 3122
272 Ga0466958_0032623 3300045836 Bacteria 3099
273 Ga0466967_0150808 3300045976 Bacteria 2172
274 Ga0466967_0531929 3300045976 Bacteria 1156
275 Ga0495617_000003 3300046452 Bacteria 541914
276 Ga0495617_000208 3300046452 Bacteria 36937
277 Ga0495617_004548 3300046452 Bacteria 5027
278 Ga0495603_0012166 3300046455 Bacteria 5211
279 Ga0495590_0000001 3300046457 Bacteria 762984
280 Ga0495590_0001769 3300046457 Bacteria 9174
281 Ga0495590_0010308 3300046457 Bacteria 3518
282 Ga0495590_0025477 3300046457 Bacteria 2079
283 Ga0495590_0032711 3300046457 Bacteria 1819
284 Ga0495638_0006478 3300046460 Bacteria 8513
285 Ga0495653_0000002 3300046463 Bacteria 507262
286 Ga0495653_0013560 3300046463 Bacteria 6644
287 Ga0495650_0000001 3300046471 Bacteria 1085492
288 Ga0495650_0000072 3300046471 Bacteria 257886
289 Ga0495650_0000267 3300046471 Bacteria 100234
290 Ga0495650_0000427 3300046471 Bacteria 68283
291 Ga0495650_0004037 3300046471 Bacteria 10287
292 Ga0495650_0005248 3300046471 Bacteria 8492
293 Ga0495650_0046968 3300046471 Bacteria 1808
294 Ga0495605_0000065 3300046474 Bacteria 139441
295 Ga0495605_0000103 3300046474 Bacteria 105879
296 Ga0495605_0006806 3300046474 Bacteria 6530
297 Ga0495605_0009486 3300046474 Bacteria 5466
298 Ga0495605_0010607 3300046474 Bacteria 5152
299 Ga0495605_0013758 3300046474 Bacteria 4447
300 Ga0495605_0131119 3300046474 Bacteria 1130
301 Ga0495639_0023644 3300046475 Bacteria 2702
302 Ga0495584_0000009 3300046491 Bacteria 236318
303 Ga0495584_0000182 3300046491 Bacteria 44393
304 Ga0495584_0000904 3300046491 Bacteria 18948
305 Ga0495584_0006880 3300046491 Bacteria 5944
306 Ga0495584_0008198 3300046491 Bacteria 5425
307 Ga0495584_0011178 3300046491 Bacteria 4602
308 Ga0495584_0011989 3300046491 Bacteria 4432
309 Ga0495585_0000154 3300046492 Bacteria 73681
310 Ga0495585_0000260 3300046492 Bacteria 54082
311 Ga0495585_0000940 3300046492 Bacteria 24573
312 Ga0495585_0002583 3300046492 Bacteria 12807
313 Ga0495585_0007271 3300046492 Bacteria 6796
314 Ga0495585_0026872 3300046492 Bacteria 3286
315 Ga0495585_0041966 3300046492 Bacteria 2564
316 Ga0495585_0091316 3300046492 Bacteria 1639
317 Ga0495596_0010296 3300046500 Bacteria 4076
318 Ga0495596_0015031 3300046500 Bacteria 3251
319 Ga0495596_0018205 3300046500 Bacteria 2899
320 Ga0495596_0018821 3300046500 Bacteria 2843
321 Ga0495596_0128062 3300046500 Bacteria 985
322 Ga0495607_0000644 3300046501 Bacteria 33902
323 Ga0495607_0009099 3300046501 Bacteria 6751
324 Ga0495607_0034933 3300046501 Bacteria 3045
325 Ga0495607_0040486 3300046501 Bacteria 2774
326 Ga0495607_0060402 3300046501 Bacteria 2157
327 Ga0495583_0000008 3300046506 Bacteria 411092
328 Ga0495583_0000050 3300046506 Bacteria 213627
329 Ga0495583_0000064 3300046506 Bacteria 192380
330 Ga0495583_0000253 3300046506 Bacteria 88398
331 Ga0495583_0016130 3300046506 Bacteria 4028
332 Ga0495583_0018718 3300046506 Bacteria 3639
333 Ga0495583_0034199 3300046506 Bacteria 2437
334 Ga0495606_0000001 3300046507 Bacteria 592123
335 Ga0495606_0000030 3300046507 Bacteria 249484
336 Ga0495606_0000282 3300046507 Bacteria 88450
337 Ga0495606_0003624 3300046507 Bacteria 16227
338 Ga0495606_0005214 3300046507 Bacteria 12545
339 Ga0495606_0010442 3300046507 Bacteria 7708
340 Ga0495606_0024337 3300046507 Bacteria 4366
341 Ga0495610_0000003 3300046512 Bacteria 1203910
342 Ga0495610_0001826 3300046512 Bacteria 18503
343 Ga0495610_0009770 3300046512 Bacteria 6027
344 Ga0495610_0016720 3300046512 Bacteria 4211
345 Ga0495610_0041049 3300046512 Bacteria 2326
346 Ga0495616_0000012 3300046513 Bacteria 211342
347 Ga0495616_0000283 3300046513 Bacteria 41076
348 Ga0495616_0001100 3300046513 Bacteria 19247
349 Ga0495616_0006912 3300046513 Bacteria 6833
350 Ga0495616_0052135 3300046513 Bacteria 2037
351 Ga0495616_0055424 3300046513 Bacteria 1962
352 Ga0495616_0076573 3300046513 Bacteria 1607
353 Ga0495631_0000214 3300046518 Bacteria 39867
354 Ga0495631_0003192 3300046518 Bacteria 9024
355 Ga0495631_0007582 3300046518 Bacteria 5515
356 Ga0495631_0078034 3300046518 Bacteria 1429
357 Ga0495632_0000117 3300046519 Bacteria 81479
358 Ga0495632_0000151 3300046519 Bacteria 71855
359 Ga0495632_0000405 3300046519 Bacteria 40703
360 Ga0495632_0002250 3300046519 Bacteria 14864
361 Ga0495637_0000042 3300046520 Bacteria 114979
362 Ga0495643_0000028 3300046522 Bacteria 262886
363 Ga0495643_0000285 3300046522 Bacteria 72233
364 Ga0495643_0009345 3300046522 Bacteria 6097
365 Ga0495643_0018663 3300046522 Bacteria 4024
366 Ga0495643_0018836 3300046522 Bacteria 3999
367 Ga0495643_0083757 3300046522 Bacteria 1655
368 Ga0495643_0093325 3300046522 Bacteria 1550
369 Ga0495644_0026277 3300046523 Bacteria 2209
370 Ga0495648_0000001 3300046524 Bacteria 696872
371 Ga0495648_0000079 3300046524 Bacteria 126099
372 Ga0495648_0005786 3300046524 Bacteria 10197
373 Ga0495648_0014982 3300046524 Bacteria 5647
374 Ga0495648_0016643 3300046524 Bacteria 5292
375 Ga0495648_0023950 3300046524 Bacteria 4168
376 Ga0495648_0027847 3300046524 Bacteria 3775
377 Ga0495648_0033278 3300046524 Bacteria 3369
378 Ga0495648_0040219 3300046524 Bacteria 2967
379 Ga0495648_0058300 3300046524 Bacteria 2309
380 Ga0495642_0002229 3300046528 Bacteria 7934
381 Ga0495642_0002749 3300046528 Bacteria 7056
382 Ga0495642_0004777 3300046528 Bacteria 5240
383 Ga0495654_0000037 3300046530 Bacteria 188218
384 Ga0495654_0008463 3300046530 Bacteria 5681
385 Ga0495654_0009920 3300046530 Bacteria 5206
386 Ga0495654_0016392 3300046530 Bacteria 3920
387 Ga0495654_0040665 3300046530 Bacteria 2316
388 Ga0495654_0073473 3300046530 Bacteria 1617
389 Ga0495609_0000026 3300046538 Bacteria 251973
390 Ga0495609_0000241 3300046538 Bacteria 52185
391 Ga0495609_0001046 3300046538 Bacteria 19408
392 Ga0495609_0013197 3300046538 Bacteria 3906
393 Ga0495609_0015872 3300046538 Bacteria 3518
394 Ga0495609_0018079 3300046538 Bacteria 3270
395 Ga0495609_0064905 3300046538 Bacteria 1610
396 Ga0495597_0000073 3300046542 Bacteria 87767
397 Ga0495597_0000705 3300046542 Bacteria 26750
398 Ga0495597_0000864 3300046542 Bacteria 23742
399 Ga0495597_0004402 3300046542 Bacteria 7755
400 Ga0495597_0008100 3300046542 Bacteria 5287
401 Ga0495622_0000131 3300046557 Bacteria 64280
402 Ga0495622_0026719 3300046557 Bacteria 2694
403 Ga0495622_0030689 3300046557 Bacteria 2512
404 Ga0495633_0000055 3300046558 Bacteria 151013
405 Ga0495633_0000106 3300046558 Bacteria 113381
406 Ga0495633_0000675 3300046558 Bacteria 31481
407 Ga0495633_0013433 3300046558 Bacteria 4316
408 Ga0495633_0018016 3300046558 Bacteria 3593
409 Ga0495633_0018951 3300046558 Bacteria 3484
410 Ga0495656_0006356 3300046615 Bacteria 4142
411 Ga0495656_0049412 3300046615 Bacteria 1791
412 Ga0495656_0155497 3300046615 Bacteria 1108
413 Ga0495668_0000190 3300046616 Bacteria 91473
414 Ga0495668_0000565 3300046616 Bacteria 45559
415 Ga0495668_0001065 3300046616 Bacteria 29015
416 Ga0495668_0001873 3300046616 Bacteria 18839
417 Ga0495668_0002146 3300046616 Bacteria 16984
418 Ga0495668_0006874 3300046616 Bacteria 7376
419 Ga0495668_0013236 3300046616 Bacteria 4875
420 Ga0495668_0016126 3300046616 Bacteria 4346
421 Ga0495668_0019446 3300046616 Bacteria 3914
422 Ga0495611_0000151 3300046648 Bacteria 49625
423 Ga0495611_0018928 3300046648 Bacteria 2955
424 Ga0495611_0066432 3300046648 Bacteria 1644
425 Ga0495625_0000035 3300046660 Bacteria 224323
426 Ga0495625_0000391 3300046660 Bacteria 66888
427 Ga0495625_0002897 3300046660 Bacteria 17926
428 Ga0495625_0017011 3300046660 Bacteria 5702
429 Ga0495625_0023692 3300046660 Bacteria 4685
430 Ga0495625_0043513 3300046660 Bacteria 3256
431 Ga0495625_0076343 3300046660 Bacteria 2343
432 Ga0495625_0131621 3300046660 Bacteria 1694
433 Ga0495659_0000158 3300046664 Bacteria 30194
434 Ga0495659_0028445 3300046664 Bacteria 1934
435 Ga0495659_0041143 3300046664 Bacteria 1649
436 Ga0495661_0000152 3300046665 Bacteria 81192
437 Ga0495661_0000715 3300046665 Bacteria 32660
438 Ga0495661_0006925 3300046665 Bacteria 7925
439 Ga0495661_0008169 3300046665 Bacteria 7257
440 Ga0495661_0016799 3300046665 Bacteria 4840
441 Ga0495661_0103006 3300046665 Bacteria 1603
442 Ga0495588_0000139 3300046674 Bacteria 109955
443 Ga0495646_0046872 3300046680 Bacteria 2633
444 Ga0495669_0002681 3300046684 Bacteria 7287
445 Ga0495669_0021045 3300046684 Bacteria 2827
446 Ga0495670_0000114 3300046691 Bacteria 35822
447 Ga0495670_0006155 3300046691 Bacteria 5893
448 Ga0495670_0010977 3300046691 Bacteria 4452
449 Ga0495670_0088515 3300046691 Bacteria 1583
450 Ga0495671_0000010 3300046692 Bacteria 368641
451 Ga0495671_0002314 3300046692 Bacteria 12109
452 Ga0495671_0006896 3300046692 Bacteria 6517
453 Ga0495671_0007326 3300046692 Bacteria 6299
454 Ga0495671_0007720 3300046692 Bacteria 6103
455 Ga0495649_0035077 3300046694 Bacteria 2759
456 Ga0495649_0041820 3300046694 Bacteria 2505
457 Ga0495649_0042748 3300046694 Bacteria 2475
458 Ga0495649_0048270 3300046694 Bacteria 2313
459 Ga0495649_0065306 3300046694 Bacteria 1953
460 Ga0495649_0070323 3300046694 Bacteria 1876
461 Ga0495589_0000100 3300046794 Bacteria 83307
462 Ga0495589_0000101 3300046794 Bacteria 82583
463 Ga0495589_0037719 3300046794 Bacteria 2420
464 Ga0495589_0100712 3300046794 Bacteria 1398
465 Ga0495660_0000027 3300046810 Bacteria 254331
466 Ga0495660_0000335 3300046810 Bacteria 41632
467 Ga0495660_0001827 3300046810 Bacteria 13973
468 Ga0495660_0010965 3300046810 Bacteria 5266
469 Ga0495660_0020088 3300046810 Bacteria 3831
470 Ga0495660_0039111 3300046810 Bacteria 2635
471 Ga0495660_0041760 3300046810 Bacteria 2537
472 Ga0495660_0052366 3300046810 Bacteria 2217
473 Ga0495636_0003252 3300047318 Bacteria 6299
474 Ga0495636_0042115 3300047318 Bacteria 1896
475 Ga0495672_0000220 3300047320 Bacteria 81547
476 Ga0495672_0000221 3300047320 Bacteria 81255
477 Ga0495672_0002445 3300047320 Bacteria 17096
478 Ga0495672_0002802 3300047320 Bacteria 15553
479 Ga0495672_0007979 3300047320 Bacteria 7889
480 Ga0495680_0025635 3300047322 Bacteria 4876
481 Ga0495683_0000064 3300047323 Bacteria 112558
482 Ga0495683_0001336 3300047323 Bacteria 16464
483 Ga0495683_0032651 3300047323 Bacteria 2651
484 Ga0495687_000012 3300047443 Bacteria 391586
485 Ga0495687_000037 3300047443 Bacteria 252363
486 Ga0495687_000062 3300047443 Bacteria 176135
487 Ga0495687_000122 3300047443 Bacteria 119372
488 Ga0495687_003478 3300047443 Bacteria 11377
489 Ga0495677_0000014 3300047445 Bacteria 136236
490 Ga0495677_0003124 3300047445 Bacteria 6455
491 Ga0495677_0004220 3300047445 Bacteria 5539
492 Ga0495677_0032844 3300047445 Bacteria 1890
493 Ga0495679_001792 3300047446 Bacteria 11717
494 Ga0495679_004418 3300047446 Bacteria 6499
495 Ga0495685_000262 3300047447 Bacteria 18174
496 Ga0495685_001925 3300047447 Bacteria 6417
497 Ga0495673_0000003 3300047469 Bacteria 1491337
498 Ga0495673_0000016 3300047469 Bacteria 580643
499 Ga0495673_0000035 3300047469 Bacteria 316861
500 Ga0495673_0003607 3300047469 Bacteria 10132
501 Ga0495681_0000021 3300047470 Bacteria 166534
502 Ga0495681_0000246 3300047470 Bacteria 44798
503 Ga0495681_0006028 3300047470 Bacteria 8020
504 Ga0495681_0015183 3300047470 Bacteria 4367
505 Ga0495681_0024947 3300047470 Bacteria 3135
506 Ga0495686_0000047 3300047472 Bacteria 280086
507 Ga0495686_0007983 3300047472 Bacteria 7848
508 Ga0495686_0008813 3300047472 Bacteria 7348
509 Ga0495686_0096437 3300047472 Bacteria 1790
510 Ga0495686_0149193 3300047472 Bacteria 1374
511 Ga0495626_0000222 3300048091 Bacteria 67304
512 Ga0495626_0001784 3300048091 Bacteria 16276
513 Ga0495626_0008414 3300048091 Bacteria 5658
514 Ga0495626_0015604 3300048091 Bacteria 3883
515 Ga0495626_0089155 3300048091 Bacteria 1358
516 Ga0495626_0095110 3300048091 Bacteria 1305
517 Ga0495626_0137873 3300048091 Bacteria 1036
518 Ga0496102_0049277 3300048905 Bacteria 3831
519 Ga0496102_0147844 3300048905 Bacteria 2206
520 Ga0496103_0178087 3300048906 Bacteria 1366
521 Ga0496106_0030710 3300048909 Bacteria 4005
522 Ga0496108_0329777 3300048911 Bacteria 1331
523 Ga0496109_0199668 3300048912 Bacteria 1880
524 Ga0496110_0000026 3300048913 Bacteria 71385
525 Ga0496111_0041791 3300048914 Bacteria 3291
526 Ga0496111_0050164 3300048914 Bacteria 3009
527 Ga0496113_0001992 3300048916 Bacteria 11697
528 Ga0496117_0000005 3300048920 Bacteria 777468
529 Ga0496118_0000022 3300048921 Bacteria 438602
530 Ga0496120_0039174 3300048923 Bacteria 2799
531 Ga0496121_0004143 3300048924 Bacteria 19841
532 Ga0496121_0041960 3300048924 Bacteria 3988
533 Ga0496122_0001132 3300048925 Bacteria 45868
534 Ga0496122_0020696 3300048925 Bacteria 5926
535 Ga0496122_0025368 3300048925 Bacteria 5149
536 Ga0496122_0050365 3300048925 Bacteria 3177
537 Ga0496123_0003516 3300048926 Bacteria 17450
538 Ga0496123_0005149 3300048926 Bacteria 13318
539 Ga0496123_0006339 3300048926 Bacteria 11489
540 Ga0496124_0024602 3300048927 Bacteria 5470
541 Ga0496124_0084520 3300048927 Bacteria 2602
542 Ga0496124_0142299 3300048927 Bacteria 1891
543 Ga0496124_0162170 3300048927 Bacteria 1741
544 Ga0496126_0004427 3300048929 Bacteria 16812
545 Ga0495678_000002 3300049459 Bacteria 999613
546 Ga0495678_000029 3300049459 Bacteria 219803
547 Ga0495678_000045 3300049459 Bacteria 171880
548 Ga0495678_000663 3300049459 Bacteria 31565
549 Ga0495678_004929 3300049459 Bacteria 7540
550 Ga0495678_024725 3300049459 Bacteria 2589
551 Ga0495682_0000208 3300049460 Bacteria 47163
552 Ga0495682_0000628 3300049460 Bacteria 23643
553 Ga0495682_0071136 3300049460 Bacteria 1252
554 Ga0501311_001840 3300049527 Bacteria 1934
555 Ga0501316_003450 3300049532 Bacteria 1537
556 Ga0501335_000226 3300049551 Bacteria 3168
557 Ga0501034_0103678 3300049571 Bacteria 2838
558 Ga0501036_0156079 3300049572 Bacteria 1925
559 Ga0501198_009956 3300049649 Bacteria 1400
560 Ga0501207_007153 3300049654 Bacteria 1586
561 Ga0501217_015353 3300049661 Bacteria 1742
562 Ga0501222_003666 3300049662 Bacteria 2091
563 Ga0501227_002485 3300049665 Bacteria 4068
564 Ga0501227_003667 3300049665 Bacteria 3328
565 Ga0501240_007331 3300049673 Bacteria 1384
566 Ga0501249_002660 3300049679 Bacteria 3598
567 Ga0501269_000700 3300049766 Bacteria 5582
568 Ga0501279_004021 3300049775 Bacteria 1926
569 Ga0501035_0011980 3300049822 Bacteria 8021
570 Ga0501044_0588127 3300049823 Bacteria 1007
571 Ga0500594_0002831 3300053118 Bacteria 3784
572 Ga0500618_000068 3300053125 Bacteria 88668
573 Ga0500586_001379 3300053145 Bacteria 5117
574 Ga0587083_0004084 3300059505 Bacteria 1996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042156 Ga0439446_0010941 Ga0439446_0010941_851_1741 282
2 3300003323 rootH1_10126298 rootH1_101262982 295
3 3300046506 Ga0495583_0000008 Ga0495583_0000008_213917_214864 295
4 3300025250 Ga0209026_1015914 Ga0209026_10159142 298
5 3300003320 rootH2_10011530 rootH2_100115301 300
6 3300003323 rootH1_10069919 rootH1_100699193 300
7 3300046660 Ga0495625_0023692 Ga0495625_0023692_1937_2884 300
8 3300046507 Ga0495606_0000282 Ga0495606_0000282_33352_34338 302
9 3300046810 Ga0495660_0001827 Ga0495660_0001827_2334_3314 302
10 3300047472 Ga0495686_0008813 Ga0495686_0008813_1858_2838 302
11 3300049649 Ga0501198_009956 Ga0501198_009956_232_1182 304
12 iso_pu_bacteria 2643221554 2643789486 309
13 iso_pu_bacteria 2643221638 2644216057 309
14 iso_pu_bacteria 2643221645 2644251262 309
15 iso_pu_bacteria 2643221664 2644357529 309
16 iso_pu_bacteria 2690315857 2691331105 309
17 iso_pu_bacteria 2916178963 2916179111 309
18 iso_pu_bacteria 2919534386 2919534667 309
19 3300002739 JGI25158J39367_1004471 JGI25158J39367_10044712 310
20 3300002773 JGI25152J39213_1000026 JGI25152J39213_100002669 310
21 3300002773 JGI25152J39213_1004392 JGI25152J39213_10043922 310
22 3300002774 JGI25150J39212_1000478 JGI25150J39212_10004782 310
23 3300002774 JGI25150J39212_1005449 JGI25150J39212_10054493 310
24 3300002987 JGI25159J45721_1000676 JGI25159J45721_10006769 310
25 3300002987 JGI25159J45721_1014739 JGI25159J45721_10147392 310
26 3300003354 JGI25160J50197_1006539 JGI25160J50197_10065392 310
27 3300003374 JGI25161J50226_1000201 JGI25161J50226_100020135 310
28 3300003374 JGI25161J50226_1004252 JGI25161J50226_10042522 310
29 3300003771 Ga0055526_1003053 Ga0055526_10030538 310
30 3300003771 Ga0055526_1018147 Ga0055526_10181472 310
31 3300003773 Ga0055537_1006491 Ga0055537_10064912 310
32 3300003775 Ga0055524_1002546 Ga0055524_10025462 310
33 3300003775 Ga0055524_1003014 Ga0055524_10030146 310
34 3300003775 Ga0055524_1003992 Ga0055524_10039922 310
35 3300003790 Ga0055528_1019049 Ga0055528_10190492 310
36 3300003791 Ga0055530_10002749 Ga0055530_100027498 310
37 3300003794 Ga0055531_10048507 Ga0055531_100485071 310
38 3300004625 Ga0055543_1000103 Ga0055543_100010332 310
39 3300005262 Ga0065165_1001082 Ga0065165_10010822 310
40 3300025208 Ga0209436_100301 Ga0209436_10030119 310
41 3300025208 Ga0209436_103138 Ga0209436_1031383 310
42 3300025245 Ga0207425_1000017 Ga0207425_100001728 310
43 3300025245 Ga0207425_1000085 Ga0207425_100008522 310
44 3300025245 Ga0207425_1008410 Ga0207425_10084102 310
45 3300025258 Ga0209129_1000162 Ga0209129_100016267 310
46 3300025263 Ga0209565_1000452 Ga0209565_10004525 310
47 3300025263 Ga0209565_1002359 Ga0209565_10023594 310
48 3300025263 Ga0209565_1002832 Ga0209565_10028322 310
49 3300025284 Ga0209130_1000188 Ga0209130_100018853 310
50 3300025284 Ga0209130_1008273 Ga0209130_10082733 310
51 3300025291 Ga0209675_1002209 Ga0209675_10022097 310
52 3300025291 Ga0209675_1010711 Ga0209675_10107113 310
53 3300025295 Ga0209564_1000343 Ga0209564_100034362 310
54 3300025295 Ga0209564_1002854 Ga0209564_10028543 310
55 3300025295 Ga0209564_1011336 Ga0209564_10113363 310
56 3300025297 Ga0209758_1000250 Ga0209758_100025077 310
57 3300025298 Ga0209050_1000316 Ga0209050_100031658 310
58 3300025298 Ga0209050_1000612 Ga0209050_100061227 310
59 3300025298 Ga0209050_1001484 Ga0209050_10014846 310
60 3300025298 Ga0209050_1015304 Ga0209050_10153043 310
61 3300025299 Ga0209256_1000184 Ga0209256_100018467 310
62 3300025299 Ga0209256_1000841 Ga0209256_100084136 310
63 3300025299 Ga0209256_1003010 Ga0209256_10030103 310
64 3300025302 Ga0207426_1007269 Ga0207426_10072693 310
65 3300025304 Ga0209257_1000123 Ga0209257_1000123138 310
66 3300031548 Ga0307408_100000092 Ga0307408_10000009262 310
67 3300031548 Ga0307408_100003582 Ga0307408_1000035822 310
68 3300031548 Ga0307408_100005970 Ga0307408_1000059706 310
69 3300031548 Ga0307408_100216164 Ga0307408_1002161642 310
70 3300046471 Ga0495650_0004037 Ga0495650_0004037_2499_3434 310
71 3300046615 Ga0495656_0155497 Ga0495656_0155497_24_968 310
72 3300046616 Ga0495668_0000565 Ga0495668_0000565_41391_42335 310
73 3300048913 Ga0496110_0000026 Ga0496110_0000026_34905_35849 310
74 3300048914 Ga0496111_0041791 Ga0496111_0041791_631_1575 310
75 3300049527 Ga0501311_001840 Ga0501311_001840_313_1257 310
76 3300049665 Ga0501227_002485 Ga0501227_002485_188_1132 310
77 3300049665 Ga0501227_003667 Ga0501227_003667_474_1418 310
78 3300049775 Ga0501279_004021 Ga0501279_004021_274_1218 310
79 iso_pu_bacteria 2600255292 2601671312 310
80 iso_pu_bacteria 2738541297 2738829884 310
81 iso_pu_bacteria 2738541357 2739153680 310
82 iso_pu_bacteria 2738543003 2739195600 310
83 iso_pu_bacteria 2738543026 2739322076 310
84 iso_pu_bacteria 2738543029 2739340317 310
85 iso_pu_bacteria 2842711865 2842715518 310
86 iso_pu_bacteria 2857547612 2857548848 310
87 iso_pu_bacteria 2857564685 2857566937 310
88 iso_pu_bacteria 2885080285 2885080357 310
89 iso_pu_bacteria 2919497567 2919500168 310
90 iso_pu_bacteria 2919688452 2919691630 310
91 iso_pu_bacteria 2932410948 2932415456 310
92 iso_pu_bacteria 2932416698 2932421383 310
93 iso_pu_bacteria 8054357960 8054358010 310
94 3300002774 JGI25150J39212_1004201 JGI25150J39212_10042012 311
95 3300003322 rootL2_10001989 rootL2_100019892 311
96 3300003322 rootL2_10070531 rootL2_100705315 311
97 3300003322 rootL2_10136594 rootL2_101365941 311
98 3300003759 Ga0055525_1000006 Ga0055525_1000006533 311
99 3300003763 Ga0055529_1000032 Ga0055529_1000032230 311
100 3300003771 Ga0055526_1000053 Ga0055526_100005347 311
101 3300005327 Ga0070658_10043212 Ga0070658_100432124 311
102 3300005327 Ga0070658_10095341 Ga0070658_100953412 311
103 3300005339 Ga0070660_100006208 Ga0070660_1000062084 311
104 3300005339 Ga0070660_100013161 Ga0070660_1000131614 311
105 3300005339 Ga0070660_100063787 Ga0070660_1000637872 311
106 3300005366 Ga0070659_100024228 Ga0070659_1000242283 311
107 3300005366 Ga0070659_100063112 Ga0070659_1000631122 311
108 3300005457 Ga0070662_100126404 Ga0070662_1001264042 311
109 3300005457 Ga0070662_100353923 Ga0070662_1003539231 311
110 3300005563 Ga0068855_100065376 Ga0068855_1000653764 311
111 3300005564 Ga0070664_100106815 Ga0070664_1001068152 311
112 3300006881 Ga0068865_100430674 Ga0068865_1004306741 311
113 3300009148 Ga0105243_10011176 Ga0105243_100111766 311
114 3300009174 Ga0105241_10016143 Ga0105241_100161434 311
115 3300009176 Ga0105242_10011548 Ga0105242_100115487 311
116 3300009176 Ga0105242_10584387 Ga0105242_105843871 311
117 3300013102 Ga0157371_10000014 Ga0157371_10000014263 311
118 3300013105 Ga0157369_10319743 Ga0157369_103197432 311
119 3300013296 Ga0157374_10346819 Ga0157374_103468192 311
120 3300013297 Ga0157378_10204432 Ga0157378_102044322 311
121 3300013307 Ga0157372_10318841 Ga0157372_103188411 311
122 3300017792 Ga0163161_10191791 Ga0163161_101917912 311
123 3300025230 Ga0209563_100022 Ga0209563_100022531 311
124 3300025245 Ga0207425_1000326 Ga0207425_10003265 311
125 3300025253 Ga0209677_102629 Ga0209677_1026293 311
126 3300025254 Ga0209148_1000678 Ga0209148_10006785 311
127 3300025263 Ga0209565_1020281 Ga0209565_10202812 311
128 3300025272 Ga0209455_1000043 Ga0209455_1000043322 311
129 3300025294 Ga0209025_1024135 Ga0209025_10241352 311
130 3300025295 Ga0209564_1000011 Ga0209564_100001149 311
131 3300025297 Ga0209758_1001409 Ga0209758_10014095 311
132 3300025909 Ga0207705_10027711 Ga0207705_100277113 311
133 3300025909 Ga0207705_10141331 Ga0207705_101413312 311
134 3300025913 Ga0207695_10212725 Ga0207695_102127252 311
135 3300025919 Ga0207657_10005165 Ga0207657_100051654 311
136 3300025920 Ga0207649_10077810 Ga0207649_100778101 311
137 3300025932 Ga0207690_10079757 Ga0207690_100797572 311
138 3300025933 Ga0207706_10067011 Ga0207706_100670112 311
139 3300025934 Ga0207686_10057360 Ga0207686_100573602 311
140 3300025945 Ga0207679_10076590 Ga0207679_100765902 311
141 3300025949 Ga0207667_10266283 Ga0207667_102662832 311
142 3300026067 Ga0207678_10477564 Ga0207678_104775641 311
143 3300031548 Ga0307408_100364314 Ga0307408_1003643142 311
144 3300031995 Ga0307409_100022485 Ga0307409_1000224854 311
145 3300032002 Ga0307416_100197720 Ga0307416_1001977202 311
146 3300032002 Ga0307416_100284591 Ga0307416_1002845912 311
147 3300032004 Ga0307414_10061003 Ga0307414_100610031 311
148 3300037312 Ga0395899_0000293 Ga0395899_0000293_49128_50075 311
149 3300037312 Ga0395899_0003754 Ga0395899_0003754_9786_10742 311
150 3300037312 Ga0395899_0214669 Ga0395899_0214669_85_1119 311
151 3300037418 Ga0395900_0010023 Ga0395900_0010023_2662_3612 311
152 3300037418 Ga0395900_0036179 Ga0395900_0036179_85_1119 311
153 3300037418 Ga0395900_0186020 Ga0395900_0186020_612_1607 311
154 3300037418 Ga0395900_0196590 Ga0395900_0196590_163_1113 311
155 3300037466 Ga0395898_0039140 Ga0395898_0039140_213_1247 311
156 3300037466 Ga0395898_0251856 Ga0395898_0251856_107_1057 311
157 3300037471 Ga0395905_0326109 Ga0395905_0326109_332_1282 311
158 3300038443 Ga0395901_0000019 Ga0395901_0000019_211238_212188 311
159 3300042157 Ga0439458_0028525 Ga0439458_0028525_151_1116 311
160 3300044656 Ga0466969_0047280 Ga0466969_0047280_1021_1995 311
161 3300044658 Ga0466972_0009564 Ga0466972_0009564_3687_4643 311
162 3300044683 Ga0466965_0007237 Ga0466965_0007237_3161_4117 311
163 3300044683 Ga0466965_0015756 Ga0466965_0015756_1253_2203 311
164 3300044683 Ga0466965_0045762 Ga0466965_0045762_664_1614 311
165 3300044684 Ga0466966_0006384 Ga0466966_0006384_5150_6100 311
166 3300044684 Ga0466966_0011051 Ga0466966_0011051_2425_3399 311
167 3300044684 Ga0466966_0126037 Ga0466966_0126037_407_1390 311
168 3300044693 Ga0466961_0135886 Ga0466961_0135886_24_980 311
169 3300044693 Ga0466961_0175105 Ga0466961_0175105_32_982 311
170 3300044706 Ga0466964_0025245 Ga0466964_0025245_282_1238 311
171 3300044735 Ga0466968_0004950 Ga0466968_0004950_2967_3923 311
172 3300044842 Ga0466957_0000104 Ga0466957_0000104_2389_3339 311
173 3300044842 Ga0466957_0067208 Ga0466957_0067208_33_989 311
174 3300044842 Ga0466957_0079841 Ga0466957_0079841_138_1088 311
175 3300045049 Ga0466959_0003643 Ga0466959_0003643_7534_8484 311
176 3300045049 Ga0466959_0208225 Ga0466959_0208225_49_999 311
177 3300045836 Ga0466958_0032623 Ga0466958_0032623_795_1760 311
178 3300045976 Ga0466967_0150808 Ga0466967_0150808_123_1073 311
179 3300045976 Ga0466967_0531929 Ga0466967_0531929_83_1033 311
180 3300046452 Ga0495617_000003 Ga0495617_000003_263120_264097 311
181 3300046452 Ga0495617_000208 Ga0495617_000208_26557_27504 311
182 3300046455 Ga0495603_0012166 Ga0495603_0012166_3786_4736 311
183 3300046457 Ga0495590_0001769 Ga0495590_0001769_5190_6140 311
184 3300046457 Ga0495590_0025477 Ga0495590_0025477_643_1593 311
185 3300046463 Ga0495653_0000002 Ga0495653_0000002_451753_452730 311
186 3300046463 Ga0495653_0013560 Ga0495653_0013560_1452_2399 311
187 3300046471 Ga0495650_0000001 Ga0495650_0000001_470105_471043 311
188 3300046471 Ga0495650_0000072 Ga0495650_0000072_145904_146881 311
189 3300046471 Ga0495650_0000267 Ga0495650_0000267_6530_7507 311
190 3300046471 Ga0495650_0000427 Ga0495650_0000427_53333_54313 311
191 3300046471 Ga0495650_0046968 Ga0495650_0046968_753_1730 311
192 3300046474 Ga0495605_0000065 Ga0495605_0000065_31743_32693 311
193 3300046474 Ga0495605_0000103 Ga0495605_0000103_24813_25772 311
194 3300046474 Ga0495605_0006806 Ga0495605_0006806_1291_2241 311
195 3300046474 Ga0495605_0010607 Ga0495605_0010607_2297_3247 311
196 3300046474 Ga0495605_0013758 Ga0495605_0013758_1095_2042 311
197 3300046474 Ga0495605_0131119 Ga0495605_0131119_102_1049 311
198 3300046491 Ga0495584_0000009 Ga0495584_0000009_222406_223353 311
199 3300046491 Ga0495584_0000182 Ga0495584_0000182_30865_31812 311
200 3300046491 Ga0495584_0000904 Ga0495584_0000904_10739_11686 311
201 3300046491 Ga0495584_0006880 Ga0495584_0006880_3052_3999 311
202 3300046491 Ga0495584_0011178 Ga0495584_0011178_997_1947 311
203 3300046492 Ga0495585_0000154 Ga0495585_0000154_68013_68960 311
204 3300046492 Ga0495585_0000260 Ga0495585_0000260_2710_3657 311
205 3300046492 Ga0495585_0000940 Ga0495585_0000940_16959_17936 311
206 3300046492 Ga0495585_0002583 Ga0495585_0002583_7200_8147 311
207 3300046492 Ga0495585_0007271 Ga0495585_0007271_3553_4500 311
208 3300046492 Ga0495585_0026872 Ga0495585_0026872_2266_3213 311
209 3300046492 Ga0495585_0041966 Ga0495585_0041966_490_1437 311
210 3300046500 Ga0495596_0010296 Ga0495596_0010296_786_1733 311
211 3300046500 Ga0495596_0015031 Ga0495596_0015031_2249_3196 311
212 3300046500 Ga0495596_0018205 Ga0495596_0018205_60_1007 311
213 3300046500 Ga0495596_0018821 Ga0495596_0018821_60_1007 311
214 3300046500 Ga0495596_0128062 Ga0495596_0128062_19_966 311
215 3300046501 Ga0495607_0000644 Ga0495607_0000644_30688_31635 311
216 3300046501 Ga0495607_0009099 Ga0495607_0009099_3304_4251 311
217 3300046501 Ga0495607_0040486 Ga0495607_0040486_1507_2454 311
218 3300046501 Ga0495607_0060402 Ga0495607_0060402_70_1020 311
219 3300046506 Ga0495583_0000064 Ga0495583_0000064_157207_158154 311
220 3300046506 Ga0495583_0016130 Ga0495583_0016130_2200_3147 311
221 3300046506 Ga0495583_0018718 Ga0495583_0018718_1150_2097 311
222 3300046507 Ga0495606_0000001 Ga0495606_0000001_291138_292115 311
223 3300046507 Ga0495606_0000030 Ga0495606_0000030_43476_44453 311
224 3300046507 Ga0495606_0003624 Ga0495606_0003624_14507_15454 311
225 3300046507 Ga0495606_0010442 Ga0495606_0010442_4831_5811 311
226 3300046512 Ga0495610_0000003 Ga0495610_0000003_952578_953555 311
227 3300046512 Ga0495610_0001826 Ga0495610_0001826_6303_7280 311
228 3300046512 Ga0495610_0016720 Ga0495610_0016720_2928_3908 311
229 3300046512 Ga0495610_0041049 Ga0495610_0041049_1321_2301 311
230 3300046513 Ga0495616_0000012 Ga0495616_0000012_74353_75303 311
231 3300046513 Ga0495616_0001100 Ga0495616_0001100_6777_7724 311
232 3300046513 Ga0495616_0006912 Ga0495616_0006912_576_1523 311
233 3300046513 Ga0495616_0052135 Ga0495616_0052135_1051_1998 311
234 3300046513 Ga0495616_0055424 Ga0495616_0055424_848_1798 311
235 3300046513 Ga0495616_0076573 Ga0495616_0076573_411_1358 311
236 3300046518 Ga0495631_0000214 Ga0495631_0000214_35883_36833 311
237 3300046518 Ga0495631_0003192 Ga0495631_0003192_2248_3195 311
238 3300046518 Ga0495631_0007582 Ga0495631_0007582_3487_4437 311
239 3300046518 Ga0495631_0078034 Ga0495631_0078034_118_1065 311
240 3300046519 Ga0495632_0000117 Ga0495632_0000117_38539_39486 311
241 3300046519 Ga0495632_0000151 Ga0495632_0000151_37442_38392 311
242 3300046519 Ga0495632_0000405 Ga0495632_0000405_37432_38382 311
243 3300046519 Ga0495632_0002250 Ga0495632_0002250_12981_13928 311
244 3300046520 Ga0495637_0000042 Ga0495637_0000042_53514_54491 311
245 3300046522 Ga0495643_0009345 Ga0495643_0009345_3615_4562 311
246 3300046522 Ga0495643_0018663 Ga0495643_0018663_3005_3955 311
247 3300046522 Ga0495643_0018836 Ga0495643_0018836_438_1385 311
248 3300046522 Ga0495643_0083757 Ga0495643_0083757_89_1036 311
249 3300046524 Ga0495648_0000079 Ga0495648_0000079_74641_75588 311
250 3300046524 Ga0495648_0005786 Ga0495648_0005786_1250_2227 311
251 3300046524 Ga0495648_0023950 Ga0495648_0023950_2958_3905 311
252 3300046524 Ga0495648_0027847 Ga0495648_0027847_2242_3192 311
253 3300046524 Ga0495648_0033278 Ga0495648_0033278_1300_2247 311
254 3300046524 Ga0495648_0058300 Ga0495648_0058300_1279_2226 311
255 3300046528 Ga0495642_0002229 Ga0495642_0002229_4257_5207 311
256 3300046528 Ga0495642_0002749 Ga0495642_0002749_2102_3052 311
257 3300046528 Ga0495642_0004777 Ga0495642_0004777_1361_2311 311
258 3300046530 Ga0495654_0000037 Ga0495654_0000037_83771_84748 311
259 3300046530 Ga0495654_0008463 Ga0495654_0008463_2447_3397 311
260 3300046530 Ga0495654_0009920 Ga0495654_0009920_2385_3335 311
261 3300046530 Ga0495654_0016392 Ga0495654_0016392_222_1169 311
262 3300046530 Ga0495654_0040665 Ga0495654_0040665_174_1151 311
263 3300046538 Ga0495609_0000026 Ga0495609_0000026_73839_74786 311
264 3300046538 Ga0495609_0018079 Ga0495609_0018079_1975_2922 311
265 3300046538 Ga0495609_0064905 Ga0495609_0064905_344_1291 311
266 3300046542 Ga0495597_0000073 Ga0495597_0000073_2234_3181 311
267 3300046542 Ga0495597_0000864 Ga0495597_0000864_10817_11797 311
268 3300046542 Ga0495597_0004402 Ga0495597_0004402_4072_5022 311
269 3300046558 Ga0495633_0000055 Ga0495633_0000055_129409_130389 311
270 3300046558 Ga0495633_0013433 Ga0495633_0013433_2579_3526 311
271 3300046558 Ga0495633_0018016 Ga0495633_0018016_1375_2355 311
272 3300046615 Ga0495656_0049412 Ga0495656_0049412_771_1718 311
273 3300046616 Ga0495668_0000190 Ga0495668_0000190_52576_53553 311
274 3300046616 Ga0495668_0001065 Ga0495668_0001065_15859_16836 311
275 3300046616 Ga0495668_0001873 Ga0495668_0001873_4175_5152 311
276 3300046616 Ga0495668_0006874 Ga0495668_0006874_2344_3291 311
277 3300046616 Ga0495668_0016126 Ga0495668_0016126_1038_1985 311
278 3300046616 Ga0495668_0019446 Ga0495668_0019446_483_1433 311
279 3300046648 Ga0495611_0000151 Ga0495611_0000151_14649_15596 311
280 3300046648 Ga0495611_0018928 Ga0495611_0018928_74_1021 311
281 3300046660 Ga0495625_0000391 Ga0495625_0000391_34005_34982 311
282 3300046660 Ga0495625_0017011 Ga0495625_0017011_3417_4364 311
283 3300046660 Ga0495625_0076343 Ga0495625_0076343_881_1828 311
284 3300046665 Ga0495661_0000152 Ga0495661_0000152_73821_74768 311
285 3300046665 Ga0495661_0000715 Ga0495661_0000715_24846_25796 311
286 3300046665 Ga0495661_0006925 Ga0495661_0006925_6050_6997 311
287 3300046665 Ga0495661_0008169 Ga0495661_0008169_5798_6775 311
288 3300046665 Ga0495661_0016799 Ga0495661_0016799_3419_4366 311
289 3300046674 Ga0495588_0000139 Ga0495588_0000139_42229_43182 311
290 3300046680 Ga0495646_0046872 Ga0495646_0046872_494_1441 311
291 3300046684 Ga0495669_0021045 Ga0495669_0021045_801_1751 311
292 3300046691 Ga0495670_0006155 Ga0495670_0006155_2655_3605 311
293 3300046691 Ga0495670_0010977 Ga0495670_0010977_1466_2413 311
294 3300046691 Ga0495670_0088515 Ga0495670_0088515_278_1225 311
295 3300046692 Ga0495671_0000010 Ga0495671_0000010_206808_207785 311
296 3300046692 Ga0495671_0006896 Ga0495671_0006896_2164_3114 311
297 3300046692 Ga0495671_0007326 Ga0495671_0007326_1890_2837 311
298 3300046694 Ga0495649_0035077 Ga0495649_0035077_591_1538 311
299 3300046694 Ga0495649_0048270 Ga0495649_0048270_1226_2176 311
300 3300046694 Ga0495649_0065306 Ga0495649_0065306_21_971 311
301 3300046794 Ga0495589_0000100 Ga0495589_0000100_58063_59013 311
302 3300046794 Ga0495589_0000101 Ga0495589_0000101_7798_8745 311
303 3300046794 Ga0495589_0037719 Ga0495589_0037719_996_1943 311
304 3300046794 Ga0495589_0100712 Ga0495589_0100712_126_1076 311
305 3300046810 Ga0495660_0000027 Ga0495660_0000027_185971_186921 311
306 3300046810 Ga0495660_0020088 Ga0495660_0020088_579_1526 311
307 3300046810 Ga0495660_0039111 Ga0495660_0039111_629_1606 311
308 3300046810 Ga0495660_0052366 Ga0495660_0052366_51_998 311
309 3300047320 Ga0495672_0002802 Ga0495672_0002802_12088_13038 311
310 3300047320 Ga0495672_0007979 Ga0495672_0007979_3289_4239 311
311 3300047322 Ga0495680_0025635 Ga0495680_0025635_3526_4473 311
312 3300047323 Ga0495683_0000064 Ga0495683_0000064_43909_44856 311
313 3300047323 Ga0495683_0032651 Ga0495683_0032651_826_1773 311
314 3300047443 Ga0495687_000012 Ga0495687_000012_235040_235987 311
315 3300047443 Ga0495687_000037 Ga0495687_000037_73839_74786 311
316 3300047443 Ga0495687_000122 Ga0495687_000122_39810_40757 311
317 3300047443 Ga0495687_003478 Ga0495687_003478_7786_8736 311
318 3300047445 Ga0495677_0000014 Ga0495677_0000014_61451_62398 311
319 3300047445 Ga0495677_0003124 Ga0495677_0003124_2510_3457 311
320 3300047446 Ga0495679_001792 Ga0495679_001792_2455_3402 311
321 3300047446 Ga0495679_004418 Ga0495679_004418_654_1601 311
322 3300047469 Ga0495673_0000003 Ga0495673_0000003_958025_958972 311
323 3300047469 Ga0495673_0000016 Ga0495673_0000016_244778_245755 311
324 3300047470 Ga0495681_0000021 Ga0495681_0000021_153139_154104 311
325 3300047470 Ga0495681_0000246 Ga0495681_0000246_41521_42471 311
326 3300047470 Ga0495681_0024947 Ga0495681_0024947_1368_2315 311
327 3300047472 Ga0495686_0000047 Ga0495686_0000047_83131_84078 311
328 3300047472 Ga0495686_0007983 Ga0495686_0007983_1583_2560 311
329 3300047472 Ga0495686_0096437 Ga0495686_0096437_378_1355 311
330 3300047472 Ga0495686_0149193 Ga0495686_0149193_122_1072 311
331 3300048091 Ga0495626_0000222 Ga0495626_0000222_30648_31598 311
332 3300048091 Ga0495626_0001784 Ga0495626_0001784_2768_3715 311
333 3300048091 Ga0495626_0008414 Ga0495626_0008414_2936_3883 311
334 3300048091 Ga0495626_0015604 Ga0495626_0015604_2158_3108 311
335 3300048091 Ga0495626_0089155 Ga0495626_0089155_233_1180 311
336 3300048091 Ga0495626_0095110 Ga0495626_0095110_230_1180 311
337 3300048091 Ga0495626_0137873 Ga0495626_0137873_16_963 311
338 3300048905 Ga0496102_0049277 Ga0496102_0049277_1285_2241 311
339 3300048905 Ga0496102_0147844 Ga0496102_0147844_324_1271 311
340 3300048909 Ga0496106_0030710 Ga0496106_0030710_633_1583 311
341 3300048911 Ga0496108_0329777 Ga0496108_0329777_340_1290 311
342 3300048912 Ga0496109_0199668 Ga0496109_0199668_375_1325 311
343 3300048916 Ga0496113_0001992 Ga0496113_0001992_2807_3763 311
344 3300048923 Ga0496120_0039174 Ga0496120_0039174_1830_2789 311
345 3300048925 Ga0496122_0020696 Ga0496122_0020696_1640_2614 311
346 3300048925 Ga0496122_0025368 Ga0496122_0025368_3142_4098 311
347 3300048925 Ga0496122_0050365 Ga0496122_0050365_894_1871 311
348 3300048926 Ga0496123_0003516 Ga0496123_0003516_3931_4905 311
349 3300048926 Ga0496123_0005149 Ga0496123_0005149_10021_10998 311
350 3300048927 Ga0496124_0142299 Ga0496124_0142299_513_1490 311
351 3300048927 Ga0496124_0162170 Ga0496124_0162170_738_1697 311
352 3300048929 Ga0496126_0004427 Ga0496126_0004427_10141_11088 311
353 3300049459 Ga0495678_000045 Ga0495678_000045_77789_78736 311
354 3300049460 Ga0495682_0000628 Ga0495682_0000628_20025_20972 311
355 3300049460 Ga0495682_0071136 Ga0495682_0071136_263_1213 311
356 3300049532 Ga0501316_003450 Ga0501316_003450_541_1506 311
357 3300049551 Ga0501335_000226 Ga0501335_000226_1003_1968 311
358 3300049572 Ga0501036_0156079 Ga0501036_0156079_606_1556 311
359 3300049661 Ga0501217_015353 Ga0501217_015353_734_1699 311
360 3300049662 Ga0501222_003666 Ga0501222_003666_648_1598 311
361 3300049822 Ga0501035_0011980 Ga0501035_0011980_632_1582 311
362 3300049823 Ga0501044_0588127 Ga0501044_0588127_15_965 311
363 3300053125 Ga0500618_000068 Ga0500618_000068_47602_48579 311
364 3300053145 Ga0500586_001379 Ga0500586_001379_3366_4346 311
365 3300059505 Ga0587083_0004084 Ga0587083_0004084_637_1587 311
366 iso_pu_bacteria 2643221556 2643801500 311
367 iso_pu_bacteria 2643221684 2644471438 311
368 iso_pu_bacteria 2738541276 2738713391 311
369 iso_pu_bacteria 2904424332 2904425720 311
370 iso_pu_bacteria 8047673197 8047677196 311
371 3300002738 JGI25154J39366_1000503 JGI25154J39366_100050310 312
372 3300003771 Ga0055526_1000018 Ga0055526_1000018135 312
373 3300003794 Ga0055531_10000025 Ga0055531_1000002554 312
374 3300025246 Ga0209646_1000051 Ga0209646_100005114 312
375 3300025295 Ga0209564_1000068 Ga0209564_1000068241 312
376 3300025298 Ga0209050_1001479 Ga0209050_10014796 312
377 3300025303 Ga0209051_1005230 Ga0209051_10052305 312
378 3300025304 Ga0209257_1000032 Ga0209257_1000032138 312
379 3300031548 Ga0307408_100000419 Ga0307408_10000041924 312
380 3300046452 Ga0495617_004548 Ga0495617_004548_3859_4839 312
381 3300046457 Ga0495590_0010308 Ga0495590_0010308_774_1754 312
382 3300046460 Ga0495638_0006478 Ga0495638_0006478_3913_4893 312
383 3300046474 Ga0495605_0009486 Ga0495605_0009486_3406_4386 312
384 3300046491 Ga0495584_0008198 Ga0495584_0008198_2561_3541 312
385 3300046492 Ga0495585_0091316 Ga0495585_0091316_515_1495 312
386 3300046501 Ga0495607_0034933 Ga0495607_0034933_896_1876 312
387 3300046506 Ga0495583_0000253 Ga0495583_0000253_22815_23795 312
388 3300046507 Ga0495606_0024337 Ga0495606_0024337_1116_2096 312
389 3300046513 Ga0495616_0000283 Ga0495616_0000283_2503_3483 312
390 3300046523 Ga0495644_0026277 Ga0495644_0026277_189_1169 312
391 3300046524 Ga0495648_0016643 Ga0495648_0016643_2555_3535 312
392 3300046524 Ga0495648_0040219 Ga0495648_0040219_1018_1983 312
393 3300046538 Ga0495609_0000241 Ga0495609_0000241_33283_34263 312
394 3300046542 Ga0495597_0008100 Ga0495597_0008100_4115_5095 312
395 3300046615 Ga0495656_0006356 Ga0495656_0006356_1517_2497 312
396 3300046648 Ga0495611_0066432 Ga0495611_0066432_139_1119 312
397 3300046660 Ga0495625_0131621 Ga0495625_0131621_144_1124 312
398 3300046664 Ga0495659_0000158 Ga0495659_0000158_9657_10637 312
399 3300046664 Ga0495659_0041143 Ga0495659_0041143_277_1257 312
400 3300046665 Ga0495661_0103006 Ga0495661_0103006_394_1374 312
401 3300046691 Ga0495670_0000114 Ga0495670_0000114_3556_4536 312
402 3300046692 Ga0495671_0002314 Ga0495671_0002314_2635_3615 312
403 3300046692 Ga0495671_0007720 Ga0495671_0007720_4855_5835 312
404 3300046694 Ga0495649_0041820 Ga0495649_0041820_1312_2262 312
405 3300047318 Ga0495636_0003252 Ga0495636_0003252_5131_6111 312
406 3300047320 Ga0495672_0002445 Ga0495672_0002445_15848_16828 312
407 3300047323 Ga0495683_0001336 Ga0495683_0001336_12957_13937 312
408 3300047443 Ga0495687_000062 Ga0495687_000062_125328_126308 312
409 3300047445 Ga0495677_0004220 Ga0495677_0004220_2675_3655 312
410 3300047447 Ga0495685_000262 Ga0495685_000262_7725_8705 312
411 3300047469 Ga0495673_0000035 Ga0495673_0000035_191371_192321 312
412 3300047469 Ga0495673_0003607 Ga0495673_0003607_6633_7613 312
413 3300048906 Ga0496103_0178087 Ga0496103_0178087_49_1032 312
414 3300049459 Ga0495678_000663 Ga0495678_000663_26842_27822 312
415 3300049460 Ga0495682_0000208 Ga0495682_0000208_3644_4624 312
416 3300049654 Ga0501207_007153 Ga0501207_007153_133_1077 312
417 3300049679 Ga0501249_002660 Ga0501249_002660_2535_3518 312
418 3300053118 Ga0500594_0002831 Ga0500594_0002831_1934_2899 312
419 iso_pu_bacteria 2738541280 2738740120 312
420 iso_pu_bacteria 2738541300 2738844115 312
421 iso_pu_bacteria 2738543018 2739274322 312
422 iso_pu_bacteria 2738543030 2739343366 312
423 iso_pu_bacteria 2857553236 2857555921 312
424 iso_pu_bacteria 2919476304 2919478254 312
425 iso_pu_bacteria 2937610967 2937613548 312
426 3300002987 JGI25159J45721_1002470 JGI25159J45721_10024704 313
427 3300003316 rootH1_10015702 rootH1_100157025 313
428 3300003322 rootL2_10002151 rootL2_1000215147 313
429 3300003323 rootH1_10002339 rootH1_100023393 313
430 3300003323 rootH1_10042111 rootH1_100421115 313
431 3300003773 Ga0055537_1000027 Ga0055537_10000275 313
432 3300003775 Ga0055524_1002925 Ga0055524_10029255 313
433 3300003784 Ga0055534_1000051 Ga0055534_100005137 313
434 3300003790 Ga0055528_1000731 Ga0055528_10007314 313
435 3300003794 Ga0055531_10002488 Ga0055531_100024889 313
436 3300005262 Ga0065165_1001148 Ga0065165_10011489 313
437 3300006944 Ga0099823_1000046 Ga0099823_100004630 313
438 3300006946 Ga0079104_1024665 Ga0079104_10246652 313
439 3300009036 Ga0105244_10001201 Ga0105244_1000120112 313
440 3300009036 Ga0105244_10040268 Ga0105244_100402682 313
441 3300014497 Ga0182008_10001070 Ga0182008_100010705 313
442 3300015261 Ga0182006_1000007 Ga0182006_1000007160 313
443 3300015261 Ga0182006_1000040 Ga0182006_10000402 313
444 3300015262 Ga0182007_10000068 Ga0182007_1000006811 313
445 3300015265 Ga0182005_1000010 Ga0182005_1000010139 313
446 3300015265 Ga0182005_1000051 Ga0182005_100005134 313
447 3300021361 Ga0213872_10000040 Ga0213872_1000004078 313
448 3300021361 Ga0213872_10052139 Ga0213872_100521392 313
449 3300025263 Ga0209565_1000017 Ga0209565_1000017226 313
450 3300025273 Ga0209673_1000007 Ga0209673_1000007203 313
451 3300025273 Ga0209673_1015546 Ga0209673_10155462 313
452 3300025284 Ga0209130_1000078 Ga0209130_1000078155 313
453 3300025291 Ga0209675_1000009 Ga0209675_1000009315 313
454 3300025295 Ga0209564_1000036 Ga0209564_1000036203 313
455 3300025295 Ga0209564_1000055 Ga0209564_1000055250 313
456 3300025298 Ga0209050_1001361 Ga0209050_100136113 313
457 3300025299 Ga0209256_1000167 Ga0209256_100016718 313
458 3300025299 Ga0209256_1006853 Ga0209256_10068532 313
459 3300025302 Ga0207426_1025391 Ga0207426_10253912 313
460 3300025303 Ga0209051_1000869 Ga0209051_10008692 313
461 3300025304 Ga0209257_1003015 Ga0209257_100301511 313
462 3300027111 Ga0209281_1005021 Ga0209281_10050212 313
463 3300027296 Ga0209389_1013868 Ga0209389_10138684 313
464 3300030745 Ga0316182_1011444 Ga0316182_10114441 313
465 3300030745 Ga0316182_1278328 Ga0316182_12783282 313
466 3300031456 Ga0307513_10403823 Ga0307513_104038231 313
467 3300031838 Ga0307518_10099607 Ga0307518_100996071 313
468 3300039447 Ga0436361_0424561 Ga0436361_0424561_4017_5003 313
469 3300039447 Ga0436361_0617438 Ga0436361_0617438_445_1392 313
470 3300039447 Ga0436361_1177289 Ga0436361_1177289_6381_7334 313
471 3300042127 Ga0450890_000853 Ga0450890_000853_2855_3823 313
472 3300044672 Ga0466982_0066678 Ga0466982_0066678_315_1298 313
473 3300046457 Ga0495590_0000001 Ga0495590_0000001_201747_202730 313
474 3300046457 Ga0495590_0032711 Ga0495590_0032711_193_1152 313
475 3300046471 Ga0495650_0005248 Ga0495650_0005248_2714_3697 313
476 3300046475 Ga0495639_0023644 Ga0495639_0023644_1532_2515 313
477 3300046491 Ga0495584_0011989 Ga0495584_0011989_151_1134 313
478 3300046506 Ga0495583_0000050 Ga0495583_0000050_107870_108853 313
479 3300046506 Ga0495583_0034199 Ga0495583_0034199_1338_2297 313
480 3300046507 Ga0495606_0005214 Ga0495606_0005214_9568_10521 313
481 3300046512 Ga0495610_0009770 Ga0495610_0009770_231_1217 313
482 3300046522 Ga0495643_0000028 Ga0495643_0000028_69755_70747 313
483 3300046522 Ga0495643_0000285 Ga0495643_0000285_65985_66968 313
484 3300046522 Ga0495643_0093325 Ga0495643_0093325_563_1522 313
485 3300046524 Ga0495648_0000001 Ga0495648_0000001_650086_651069 313
486 3300046524 Ga0495648_0014982 Ga0495648_0014982_4636_5628 313
487 3300046530 Ga0495654_0073473 Ga0495654_0073473_374_1321 313
488 3300046538 Ga0495609_0001046 Ga0495609_0001046_6010_6969 313
489 3300046538 Ga0495609_0013197 Ga0495609_0013197_450_1418 313
490 3300046538 Ga0495609_0015872 Ga0495609_0015872_1351_2334 313
491 3300046542 Ga0495597_0000705 Ga0495597_0000705_10404_11387 313
492 3300046557 Ga0495622_0000131 Ga0495622_0000131_5165_6148 313
493 3300046557 Ga0495622_0026719 Ga0495622_0026719_920_1867 313
494 3300046557 Ga0495622_0030689 Ga0495622_0030689_205_1152 313
495 3300046558 Ga0495633_0000106 Ga0495633_0000106_10456_11439 313
496 3300046558 Ga0495633_0000675 Ga0495633_0000675_27250_28197 313
497 3300046616 Ga0495668_0002146 Ga0495668_0002146_10054_11037 313
498 3300046616 Ga0495668_0013236 Ga0495668_0013236_1679_2662 313
499 3300046660 Ga0495625_0000035 Ga0495625_0000035_111642_112625 313
500 3300046660 Ga0495625_0002897 Ga0495625_0002897_11086_12045 313
501 3300046660 Ga0495625_0043513 Ga0495625_0043513_616_1596 313
502 3300046664 Ga0495659_0028445 Ga0495659_0028445_422_1405 313
503 3300046684 Ga0495669_0002681 Ga0495669_0002681_2205_3188 313
504 3300046694 Ga0495649_0042748 Ga0495649_0042748_265_1224 313
505 3300046694 Ga0495649_0070323 Ga0495649_0070323_394_1377 313
506 3300046810 Ga0495660_0000335 Ga0495660_0000335_17511_18479 313
507 3300046810 Ga0495660_0010965 Ga0495660_0010965_2969_3937 313
508 3300046810 Ga0495660_0041760 Ga0495660_0041760_80_1027 313
509 3300047318 Ga0495636_0042115 Ga0495636_0042115_44_1003 313
510 3300047320 Ga0495672_0000220 Ga0495672_0000220_1432_2379 313
511 3300047320 Ga0495672_0000221 Ga0495672_0000221_77881_78873 313
512 3300047445 Ga0495677_0032844 Ga0495677_0032844_785_1744 313
513 3300047447 Ga0495685_001925 Ga0495685_001925_2356_3315 313
514 3300047470 Ga0495681_0006028 Ga0495681_0006028_2103_3062 313
515 3300047470 Ga0495681_0015183 Ga0495681_0015183_23_991 313
516 3300048914 Ga0496111_0050164 Ga0496111_0050164_1411_2358 313
517 3300048920 Ga0496117_0000005 Ga0496117_0000005_280322_281269 313
518 3300048921 Ga0496118_0000022 Ga0496118_0000022_157334_158281 313
519 3300048924 Ga0496121_0004143 Ga0496121_0004143_4839_5786 313
520 3300048924 Ga0496121_0041960 Ga0496121_0041960_1271_2218 313
521 3300048925 Ga0496122_0001132 Ga0496122_0001132_13274_14221 313
522 3300048926 Ga0496123_0006339 Ga0496123_0006339_1383_2330 313
523 3300048927 Ga0496124_0024602 Ga0496124_0024602_3943_4926 313
524 3300048927 Ga0496124_0084520 Ga0496124_0084520_515_1462 313
525 3300049459 Ga0495678_000002 Ga0495678_000002_958000_958968 313
526 3300049459 Ga0495678_000029 Ga0495678_000029_166222_167214 313
527 3300049459 Ga0495678_004929 Ga0495678_004929_825_1778 313
528 3300049459 Ga0495678_024725 Ga0495678_024725_1447_2400 313
529 3300049673 Ga0501240_007331 Ga0501240_007331_247_1206 313
530 3300049766 Ga0501269_000700 Ga0501269_000700_4496_5482 313
531 3300028800 Ga0265338_10000331 Ga0265338_1000033113 314
532 3300028800 Ga0265338_10008840 Ga0265338_100088403 314
533 3300031548 Ga0307408_100000286 Ga0307408_10000028612 314
534 3300031548 Ga0307408_100021916 Ga0307408_1000219163 314
535 3300031727 Ga0316576_10000921 Ga0316576_100009217 314
536 3300031727 Ga0316576_10040422 Ga0316576_100404222 314
537 3300031728 Ga0316578_10050384 Ga0316578_100503842 314
538 3300031901 Ga0307406_10028255 Ga0307406_100282552 314
539 3300042129 Ga0450891_002414 Ga0450891_002414_231_1199 314
540 3300042876 Ga0451577_0000642 Ga0451577_0000642_2914_3861 314
541 3300045051 Ga0451576_0000098 Ga0451576_0000098_90444_91391 314
542 3300045051 Ga0451576_0016173 Ga0451576_0016173_2580_3527 314
543 3300031727 Ga0316576_10170457 Ga0316576_101704572 315
544 3300046558 Ga0495633_0018951 Ga0495633_0018951_1975_2940 316
545 3300049571 Ga0501034_0103678 Ga0501034_0103678_895_1860 316
546 3300002705 JGI25156J39149_1007056 JGI25156J39149_10070562 320
547 3300002741 JGI25157J39369_1000256 JGI25157J39369_100025614 320
548 3300003752 Ga0055539_1007205 Ga0055539_10072052 320
549 3300003756 Ga0055533_1006262 Ga0055533_10062622 320
550 3300003756 Ga0055533_1008429 Ga0055533_10084292 320
551 3300003760 Ga0055527_1000393 Ga0055527_10003936 320
552 3300003761 Ga0055535_1000974 Ga0055535_100097413 320
553 3300003762 Ga0055542_1000970 Ga0055542_100097013 320
554 3300003763 Ga0055529_1000818 Ga0055529_100081813 320
555 3300025226 Ga0209674_100059 Ga0209674_100059178 320
556 3300025226 Ga0209674_102211 Ga0209674_1022112 320
557 3300025228 Ga0209672_100008 Ga0209672_100008619 320
558 3300025242 Ga0209258_100004 Ga0209258_100004571 320
559 3300025242 Ga0209258_100008 Ga0209258_100008196 320
560 3300025250 Ga0209026_1000045 Ga0209026_1000045197 320
561 3300025253 Ga0209677_101205 Ga0209677_1012056 320
562 3300025253 Ga0209677_107599 Ga0209677_1075992 320
563 3300025254 Ga0209148_1000053 Ga0209148_1000053316 320
564 3300025256 Ga0209759_1000212 Ga0209759_100021266 320
565 3300025272 Ga0209455_1000007 Ga0209455_1000007316 320
566 3300026078 Ga0207702_10000654 Ga0207702_1000065419 320
567 3300037312 Ga0395899_0000226 Ga0395899_0000226_35783_36754 320
568 3300037418 Ga0395900_0000011 Ga0395900_0000011_380385_381356 320
569 3300037466 Ga0395898_0000029 Ga0395898_0000029_137433_138404 320
570 3300038443 Ga0395901_0024509 Ga0395901_0024509_279_1250 320
571 3300044693 Ga0466961_0000272 Ga0466961_0000272_27055_28026 320
572 3300044693 Ga0466961_0000299 Ga0466961_0000299_21073_22044 320
573 3300044693 Ga0466961_0013395 Ga0466961_0013395_999_1970 320
574 3300044765 Ga0466970_0000201 Ga0466970_0000201_26683_27654 320
575 3300044765 Ga0466970_0012603 Ga0466970_0012603_2045_3016 320
576 3300045049 Ga0466959_0000006 Ga0466959_0000006_113177_114148 320
577 3300045049 Ga0466959_0077725 Ga0466959_0077725_533_1504 320
578 3300045836 Ga0466958_0032112 Ga0466958_0032112_1298_2269 320
579 3300044693 Ga0466961_0004718 Ga0466961_0004718_5378_6343 321
580 3300002705 JGI25156J39149_1003241 JGI25156J39149_10032413 322
581 3300002737 JGI25162J39368_1003969 JGI25162J39368_10039693 322
582 3300002738 JGI25154J39366_1004732 JGI25154J39366_10047322 322
583 3300002741 JGI25157J39369_1002177 JGI25157J39369_10021773 322
584 3300002772 JGI25164J39214_1000064 JGI25164J39214_100006458 322
585 3300003214 JGI25165J46597_1000278 JGI25165J46597_100027857 322
586 3300003759 Ga0055525_1000043 Ga0055525_100004351 322
587 3300003760 Ga0055527_1000305 Ga0055527_10003055 322
588 3300003760 Ga0055527_1001316 Ga0055527_10013162 322
589 3300003761 Ga0055535_1000652 Ga0055535_10006525 322
590 3300003762 Ga0055542_1000393 Ga0055542_10003935 322
591 3300003762 Ga0055542_1000672 Ga0055542_10006725 322
592 3300003763 Ga0055529_1000409 Ga0055529_10004095 322
593 3300003763 Ga0055529_1000620 Ga0055529_10006204 322
594 3300025228 Ga0209672_100004 Ga0209672_100004716 322
595 3300025228 Ga0209672_100121 Ga0209672_10012161 322
596 3300025230 Ga0209563_100036 Ga0209563_100036179 322
597 3300025231 Ga0207427_100037 Ga0207427_100037206 322
598 3300025233 Ga0209437_100213 Ga0209437_10021357 322
599 3300025242 Ga0209258_100003 Ga0209258_100003716 322
600 3300025242 Ga0209258_100106 Ga0209258_100106139 322
601 3300025246 Ga0209646_1001473 Ga0209646_10014734 322
602 3300025250 Ga0209026_1003347 Ga0209026_10033473 322
603 3300025254 Ga0209148_1000025 Ga0209148_100002520 322
604 3300025254 Ga0209148_1000042 Ga0209148_1000042265 322
605 3300025256 Ga0209759_1000185 Ga0209759_100018542 322
606 3300025261 Ga0209233_1000096 Ga0209233_1000096207 322
607 3300025272 Ga0209455_1000004 Ga0209455_1000004716 322
608 3300025272 Ga0209455_1000016 Ga0209455_1000016520 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

6

306

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k1u-assembly1.cif.gz_A beta-xylosidase, family 43 glycosyl hydrolase from clostridium acetobutylicum 0.9767 3 310
5m8b-assembly1.cif.gz_B crystal structure of alpha-l-arabinofuranosidase from lactobacillus brevis 0.9717 3 310
5m8e-assembly1.cif.gz_B crystal structure of a gh43 arabonofuranosidase from weissella sp. strain 142 0.9682 1 310
3akh-assembly1.cif.gz_A crystal structure of exo-1,5-alpha-l-arabinofuranosidase complexed with alpha-1,5-l-arabinofuranotriose 0.9682 3 309
3k1u-assembly1.cif.gz_A beta-xylosidase, family 43 glycosyl hydrolase from clostridium acetobutylicum 0.9554 3 310
ID Description Score Start End Superfamily
3akhA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9682 3 309 2.115.10.20
3akhA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9498 3 309 2.115.10.20
4qqsA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8123 3 316 2.115.10.20
3kstA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8088 4 307 2.115.10.20
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8015 1 314 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A377WCH1-F1-model_v4 Alpha-L-arabinofuranosidase II (EC 3.2.1.55) 0.9909 5 68 GO:0005975
GO:0046556
AF-A0A379WGH8-F1-model_v4 Glycosyl hydrolase (EC 3.2.1.55) 0.9867 5 183 GO:0005975
GO:0046556
AF-A0A2N5AG52-F1-model_v4 Alpha-N-arabinofuranosidase 0.9848 5 197 GO:0004553
GO:0005975
AF-A0A656YHE7-F1-model_v4 deleted 0.9844 5 162
AF-A0A379TQ40-F1-model_v4 Glycosyl hydrolase (EC 3.2.1.55) 0.9819 1 116 GO:0005975
GO:0046556

Feature Viewer

pLDDT pTM Quality
92.59 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map