F468799

General Info

Members Datasets Scaffolds Average Seq Length
608 281 1216 166

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10000465|Ga0316583_100004657
Length 180
Sequence MSATTSTRMTGLLAGYDFLDSIVDAIEGLKKAGFKKITAYVPYPEHHIEAALGYGQSPVRVFTLVGGLTGAATGMALTVWTSSLWPLVVGGKPIIGMPAYIVLTFELAVLFGALATLIGFGINAHIPDLKPRVAYDPEFSAGRYGLWVVVPPERMEEARRILEAQEPAELRVGEQEAADA

Samples

Sample ID Description Type Environment
1 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
236 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
251 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
252 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
253 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
254 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
255 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
256 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
257 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
258 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
259 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
260 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
261 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
262 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
263 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
264 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
265 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
266 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
267 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
268 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
272 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
273 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
274 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.47
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 9.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316583_10000465 3300032133 Bacteria 12004
2 JGI25406J46586_10013506 3300003203 Unclassified 3504
3 Ga0058862_12889962 3300004803 Bacteria 2426
4 Ga0065715_10216618 3300005293 Bacteria 1273
5 Ga0070658_10002623 3300005327 Bacteria 14975
6 Ga0070658_10013188 3300005327 Bacteria 6630
7 Ga0070658_10064622 3300005327 Bacteria 2985
8 Ga0070658_10104841 3300005327 Bacteria 2339
9 Ga0070658_10693706 3300005327 Bacteria 884
10 Ga0070658_11288116 3300005327 Unclassified 635
11 Ga0070658_11331233 3300005327 Unclassified 624
12 Ga0070683_100006808 3300005329 Bacteria 9604
13 Ga0070683_100074339 3300005329 Bacteria 3174
14 Ga0070683_100077853 3300005329 Bacteria 3101
15 Ga0070683_100160367 3300005329 Bacteria 2134
16 Ga0070683_100169555 3300005329 Bacteria 2072
17 Ga0070683_100230294 3300005329 Bacteria 1762
18 Ga0070683_100256649 3300005329 Bacteria 1663
19 Ga0070683_100631168 3300005329 Bacteria 1026
20 Ga0070683_100740483 3300005329 Bacteria 942
21 Ga0070690_100073370 3300005330 Bacteria 2227
22 Ga0070690_100173392 3300005330 Bacteria 1486
23 Ga0070690_100268129 3300005330 Bacteria 1213
24 Ga0070670_100122344 3300005331 Bacteria 2244
25 Ga0070670_100168152 3300005331 Bacteria 1901
26 Ga0070670_100791949 3300005331 Unclassified 856
27 Ga0070670_101058471 3300005331 Bacteria 739
28 Ga0068869_100006384 3300005334 Bacteria 7474
29 Ga0070666_10507467 3300005335 Bacteria 875
30 Ga0070666_10785433 3300005335 Bacteria 701
31 Ga0070680_100003091 3300005336 Bacteria 12358
32 Ga0070680_100006424 3300005336 Bacteria 8932
33 Ga0070680_100041283 3300005336 Bacteria 3740
34 Ga0070680_100081935 3300005336 Bacteria 2662
35 Ga0070680_100394337 3300005336 Bacteria 1179
36 Ga0070682_100001044 3300005337 Bacteria 16013
37 Ga0070682_100013735 3300005337 Bacteria 4668
38 Ga0070682_100020384 3300005337 Bacteria 3900
39 Ga0068868_100027746 3300005338 Bacteria 4320
40 Ga0070660_100041003 3300005339 Bacteria 3526
41 Ga0070660_100110784 3300005339 Bacteria 2183
42 Ga0070660_100301106 3300005339 Bacteria 1314
43 Ga0070660_100973393 3300005339 Unclassified 716
44 Ga0070689_100295674 3300005340 Bacteria 1347
45 Ga0070689_100742436 3300005340 Bacteria 860
46 Ga0070687_100019194 3300005343 Bacteria 3176
47 Ga0070661_100003156 3300005344 Bacteria 11341
48 Ga0070661_100016504 3300005344 Bacteria 5222
49 Ga0070661_100022175 3300005344 Bacteria 4544
50 Ga0070661_100092933 3300005344 Bacteria 2235
51 Ga0070661_100359763 3300005344 Bacteria 1144
52 Ga0070661_100662826 3300005344 Bacteria 848
53 Ga0070692_10251864 3300005345 Bacteria 1058
54 Ga0070668_100050222 3300005347 Bacteria 3211
55 Ga0070669_100008212 3300005353 Bacteria 7456
56 Ga0070675_100002689 3300005354 Bacteria 13361
57 Ga0070675_100125004 3300005354 Bacteria 2188
58 Ga0070675_100150592 3300005354 Bacteria 1994
59 Ga0070675_100186503 3300005354 Bacteria 1795
60 Ga0070671_100049361 3300005355 Bacteria 3501
61 Ga0070671_101335129 3300005355 Bacteria 633
62 Ga0070674_100008707 3300005356 Bacteria 6053
63 Ga0070674_100474782 3300005356 Bacteria 1037
64 Ga0070674_100550641 3300005356 Unclassified 968
65 Ga0070673_100101680 3300005364 Bacteria 2368
66 Ga0070673_100211723 3300005364 Bacteria 1674
67 Ga0070673_100376672 3300005364 Bacteria 1265
68 Ga0070688_100129664 3300005365 Bacteria 1700
69 Ga0070688_100787176 3300005365 Bacteria 743
70 Ga0070659_100048807 3300005366 Bacteria 3326
71 Ga0070659_100109744 3300005366 Bacteria 2227
72 Ga0070659_100251408 3300005366 Bacteria 1465
73 Ga0070659_101035786 3300005366 Bacteria 721
74 Ga0070667_100193556 3300005367 Bacteria 1802
75 Ga0070667_100445021 3300005367 Bacteria 1183
76 Ga0070709_10045407 3300005434 Bacteria 2726
77 Ga0070714_100291657 3300005435 Bacteria 1518
78 Ga0070714_100382213 3300005435 Bacteria 1328
79 Ga0070714_100570625 3300005435 Bacteria 1085
80 Ga0070713_100241927 3300005436 Bacteria 1644
81 Ga0070705_100041590 3300005440 Bacteria 2622
82 Ga0070662_100021848 3300005457 Bacteria 4373
83 Ga0070662_100415694 3300005457 Bacteria 1112
84 Ga0070662_100460351 3300005457 Bacteria 1057
85 Ga0070681_10002263 3300005458 Bacteria 17579
86 Ga0070681_10009188 3300005458 Bacteria 9716
87 Ga0070681_10013984 3300005458 Bacteria 7987
88 Ga0070681_10058920 3300005458 Bacteria 3820
89 Ga0070681_10383086 3300005458 Bacteria 1317
90 Ga0070681_10688364 3300005458 Bacteria 938
91 Ga0068867_100019118 3300005459 Bacteria 4878
92 Ga0068867_100094480 3300005459 Bacteria 2274
93 Ga0070685_10691089 3300005466 Bacteria 743
94 Ga0070707_100235886 3300005468 Bacteria 1781
95 Ga0070707_100254171 3300005468 Bacteria 1710
96 Ga0070707_100403762 3300005468 Unclassified 1327
97 Ga0070698_100027140 3300005471 Bacteria 5955
98 Ga0070698_100063534 3300005471 Bacteria 3723
99 Ga0070698_100501063 3300005471 Unclassified 1152
100 Ga0070699_100094064 3300005518 Bacteria 2623
101 Ga0070699_100465922 3300005518 Bacteria 1146
102 Ga0070699_101116778 3300005518 Bacteria 723
103 Ga0070679_100000347 3300005530 Bacteria 39328
104 Ga0070679_100000771 3300005530 Bacteria 27790
105 Ga0070679_100005458 3300005530 Bacteria 11785
106 Ga0070679_100010982 3300005530 Bacteria 8606
107 Ga0070679_100187463 3300005530 Bacteria 2038
108 Ga0070679_100226817 3300005530 Unclassified 1828
109 Ga0070679_100372918 3300005530 Unclassified 1374
110 Ga0070679_100581300 3300005530 Bacteria 1064
111 Ga0070684_100024221 3300005535 Bacteria 5089
112 Ga0070684_100036980 3300005535 Bacteria 4186
113 Ga0070684_100051479 3300005535 Bacteria 3577
114 Ga0070684_100057546 3300005535 Bacteria 3395
115 Ga0070684_100091205 3300005535 Bacteria 2710
116 Ga0070684_100115504 3300005535 Bacteria 2410
117 Ga0070684_100135017 3300005535 Bacteria 2228
118 Ga0070684_100169045 3300005535 Bacteria 1986
119 Ga0070684_100388578 3300005535 Bacteria 1286
120 Ga0070684_100472634 3300005535 Bacteria 1160
121 Ga0070697_100279970 3300005536 Bacteria 1431
122 Ga0068853_100082846 3300005539 Bacteria 2810
123 Ga0068853_100341361 3300005539 Bacteria 1392
124 Ga0068853_100460768 3300005539 Bacteria 1196
125 Ga0068853_101033028 3300005539 Bacteria 792
126 Ga0070672_100037576 3300005543 Bacteria 3695
127 Ga0070672_100044335 3300005543 Bacteria 3434
128 Ga0070672_101337586 3300005543 Unclassified 640
129 Ga0070686_100251113 3300005544 Bacteria 1292
130 Ga0070696_100000465 3300005546 Bacteria 25402
131 Ga0070693_100008947 3300005547 Bacteria 4967
132 Ga0070693_100034496 3300005547 Bacteria 2800
133 Ga0070693_100341586 3300005547 Unclassified 1022
134 Ga0070693_100998170 3300005547 Bacteria 633
135 Ga0070665_101243485 3300005548 Unclassified 755
136 Ga0070704_100322940 3300005549 Bacteria 1294
137 Ga0068855_100091154 3300005563 Bacteria 3517
138 Ga0068855_100151539 3300005563 Bacteria 2636
139 Ga0068855_100167687 3300005563 Bacteria 2488
140 Ga0068855_100170219 3300005563 Bacteria 2467
141 Ga0068855_100217020 3300005563 Bacteria 2147
142 Ga0068855_100428527 3300005563 Bacteria 1446
143 Ga0068855_101014772 3300005563 Unclassified 871
144 Ga0070664_100000208 3300005564 Bacteria 42028
145 Ga0070664_100088737 3300005564 Bacteria 2674
146 Ga0070664_100150011 3300005564 Bacteria 2058
147 Ga0070664_100340804 3300005564 Bacteria 1361
148 Ga0070664_100605334 3300005564 Bacteria 1016
149 Ga0070664_100770396 3300005564 Bacteria 899
150 Ga0070664_100799501 3300005564 Bacteria 882
151 Ga0070664_100995684 3300005564 Unclassified 788
152 Ga0068857_100051782 3300005577 Bacteria 3643
153 Ga0068857_100244538 3300005577 Bacteria 1643
154 Ga0068857_100251090 3300005577 Bacteria 1621
155 Ga0068854_100064293 3300005578 Bacteria 2665
156 Ga0068856_100058875 3300005614 Bacteria 3794
157 Ga0068856_100257624 3300005614 Bacteria 1760
158 Ga0070702_100013232 3300005615 Bacteria 4161
159 Ga0068852_100070096 3300005616 Bacteria 3075
160 Ga0068852_101168289 3300005616 Bacteria 790
161 Ga0068852_101416730 3300005616 Bacteria 717
162 Ga0068859_100045605 3300005617 Bacteria 4404
163 Ga0068859_100055346 3300005617 Bacteria 3992
164 Ga0068864_100038123 3300005618 Bacteria 4103
165 Ga0068864_100053429 3300005618 Bacteria 3485
166 Ga0068864_100714138 3300005618 Bacteria 980
167 Ga0068851_10122090 3300005834 Bacteria 1401
168 Ga0068851_10434234 3300005834 Bacteria 778
169 Ga0068870_10010428 3300005840 Bacteria 4271
170 Ga0068863_100022090 3300005841 Bacteria 6075
171 Ga0068858_100084873 3300005842 Bacteria 2946
172 Ga0068860_100085876 3300005843 Bacteria 2994
173 Ga0081539_10000104 3300005985 Bacteria 197478
174 Ga0070716_100262947 3300006173 Bacteria 1182
175 Ga0070712_100787959 3300006175 Unclassified 815
176 Ga0097621_100117382 3300006237 Bacteria 2254
177 Ga0097621_100717043 3300006237 Archaea 922
178 Ga0068871_100294612 3300006358 Bacteria 1423
179 Ga0068871_100335212 3300006358 Bacteria 1335
180 Ga0075430_100000690 3300006846 Bacteria 25728
181 Ga0075434_100149581 3300006871 Bacteria 2355
182 Ga0075429_100662728 3300006880 Bacteria 914
183 Ga0068865_100026273 3300006881 Bacteria 3837
184 Ga0075436_100087192 3300006914 Bacteria 2168
185 Ga0097620_100045605 3300006931 Bacteria 4404
186 Ga0097620_100055350 3300006931 Bacteria 3992
187 Ga0075435_100347546 3300007076 Bacteria 1271
188 Ga0105240_10069855 3300009093 Bacteria 4346
189 Ga0105240_10305162 3300009093 Bacteria 1820
190 Ga0105240_10645977 3300009093 Bacteria 1160
191 Ga0105245_10080817 3300009098 Bacteria 2970
192 Ga0105245_10302685 3300009098 Unclassified 1569
193 Ga0105241_10026067 3300009174 Bacteria 4348
194 Ga0105241_10148483 3300009174 Bacteria 1915
195 Ga0105241_10383735 3300009174 Bacteria 1228
196 Ga0105241_11160117 3300009174 Unclassified 730
197 Ga0105242_10015592 3300009176 Bacteria 5905
198 Ga0105248_10018257 3300009177 Bacteria 7746
199 Ga0105248_10027272 3300009177 Bacteria 6356
200 Ga0105248_10100917 3300009177 Bacteria 3252
201 Ga0105248_10129236 3300009177 Bacteria 2850
202 Ga0105248_11075337 3300009177 Bacteria 909
203 Ga0105237_10473962 3300009545 Bacteria 1258
204 Ga0105238_10046967 3300009551 Bacteria 4354
205 Ga0105238_10082339 3300009551 Bacteria 3208
206 Ga0105238_10323435 3300009551 Unclassified 1528
207 Ga0105249_10952749 3300009553 Bacteria 926
208 Ga0105239_10533713 3300010375 Bacteria 1335
209 Ga0105239_10835283 3300010375 Bacteria 1056
210 Ga0105246_10007220 3300011119 Bacteria 6807
211 Ga0105246_10374713 3300011119 Bacteria 1174
212 Ga0157373_10073384 3300013100 Bacteria 2415
213 Ga0157373_10097847 3300013100 Bacteria 2065
214 Ga0157373_10131488 3300013100 Bacteria 1760
215 Ga0157373_10354828 3300013100 Bacteria 1046
216 Ga0157371_10004746 3300013102 Bacteria 11726
217 Ga0157371_10191966 3300013102 Bacteria 1463
218 Ga0157371_10200160 3300013102 Bacteria 1432
219 Ga0157371_10294653 3300013102 Bacteria 1174
220 Ga0157371_10463938 3300013102 Bacteria 932
221 Ga0157370_10011857 3300013104 Bacteria 9092
222 Ga0157370_10032178 3300013104 Bacteria 5123
223 Ga0157370_10210246 3300013104 Bacteria 1803
224 Ga0157370_11428342 3300013104 Bacteria 622
225 Ga0157369_10088226 3300013105 Bacteria 3310
226 Ga0157369_10098010 3300013105 Unclassified 3127
227 Ga0157369_10175162 3300013105 Bacteria 2258
228 Ga0157369_10701722 3300013105 Unclassified 1042
229 Ga0157374_10036578 3300013296 Bacteria 4498
230 Ga0157374_10050370 3300013296 Bacteria 3871
231 Ga0157374_10051334 3300013296 Bacteria 3837
232 Ga0157374_10121934 3300013296 Bacteria 2517
233 Ga0157378_10090033 3300013297 Bacteria 2788
234 Ga0157378_10626106 3300013297 Bacteria 1090
235 Ga0163162_10255345 3300013306 Bacteria 1885
236 Ga0163162_10479589 3300013306 Bacteria 1375
237 Ga0157372_10008170 3300013307 Bacteria 11124
238 Ga0157372_10064630 3300013307 Bacteria 4105
239 Ga0157372_10073422 3300013307 Bacteria 3856
240 Ga0157372_10084465 3300013307 Bacteria 3598
241 Ga0157372_10134106 3300013307 Unclassified 2851
242 Ga0157372_10147583 3300013307 Bacteria 2712
243 Ga0157372_10204496 3300013307 Bacteria 2288
244 Ga0157372_10632844 3300013307 Bacteria 1246
245 Ga0157372_11295434 3300013307 Bacteria 841
246 Ga0157375_10091896 3300013308 Bacteria 3097
247 Ga0157375_10478481 3300013308 Bacteria 1410
248 Ga0157375_10504766 3300013308 Bacteria 1373
249 Ga0157375_12124888 3300013308 Unclassified 668
250 Ga0163163_10280588 3300014325 Bacteria 1717
251 Ga0163163_10427658 3300014325 Bacteria 1383
252 Ga0163163_10614138 3300014325 Bacteria 1150
253 Ga0163163_11062025 3300014325 Bacteria 873
254 Ga0182008_10008443 3300014497 Bacteria 5622
255 Ga0157377_10002853 3300014745 Bacteria 7714
256 Ga0157377_10725588 3300014745 Unclassified 724
257 Ga0157379_10800749 3300014968 Bacteria 889
258 Ga0157376_10407640 3300014969 Bacteria 1316
259 Ga0163161_10028901 3300017792 Bacteria 3939
260 Ga0163161_10224128 3300017792 Bacteria 1457
261 Ga0206354_11290198 3300020081 Bacteria 634
262 Ga0213876_10006539 3300021384 Bacteria 6355
263 Ga0207656_10099520 3300025321 Bacteria 1331
264 Ga0207682_10051077 3300025893 Bacteria 1712
265 Ga0207682_10208807 3300025893 Bacteria 900
266 Ga0207688_10028700 3300025901 Bacteria 3060
267 Ga0207688_10475729 3300025901 Bacteria 781
268 Ga0207680_10281777 3300025903 Bacteria 1155
269 Ga0207680_10358991 3300025903 Bacteria 1024
270 Ga0207699_10008984 3300025906 Bacteria 4954
271 Ga0207645_10043905 3300025907 Bacteria 2860
272 Ga0207643_10032851 3300025908 Bacteria 2901
273 Ga0207643_10033301 3300025908 Bacteria 2882
274 Ga0207705_10005035 3300025909 Bacteria 9912
275 Ga0207705_10013335 3300025909 Bacteria 5928
276 Ga0207705_10149856 3300025909 Bacteria 1747
277 Ga0207705_10206500 3300025909 Bacteria 1489
278 Ga0207705_10662942 3300025909 Bacteria 811
279 Ga0207705_10691309 3300025909 Bacteria 793
280 Ga0207654_10059784 3300025911 Bacteria 2224
281 Ga0207654_10174476 3300025911 Bacteria 1398
282 Ga0207654_10430449 3300025911 Bacteria 922
283 Ga0207707_10000715 3300025912 Bacteria 32899
284 Ga0207707_10010372 3300025912 Bacteria 8084
285 Ga0207707_10016722 3300025912 Bacteria 6393
286 Ga0207707_10363564 3300025912 Bacteria 1246
287 Ga0207707_10701335 3300025912 Bacteria 850
288 Ga0207695_10266356 3300025913 Bacteria 1610
289 Ga0207695_10524053 3300025913 Bacteria 1067
290 Ga0207693_10721517 3300025915 Unclassified 771
291 Ga0207663_10188092 3300025916 Bacteria 1480
292 Ga0207660_10004526 3300025917 Bacteria 9062
293 Ga0207660_10008349 3300025917 Bacteria 6697
294 Ga0207660_10015257 3300025917 Bacteria 5069
295 Ga0207660_10024315 3300025917 Bacteria 4101
296 Ga0207660_10086674 3300025917 Unclassified 2312
297 Ga0207660_10368577 3300025917 Bacteria 1153
298 Ga0207660_10550090 3300025917 Bacteria 939
299 Ga0207662_10010331 3300025918 Bacteria 5154
300 Ga0207662_10208921 3300025918 Bacteria 1267
301 Ga0207657_10019716 3300025919 Bacteria 6395
302 Ga0207657_10033991 3300025919 Bacteria 4591
303 Ga0207657_10053199 3300025919 Bacteria 3508
304 Ga0207657_10338489 3300025919 Bacteria 1188
305 Ga0207657_10363956 3300025919 Bacteria 1140
306 Ga0207649_10011238 3300025920 Bacteria 4932
307 Ga0207649_10013236 3300025920 Bacteria 4602
308 Ga0207649_10067906 3300025920 Bacteria 2265
309 Ga0207649_10082680 3300025920 Bacteria 2082
310 Ga0207649_10234379 3300025920 Bacteria 1314
311 Ga0207652_10002191 3300025921 Bacteria 16688
312 Ga0207652_10014968 3300025921 Bacteria 6292
313 Ga0207652_10022789 3300025921 Bacteria 5186
314 Ga0207652_10118870 3300025921 Bacteria 2350
315 Ga0207652_10211766 3300025921 Bacteria 1745
316 Ga0207652_10689515 3300025921 Bacteria 912
317 Ga0207652_10877990 3300025921 Bacteria 793
318 Ga0207646_10181481 3300025922 Bacteria 1901
319 Ga0207646_10599568 3300025922 Unclassified 989
320 Ga0207646_10611484 3300025922 Bacteria 978
321 Ga0207646_11320578 3300025922 Unclassified 629
322 Ga0207681_10008060 3300025923 Bacteria 6445
323 Ga0207681_10848939 3300025923 Bacteria 764
324 Ga0207694_10123805 3300025924 Bacteria 2066
325 Ga0207694_10142583 3300025924 Bacteria 1927
326 Ga0207694_10216388 3300025924 Bacteria 1562
327 Ga0207650_10008166 3300025925 Bacteria 7137
328 Ga0207650_10323951 3300025925 Bacteria 1263
329 Ga0207650_10641225 3300025925 Bacteria 895
330 Ga0207650_10650456 3300025925 Bacteria 889
331 Ga0207659_10163441 3300025926 Bacteria 1750
332 Ga0207687_10041523 3300025927 Bacteria 3159
333 Ga0207700_11098217 3300025928 Bacteria 711
334 Ga0207664_10114843 3300025929 Bacteria 2244
335 Ga0207664_10362745 3300025929 Bacteria 1284
336 Ga0207664_10618024 3300025929 Unclassified 973
337 Ga0207644_10081797 3300025931 Bacteria 2388
338 Ga0207644_10195624 3300025931 Bacteria 1592
339 Ga0207644_10887065 3300025931 Bacteria 747
340 Ga0207690_10052742 3300025932 Unclassified 2725
341 Ga0207690_10478391 3300025932 Bacteria 1005
342 Ga0207690_10522328 3300025932 Bacteria 962
343 Ga0207706_10023427 3300025933 Bacteria 5544
344 Ga0207706_10294652 3300025933 Bacteria 1414
345 Ga0207706_10526901 3300025933 Bacteria 1018
346 Ga0207706_10715705 3300025933 Bacteria 855
347 Ga0207686_10008025 3300025934 Bacteria 5695
348 Ga0207709_10026082 3300025935 Bacteria 3353
349 Ga0207670_10244884 3300025936 Bacteria 1383
350 Ga0207670_10408417 3300025936 Bacteria 1087
351 Ga0207670_11315234 3300025936 Bacteria 613
352 Ga0207669_10388228 3300025937 Bacteria 1090
353 Ga0207669_10388553 3300025937 Bacteria 1089
354 Ga0207669_10455889 3300025937 Bacteria 1014
355 Ga0207669_10859280 3300025937 Bacteria 756
356 Ga0207704_10059657 3300025938 Bacteria 2356
357 Ga0207665_10039856 3300025939 Bacteria 3133
358 Ga0207665_10629500 3300025939 Bacteria 839
359 Ga0207665_10820473 3300025939 Unclassified 735
360 Ga0207691_10010639 3300025940 Bacteria 8828
361 Ga0207691_10084655 3300025940 Bacteria 2846
362 Ga0207691_10189122 3300025940 Bacteria 1796
363 Ga0207691_10235108 3300025940 Bacteria 1586
364 Ga0207711_10058416 3300025941 Bacteria 3319
365 Ga0207711_10189085 3300025941 Bacteria 1876
366 Ga0207711_10192853 3300025941 Bacteria 1857
367 Ga0207689_10005430 3300025942 Bacteria 11407
368 Ga0207661_10000603 3300025944 Bacteria 22981
369 Ga0207661_10008752 3300025944 Bacteria 7241
370 Ga0207661_10022792 3300025944 Bacteria 4722
371 Ga0207661_10045187 3300025944 Bacteria 3485
372 Ga0207661_10056010 3300025944 Bacteria 3164
373 Ga0207661_10078428 3300025944 Bacteria 2719
374 Ga0207661_10137410 3300025944 Bacteria 2100
375 Ga0207661_10147041 3300025944 Bacteria 2034
376 Ga0207661_10154318 3300025944 Bacteria 1987
377 Ga0207661_10269552 3300025944 Bacteria 1519
378 Ga0207661_10626533 3300025944 Bacteria 988
379 Ga0207661_10795937 3300025944 Bacteria 870
380 Ga0207661_11067996 3300025944 Unclassified 744
381 Ga0207679_10006138 3300025945 Bacteria 7586
382 Ga0207679_10006193 3300025945 Bacteria 7551
383 Ga0207679_10057214 3300025945 Bacteria 2883
384 Ga0207679_10156326 3300025945 Bacteria 1862
385 Ga0207679_10330825 3300025945 Bacteria 1322
386 Ga0207679_10424508 3300025945 Bacteria 1174
387 Ga0207667_10027602 3300025949 Bacteria 6175
388 Ga0207667_10059293 3300025949 Bacteria 4009
389 Ga0207667_10082504 3300025949 Bacteria 3330
390 Ga0207651_10071498 3300025960 Bacteria 2459
391 Ga0207651_10082444 3300025960 Bacteria 2322
392 Ga0207651_10436321 3300025960 Bacteria 1121
393 Ga0207651_10626665 3300025960 Bacteria 942
394 Ga0207668_10074766 3300025972 Bacteria 2433
395 Ga0207640_10716707 3300025981 Unclassified 859
396 Ga0207658_10041601 3300025986 Bacteria 3329
397 Ga0207658_10299392 3300025986 Bacteria 1385
398 Ga0207677_10096183 3300026023 Bacteria 2166
399 Ga0207677_10249961 3300026023 Bacteria 1439
400 Ga0207677_11052532 3300026023 Bacteria 740
401 Ga0207703_10276453 3300026035 Bacteria 1523
402 Ga0207703_10278939 3300026035 Bacteria 1517
403 Ga0207703_10357356 3300026035 Bacteria 1346
404 Ga0207639_10520835 3300026041 Bacteria 1089
405 Ga0207639_10680062 3300026041 Bacteria 954
406 Ga0207702_10125765 3300026078 Bacteria 2301
407 Ga0207702_10213785 3300026078 Bacteria 1794
408 Ga0207702_10523645 3300026078 Bacteria 1158
409 Ga0207641_10016919 3300026088 Bacteria 5970
410 Ga0207648_10051913 3300026089 Bacteria 3584
411 Ga0207648_10223314 3300026089 Bacteria 1675
412 Ga0207676_10126431 3300026095 Bacteria 2166
413 Ga0207676_10692608 3300026095 Bacteria 986
414 Ga0207674_10003042 3300026116 Bacteria 20752
415 Ga0207674_10009538 3300026116 Bacteria 11076
416 Ga0207674_10086500 3300026116 Bacteria 3129
417 Ga0207674_11067724 3300026116 Bacteria 777
418 Ga0207675_100873592 3300026118 Unclassified 915
419 Ga0207683_10098030 3300026121 Bacteria 2615
420 Ga0207683_10492873 3300026121 Bacteria 1131
421 Ga0207683_10544758 3300026121 Bacteria 1073
422 Ga0207698_10178391 3300026142 Bacteria 1879
423 Ga0207698_10183093 3300026142 Bacteria 1858
424 Ga0268265_10135508 3300028380 Bacteria 2054
425 Ga0307408_100170723 3300031548 Bacteria 1736
426 Ga0307408_101309219 3300031548 Bacteria 679
427 Ga0316576_10157541 3300031727 Bacteria 1712
428 Ga0307405_10068332 3300031731 Bacteria 2274
429 Ga0307405_10090276 3300031731 Bacteria 2026
430 Ga0307405_10379603 3300031731 Bacteria 1100
431 Ga0307413_10142801 3300031824 Bacteria 1657
432 Ga0307413_10796982 3300031824 Bacteria 794
433 Ga0307413_10946691 3300031824 Bacteria 734
434 Ga0307410_10051044 3300031852 Unclassified 2785
435 Ga0307410_10277007 3300031852 Unclassified 1315
436 Ga0307410_10780617 3300031852 Bacteria 811
437 Ga0307406_10045575 3300031901 Bacteria 2754
438 Ga0307406_10078899 3300031901 Bacteria 2182
439 Ga0307406_10654922 3300031901 Bacteria 872
440 Ga0307406_11296355 3300031901 Bacteria 635
441 Ga0307407_10020630 3300031903 Bacteria 3381
442 Ga0307407_10067357 3300031903 Bacteria 2116
443 Ga0307407_10116436 3300031903 Bacteria 1686
444 Ga0307407_10570889 3300031903 Unclassified 839
445 Ga0307412_10037866 3300031911 Bacteria 3101
446 Ga0307412_10243371 3300031911 Unclassified 1393
447 Ga0307409_100136859 3300031995 Bacteria 2103
448 Ga0307409_100152706 3300031995 Bacteria 2007
449 Ga0307409_100951063 3300031995 Bacteria 875
450 Ga0307416_100072600 3300032002 Bacteria 2865
451 Ga0307416_100183964 3300032002 Bacteria 1962
452 Ga0307416_100316496 3300032002 Bacteria 1560
453 Ga0307416_100964440 3300032002 Bacteria 955
454 Ga0307416_101770252 3300032002 Bacteria 722
455 Ga0307414_10160495 3300032004 Bacteria 1785
456 Ga0307414_10172428 3300032004 Bacteria 1731
457 Ga0307411_10160777 3300032005 Bacteria 1682
458 Ga0307411_10365711 3300032005 Bacteria 1181
459 Ga0307411_10658937 3300032005 Bacteria 907
460 Ga0307411_11215294 3300032005 Unclassified 684
461 Ga0307415_100076109 3300032126 Bacteria 2378
462 Ga0307415_100086048 3300032126 Bacteria 2261
463 Ga0307415_100154066 3300032126 Bacteria 1772
464 Ga0307415_100800323 3300032126 Bacteria 860
465 Ga0307415_101495548 3300032126 Unclassified 646
466 Ga0373928_0095214 3300035084 Bacteria 770
467 Ga0373931_0003607 3300035691 Bacteria 6990
468 Ga0373937_0263350 3300036401 Bacteria 1626
469 Ga0373937_0500333 3300036401 Bacteria 1155
470 Ga0395905_0043876 3300037471 Bacteria 4196
471 Ga0436364_0545367 3300037853 Bacteria 677
472 Ga0436365_0677632 3300039437 Bacteria 1309
473 Ga0436365_1071216 3300039437 Bacteria 7995
474 Ga0436365_1221332 3300039437 Unclassified 934
475 Ga0451853_0663991 3300041512 Bacteria 1235
476 Ga0451577_1045012 3300042876 Unclassified 732
477 Ga0453684_0133431 3300044712 Bacteria 2976
478 Ga0466971_0288129 3300044719 Bacteria 787
479 Ga0466957_0222243 3300044842 Bacteria 1247
480 Ga0451576_0038762 3300045051 Bacteria 5044
481 Ga0451576_0044365 3300045051 Bacteria 4687
482 Ga0466958_0303699 3300045836 Bacteria 1025
483 Ga0466967_0012163 3300045976 Bacteria 6567
484 Ga0466967_0288436 3300045976 Bacteria 1576
485 Ga0495592_0175238 3300046454 Bacteria 1465
486 Ga0495603_0037180 3300046455 Bacteria 2921
487 Ga0495629_0011508 3300046459 Bacteria 6427
488 Ga0495651_0116884 3300046462 Bacteria 1964
489 Ga0495653_0042936 3300046463 Bacteria 3518
490 Ga0495582_0024601 3300046473 Bacteria 3296
491 Ga0495605_0342601 3300046474 Bacteria 628
492 Ga0495662_0223382 3300046476 Bacteria 928
493 Ga0495664_0053627 3300046477 Bacteria 2398
494 Ga0495594_0053292 3300046499 Bacteria 2228
495 Ga0495594_0531964 3300046499 Unclassified 667
496 Ga0495596_0117848 3300046500 Bacteria 1031
497 Ga0495608_0254031 3300046511 Bacteria 1095
498 Ga0495628_0215202 3300046516 Bacteria 1444
499 Ga0495630_0105924 3300046517 Bacteria 2129
500 Ga0495663_0018672 3300046525 Bacteria 1976
501 Ga0495665_0079945 3300046531 Bacteria 1720
502 Ga0495587_0024676 3300046536 Bacteria 3682
503 Ga0495587_0184556 3300046536 Bacteria 1182
504 Ga0495587_0434968 3300046536 Bacteria 727
505 Ga0495621_0017544 3300046539 Bacteria 2315
506 Ga0495645_0022805 3300046543 Bacteria 4530
507 Ga0495645_0224642 3300046543 Bacteria 1261
508 Ga0495667_0042010 3300046559 Bacteria 3031
509 Ga0495635_0160786 3300046663 Bacteria 1528
510 Ga0495659_0313253 3300046664 Unclassified 665
511 Ga0495659_0322490 3300046664 Bacteria 656
512 Ga0495588_0147389 3300046674 Bacteria 1244
513 Ga0495657_0151221 3300046675 Bacteria 1441
514 Ga0495599_0010737 3300046678 Bacteria 5609
515 Ga0495623_0274463 3300046679 Bacteria 940
516 Ga0495646_0052392 3300046680 Bacteria 2465
517 Ga0495658_0029808 3300046683 Bacteria 2957
518 Ga0495658_0576026 3300046683 Unclassified 721
519 Ga0495613_0033187 3300046689 Bacteria 3836
520 Ga0495613_0489268 3300046689 Bacteria 829
521 Ga0495624_0332709 3300046690 Bacteria 914
522 Ga0495581_0020333 3300047315 Bacteria 3854
523 Ga0495604_0374170 3300047317 Unclassified 942
524 Ga0495604_0558327 3300047317 Bacteria 738
525 Ga0495636_0144810 3300047318 Bacteria 1063
526 Ga0495674_0064105 3300047319 Bacteria 3195
527 Ga0495680_0007047 3300047322 Bacteria 10361
528 Ga0495675_0018245 3300047444 Bacteria 4453
529 Ga0495684_0063745 3300047471 Bacteria 2801
530 Ga0495602_0098340 3300048088 Bacteria 2408
531 Ga0496101_0139180 3300048904 Bacteria 1849
532 Ga0496104_0125062 3300048907 Bacteria 2469
533 Ga0496104_0651202 3300048907 Bacteria 962
534 Ga0496105_0322364 3300048908 Bacteria 1238
535 Ga0496107_0115244 3300048910 Bacteria 1978
536 Ga0496108_0236055 3300048911 Bacteria 1590
537 Ga0496109_0160662 3300048912 Bacteria 2105
538 Ga0496109_0210664 3300048912 Bacteria 1828
539 Ga0496109_1232334 3300048912 Bacteria 685
540 Ga0496110_0517218 3300048913 Bacteria 1086
541 Ga0496110_0598663 3300048913 Bacteria 1000
542 Ga0496111_0165076 3300048914 Bacteria 1645
543 Ga0496112_0310783 3300048915 Bacteria 1521
544 Ga0496112_1250326 3300048915 Unclassified 659
545 Ga0496114_0682663 3300048917 Bacteria 902
546 Ga0501309_022039 3300049129 Bacteria 899
547 Ga0501292_024640 3300049515 Unclassified 988
548 Ga0501298_046068 3300049521 Bacteria 894
549 Ga0501032_0063159 3300049569 Bacteria 2479
550 Ga0501033_0100366 3300049570 Bacteria 2112
551 Ga0501034_0093952 3300049571 Bacteria 2996
552 Ga0501034_0102110 3300049571 Bacteria 2861
553 Ga0501034_0104161 3300049571 Bacteria 2831
554 Ga0501036_0043351 3300049572 Bacteria 3810
555 Ga0501037_0036598 3300049573 Bacteria 3617
556 Ga0501038_0078129 3300049574 Bacteria 2793
557 Ga0501038_0638958 3300049574 Bacteria 802
558 Ga0501039_0329943 3300049575 Bacteria 1199
559 Ga0501043_0072868 3300049579 Bacteria 2698
560 Ga0501043_0075177 3300049579 Bacteria 2654
561 Ga0501043_0123168 3300049579 Bacteria 2033
562 Ga0501046_0123051 3300049580 Bacteria 1973
563 Ga0501046_0417900 3300049580 Bacteria 967
564 Ga0501047_0001564 3300049581 Bacteria 22388
565 Ga0501047_0091003 3300049581 Bacteria 2928
566 Ga0501047_0208053 3300049581 Bacteria 1816
567 Ga0501069_0119331 3300049585 Bacteria 1506
568 Ga0501070_0036464 3300049586 Bacteria 4106
569 Ga0501073_0274168 3300049589 Bacteria 1164
570 Ga0501198_015016 3300049649 Bacteria 1186
571 Ga0501202_022126 3300049652 Bacteria 1275
572 Ga0501211_010377 3300049658 Bacteria 912
573 Ga0501216_063612 3300049660 Unclassified 749
574 Ga0501217_006782 3300049661 Bacteria 2442
575 Ga0501223_013401 3300049663 Bacteria 1633
576 Ga0501224_002868 3300049664 Bacteria 2376
577 Ga0501227_130050 3300049665 Bacteria 685
578 Ga0501233_008491 3300049668 Bacteria 1981
579 Ga0501239_003693 3300049672 Bacteria 1469
580 Ga0501240_048879 3300049673 Unclassified 721
581 Ga0501243_004355 3300049675 Bacteria 2121
582 Ga0501243_064310 3300049675 Unclassified 686
583 Ga0501247_068742 3300049677 Unclassified 556
584 Ga0501249_005862 3300049679 Bacteria 2514
585 Ga0501249_099626 3300049679 Bacteria 695
586 Ga0501257_003483 3300049686 Bacteria 3376
587 Ga0501261_004376 3300049690 Bacteria 1744
588 Ga0501221_001170 3300049704 Bacteria 4340
589 Ga0501225_0002311 3300049705 Bacteria 5891
590 Ga0501234_001216 3300049707 Bacteria 4062
591 Ga0501080_0245671 3300049742 Bacteria 1633
592 Ga0501080_0355140 3300049742 Bacteria 1323
593 Ga0501081_0307410 3300049743 Bacteria 1164
594 Ga0501262_004402 3300049759 Bacteria 1633
595 Ga0501266_002864 3300049763 Bacteria 2151
596 Ga0501272_013018 3300049769 Bacteria 950
597 Ga0501275_038219 3300049772 Unclassified 663
598 Ga0501035_0013494 3300049822 Bacteria 7541
599 Ga0501035_0580472 3300049822 Unclassified 916
600 Ga0501044_0005534 3300049823 Bacteria 14018
601 Ga0501044_0194713 3300049823 Bacteria 1988
602 Ga0501044_0350060 3300049823 Bacteria 1397
603 nmdc:mga09592_632959_c1 3300050508 Bacteria 914
604 nmdc:mga0qj67_453_c1 3300050509 Bacteria 28026
605 nmdc:mga0rr50_336245_c1 3300050513 Bacteria 1268
606 nmdc:mga0rr50_694663_c1 3300050513 Bacteria 868
607 Ga0495601_0171239 3300053077 Bacteria 1419
608 Ga0495595_0609643 3300053084 Unclassified 558
609 Ga0316583_10000465
610 JGI25406J46586_10013506
611 Ga0058862_12889962
612 Ga0065715_10216618
613 Ga0070658_10002623
614 Ga0070658_10013188
615 Ga0070658_10064622
616 Ga0070658_10104841
617 Ga0070658_10693706
618 Ga0070658_11288116
619 Ga0070658_11331233
620 Ga0070683_100006808
621 Ga0070683_100074339
622 Ga0070683_100077853
623 Ga0070683_100160367
624 Ga0070683_100169555
625 Ga0070683_100230294
626 Ga0070683_100256649
627 Ga0070683_100631168
628 Ga0070683_100740483
629 Ga0070690_100073370
630 Ga0070690_100173392
631 Ga0070690_100268129
632 Ga0070670_100122344
633 Ga0070670_100168152
634 Ga0070670_100791949
635 Ga0070670_101058471
636 Ga0068869_100006384
637 Ga0070666_10507467
638 Ga0070666_10785433
639 Ga0070680_100003091
640 Ga0070680_100006424
641 Ga0070680_100041283
642 Ga0070680_100081935
643 Ga0070680_100394337
644 Ga0070682_100001044
645 Ga0070682_100013735
646 Ga0070682_100020384
647 Ga0068868_100027746
648 Ga0070660_100041003
649 Ga0070660_100110784
650 Ga0070660_100301106
651 Ga0070660_100973393
652 Ga0070689_100295674
653 Ga0070689_100742436
654 Ga0070687_100019194
655 Ga0070661_100003156
656 Ga0070661_100016504
657 Ga0070661_100022175
658 Ga0070661_100092933
659 Ga0070661_100359763
660 Ga0070661_100662826
661 Ga0070692_10251864
662 Ga0070668_100050222
663 Ga0070669_100008212
664 Ga0070675_100002689
665 Ga0070675_100125004
666 Ga0070675_100150592
667 Ga0070675_100186503
668 Ga0070671_100049361
669 Ga0070671_101335129
670 Ga0070674_100008707
671 Ga0070674_100474782
672 Ga0070674_100550641
673 Ga0070673_100101680
674 Ga0070673_100211723
675 Ga0070673_100376672
676 Ga0070688_100129664
677 Ga0070688_100787176
678 Ga0070659_100048807
679 Ga0070659_100109744
680 Ga0070659_100251408
681 Ga0070659_101035786
682 Ga0070667_100193556
683 Ga0070667_100445021
684 Ga0070709_10045407
685 Ga0070714_100291657
686 Ga0070714_100382213
687 Ga0070714_100570625
688 Ga0070713_100241927
689 Ga0070705_100041590
690 Ga0070662_100021848
691 Ga0070662_100415694
692 Ga0070662_100460351
693 Ga0070681_10002263
694 Ga0070681_10009188
695 Ga0070681_10013984
696 Ga0070681_10058920
697 Ga0070681_10383086
698 Ga0070681_10688364
699 Ga0068867_100019118
700 Ga0068867_100094480
701 Ga0070685_10691089
702 Ga0070707_100235886
703 Ga0070707_100254171
704 Ga0070707_100403762
705 Ga0070698_100027140
706 Ga0070698_100063534
707 Ga0070698_100501063
708 Ga0070699_100094064
709 Ga0070699_100465922
710 Ga0070699_101116778
711 Ga0070679_100000347
712 Ga0070679_100000771
713 Ga0070679_100005458
714 Ga0070679_100010982
715 Ga0070679_100187463
716 Ga0070679_100226817
717 Ga0070679_100372918
718 Ga0070679_100581300
719 Ga0070684_100024221
720 Ga0070684_100036980
721 Ga0070684_100051479
722 Ga0070684_100057546
723 Ga0070684_100091205
724 Ga0070684_100115504
725 Ga0070684_100135017
726 Ga0070684_100169045
727 Ga0070684_100388578
728 Ga0070684_100472634
729 Ga0070697_100279970
730 Ga0068853_100082846
731 Ga0068853_100341361
732 Ga0068853_100460768
733 Ga0068853_101033028
734 Ga0070672_100037576
735 Ga0070672_100044335
736 Ga0070672_101337586
737 Ga0070686_100251113
738 Ga0070696_100000465
739 Ga0070693_100008947
740 Ga0070693_100034496
741 Ga0070693_100341586
742 Ga0070693_100998170
743 Ga0070665_101243485
744 Ga0070704_100322940
745 Ga0068855_100091154
746 Ga0068855_100151539
747 Ga0068855_100167687
748 Ga0068855_100170219
749 Ga0068855_100217020
750 Ga0068855_100428527
751 Ga0068855_101014772
752 Ga0070664_100000208
753 Ga0070664_100088737
754 Ga0070664_100150011
755 Ga0070664_100340804
756 Ga0070664_100605334
757 Ga0070664_100770396
758 Ga0070664_100799501
759 Ga0070664_100995684
760 Ga0068857_100051782
761 Ga0068857_100244538
762 Ga0068857_100251090
763 Ga0068854_100064293
764 Ga0068856_100058875
765 Ga0068856_100257624
766 Ga0070702_100013232
767 Ga0068852_100070096
768 Ga0068852_101168289
769 Ga0068852_101416730
770 Ga0068859_100045605
771 Ga0068859_100055346
772 Ga0068864_100038123
773 Ga0068864_100053429
774 Ga0068864_100714138
775 Ga0068851_10122090
776 Ga0068851_10434234
777 Ga0068870_10010428
778 Ga0068863_100022090
779 Ga0068858_100084873
780 Ga0068860_100085876
781 Ga0081539_10000104
782 Ga0070716_100262947
783 Ga0070712_100787959
784 Ga0097621_100117382
785 Ga0097621_100717043
786 Ga0068871_100294612
787 Ga0068871_100335212
788 Ga0075430_100000690
789 Ga0075434_100149581
790 Ga0075429_100662728
791 Ga0068865_100026273
792 Ga0075436_100087192
793 Ga0097620_100045605
794 Ga0097620_100055350
795 Ga0075435_100347546
796 Ga0105240_10069855
797 Ga0105240_10305162
798 Ga0105240_10645977
799 Ga0105245_10080817
800 Ga0105245_10302685
801 Ga0105241_10026067
802 Ga0105241_10148483
803 Ga0105241_10383735
804 Ga0105241_11160117
805 Ga0105242_10015592
806 Ga0105248_10018257
807 Ga0105248_10027272
808 Ga0105248_10100917
809 Ga0105248_10129236
810 Ga0105248_11075337
811 Ga0105237_10473962
812 Ga0105238_10046967
813 Ga0105238_10082339
814 Ga0105238_10323435
815 Ga0105249_10952749
816 Ga0105239_10533713
817 Ga0105239_10835283
818 Ga0105246_10007220
819 Ga0105246_10374713
820 Ga0157373_10073384
821 Ga0157373_10097847
822 Ga0157373_10131488
823 Ga0157373_10354828
824 Ga0157371_10004746
825 Ga0157371_10191966
826 Ga0157371_10200160
827 Ga0157371_10294653
828 Ga0157371_10463938
829 Ga0157370_10011857
830 Ga0157370_10032178
831 Ga0157370_10210246
832 Ga0157370_11428342
833 Ga0157369_10088226
834 Ga0157369_10098010
835 Ga0157369_10175162
836 Ga0157369_10701722
837 Ga0157374_10036578
838 Ga0157374_10050370
839 Ga0157374_10051334
840 Ga0157374_10121934
841 Ga0157378_10090033
842 Ga0157378_10626106
843 Ga0163162_10255345
844 Ga0163162_10479589
845 Ga0157372_10008170
846 Ga0157372_10064630
847 Ga0157372_10073422
848 Ga0157372_10084465
849 Ga0157372_10134106
850 Ga0157372_10147583
851 Ga0157372_10204496
852 Ga0157372_10632844
853 Ga0157372_11295434
854 Ga0157375_10091896
855 Ga0157375_10478481
856 Ga0157375_10504766
857 Ga0157375_12124888
858 Ga0163163_10280588
859 Ga0163163_10427658
860 Ga0163163_10614138
861 Ga0163163_11062025
862 Ga0182008_10008443
863 Ga0157377_10002853
864 Ga0157377_10725588
865 Ga0157379_10800749
866 Ga0157376_10407640
867 Ga0163161_10028901
868 Ga0163161_10224128
869 Ga0206354_11290198
870 Ga0213876_10006539
871 Ga0207656_10099520
872 Ga0207682_10051077
873 Ga0207682_10208807
874 Ga0207688_10028700
875 Ga0207688_10475729
876 Ga0207680_10281777
877 Ga0207680_10358991
878 Ga0207699_10008984
879 Ga0207645_10043905
880 Ga0207643_10032851
881 Ga0207643_10033301
882 Ga0207705_10005035
883 Ga0207705_10013335
884 Ga0207705_10149856
885 Ga0207705_10206500
886 Ga0207705_10662942
887 Ga0207705_10691309
888 Ga0207654_10059784
889 Ga0207654_10174476
890 Ga0207654_10430449
891 Ga0207707_10000715
892 Ga0207707_10010372
893 Ga0207707_10016722
894 Ga0207707_10363564
895 Ga0207707_10701335
896 Ga0207695_10266356
897 Ga0207695_10524053
898 Ga0207693_10721517
899 Ga0207663_10188092
900 Ga0207660_10004526
901 Ga0207660_10008349
902 Ga0207660_10015257
903 Ga0207660_10024315
904 Ga0207660_10086674
905 Ga0207660_10368577
906 Ga0207660_10550090
907 Ga0207662_10010331
908 Ga0207662_10208921
909 Ga0207657_10019716
910 Ga0207657_10033991
911 Ga0207657_10053199
912 Ga0207657_10338489
913 Ga0207657_10363956
914 Ga0207649_10011238
915 Ga0207649_10013236
916 Ga0207649_10067906
917 Ga0207649_10082680
918 Ga0207649_10234379
919 Ga0207652_10002191
920 Ga0207652_10014968
921 Ga0207652_10022789
922 Ga0207652_10118870
923 Ga0207652_10211766
924 Ga0207652_10689515
925 Ga0207652_10877990
926 Ga0207646_10181481
927 Ga0207646_10599568
928 Ga0207646_10611484
929 Ga0207646_11320578
930 Ga0207681_10008060
931 Ga0207681_10848939
932 Ga0207694_10123805
933 Ga0207694_10142583
934 Ga0207694_10216388
935 Ga0207650_10008166
936 Ga0207650_10323951
937 Ga0207650_10641225
938 Ga0207650_10650456
939 Ga0207659_10163441
940 Ga0207687_10041523
941 Ga0207700_11098217
942 Ga0207664_10114843
943 Ga0207664_10362745
944 Ga0207664_10618024
945 Ga0207644_10081797
946 Ga0207644_10195624
947 Ga0207644_10887065
948 Ga0207690_10052742
949 Ga0207690_10478391
950 Ga0207690_10522328
951 Ga0207706_10023427
952 Ga0207706_10294652
953 Ga0207706_10526901
954 Ga0207706_10715705
955 Ga0207686_10008025
956 Ga0207709_10026082
957 Ga0207670_10244884
958 Ga0207670_10408417
959 Ga0207670_11315234
960 Ga0207669_10388228
961 Ga0207669_10388553
962 Ga0207669_10455889
963 Ga0207669_10859280
964 Ga0207704_10059657
965 Ga0207665_10039856
966 Ga0207665_10629500
967 Ga0207665_10820473
968 Ga0207691_10010639
969 Ga0207691_10084655
970 Ga0207691_10189122
971 Ga0207691_10235108
972 Ga0207711_10058416
973 Ga0207711_10189085
974 Ga0207711_10192853
975 Ga0207689_10005430
976 Ga0207661_10000603
977 Ga0207661_10008752
978 Ga0207661_10022792
979 Ga0207661_10045187
980 Ga0207661_10056010
981 Ga0207661_10078428
982 Ga0207661_10137410
983 Ga0207661_10147041
984 Ga0207661_10154318
985 Ga0207661_10269552
986 Ga0207661_10626533
987 Ga0207661_10795937
988 Ga0207661_11067996
989 Ga0207679_10006138
990 Ga0207679_10006193
991 Ga0207679_10057214
992 Ga0207679_10156326
993 Ga0207679_10330825
994 Ga0207679_10424508
995 Ga0207667_10027602
996 Ga0207667_10059293
997 Ga0207667_10082504
998 Ga0207651_10071498
999 Ga0207651_10082444
1000 Ga0207651_10436321
1001 Ga0207651_10626665
1002 Ga0207668_10074766
1003 Ga0207640_10716707
1004 Ga0207658_10041601
1005 Ga0207658_10299392
1006 Ga0207677_10096183
1007 Ga0207677_10249961
1008 Ga0207677_11052532
1009 Ga0207703_10276453
1010 Ga0207703_10278939
1011 Ga0207703_10357356
1012 Ga0207639_10520835
1013 Ga0207639_10680062
1014 Ga0207702_10125765
1015 Ga0207702_10213785
1016 Ga0207702_10523645
1017 Ga0207641_10016919
1018 Ga0207648_10051913
1019 Ga0207648_10223314
1020 Ga0207676_10126431
1021 Ga0207676_10692608
1022 Ga0207674_10003042
1023 Ga0207674_10009538
1024 Ga0207674_10086500
1025 Ga0207674_11067724
1026 Ga0207675_100873592
1027 Ga0207683_10098030
1028 Ga0207683_10492873
1029 Ga0207683_10544758
1030 Ga0207698_10178391
1031 Ga0207698_10183093
1032 Ga0268265_10135508
1033 Ga0307408_100170723
1034 Ga0307408_101309219
1035 Ga0316576_10157541
1036 Ga0307405_10068332
1037 Ga0307405_10090276
1038 Ga0307405_10379603
1039 Ga0307413_10142801
1040 Ga0307413_10796982
1041 Ga0307413_10946691
1042 Ga0307410_10051044
1043 Ga0307410_10277007
1044 Ga0307410_10780617
1045 Ga0307406_10045575
1046 Ga0307406_10078899
1047 Ga0307406_10654922
1048 Ga0307406_11296355
1049 Ga0307407_10020630
1050 Ga0307407_10067357
1051 Ga0307407_10116436
1052 Ga0307407_10570889
1053 Ga0307412_10037866
1054 Ga0307412_10243371
1055 Ga0307409_100136859
1056 Ga0307409_100152706
1057 Ga0307409_100951063
1058 Ga0307416_100072600
1059 Ga0307416_100183964
1060 Ga0307416_100316496
1061 Ga0307416_100964440
1062 Ga0307416_101770252
1063 Ga0307414_10160495
1064 Ga0307414_10172428
1065 Ga0307411_10160777
1066 Ga0307411_10365711
1067 Ga0307411_10658937
1068 Ga0307411_11215294
1069 Ga0307415_100076109
1070 Ga0307415_100086048
1071 Ga0307415_100154066
1072 Ga0307415_100800323
1073 Ga0307415_101495548
1074 Ga0373928_0095214
1075 Ga0373931_0003607
1076 Ga0373937_0263350
1077 Ga0373937_0500333
1078 Ga0395905_0043876
1079 Ga0436364_0545367
1080 Ga0436365_0677632
1081 Ga0436365_1071216
1082 Ga0436365_1221332
1083 Ga0451853_0663991
1084 Ga0451577_1045012
1085 Ga0453684_0133431
1086 Ga0466971_0288129
1087 Ga0466957_0222243
1088 Ga0451576_0038762
1089 Ga0451576_0044365
1090 Ga0466958_0303699
1091 Ga0466967_0012163
1092 Ga0466967_0288436
1093 Ga0495592_0175238
1094 Ga0495603_0037180
1095 Ga0495629_0011508
1096 Ga0495651_0116884
1097 Ga0495653_0042936
1098 Ga0495582_0024601
1099 Ga0495605_0342601
1100 Ga0495662_0223382
1101 Ga0495664_0053627
1102 Ga0495594_0053292
1103 Ga0495594_0531964
1104 Ga0495596_0117848
1105 Ga0495608_0254031
1106 Ga0495628_0215202
1107 Ga0495630_0105924
1108 Ga0495663_0018672
1109 Ga0495665_0079945
1110 Ga0495587_0024676
1111 Ga0495587_0184556
1112 Ga0495587_0434968
1113 Ga0495621_0017544
1114 Ga0495645_0022805
1115 Ga0495645_0224642
1116 Ga0495667_0042010
1117 Ga0495635_0160786
1118 Ga0495659_0313253
1119 Ga0495659_0322490
1120 Ga0495588_0147389
1121 Ga0495657_0151221
1122 Ga0495599_0010737
1123 Ga0495623_0274463
1124 Ga0495646_0052392
1125 Ga0495658_0029808
1126 Ga0495658_0576026
1127 Ga0495613_0033187
1128 Ga0495613_0489268
1129 Ga0495624_0332709
1130 Ga0495581_0020333
1131 Ga0495604_0374170
1132 Ga0495604_0558327
1133 Ga0495636_0144810
1134 Ga0495674_0064105
1135 Ga0495680_0007047
1136 Ga0495675_0018245
1137 Ga0495684_0063745
1138 Ga0495602_0098340
1139 Ga0496101_0139180
1140 Ga0496104_0125062
1141 Ga0496104_0651202
1142 Ga0496105_0322364
1143 Ga0496107_0115244
1144 Ga0496108_0236055
1145 Ga0496109_0160662
1146 Ga0496109_0210664
1147 Ga0496109_1232334
1148 Ga0496110_0517218
1149 Ga0496110_0598663
1150 Ga0496111_0165076
1151 Ga0496112_0310783
1152 Ga0496112_1250326
1153 Ga0496114_0682663
1154 Ga0501309_022039
1155 Ga0501292_024640
1156 Ga0501298_046068
1157 Ga0501032_0063159
1158 Ga0501033_0100366
1159 Ga0501034_0093952
1160 Ga0501034_0102110
1161 Ga0501034_0104161
1162 Ga0501036_0043351
1163 Ga0501037_0036598
1164 Ga0501038_0078129
1165 Ga0501038_0638958
1166 Ga0501039_0329943
1167 Ga0501043_0072868
1168 Ga0501043_0075177
1169 Ga0501043_0123168
1170 Ga0501046_0123051
1171 Ga0501046_0417900
1172 Ga0501047_0001564
1173 Ga0501047_0091003
1174 Ga0501047_0208053
1175 Ga0501069_0119331
1176 Ga0501070_0036464
1177 Ga0501073_0274168
1178 Ga0501198_015016
1179 Ga0501202_022126
1180 Ga0501211_010377
1181 Ga0501216_063612
1182 Ga0501217_006782
1183 Ga0501223_013401
1184 Ga0501224_002868
1185 Ga0501227_130050
1186 Ga0501233_008491
1187 Ga0501239_003693
1188 Ga0501240_048879
1189 Ga0501243_004355
1190 Ga0501243_064310
1191 Ga0501247_068742
1192 Ga0501249_005862
1193 Ga0501249_099626
1194 Ga0501257_003483
1195 Ga0501261_004376
1196 Ga0501221_001170
1197 Ga0501225_0002311
1198 Ga0501234_001216
1199 Ga0501080_0245671
1200 Ga0501080_0355140
1201 Ga0501081_0307410
1202 Ga0501262_004402
1203 Ga0501266_002864
1204 Ga0501272_013018
1205 Ga0501275_038219
1206 Ga0501035_0013494
1207 Ga0501035_0580472
1208 Ga0501044_0005534
1209 Ga0501044_0194713
1210 Ga0501044_0350060
1211 nmdc:mga09592_632959_c1
1212 nmdc:mga0qj67_453_c1
1213 nmdc:mga0rr50_336245_c1
1214 nmdc:mga0rr50_694663_c1
1215 Ga0495601_0171239
1216 Ga0495595_0609643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

10

172

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cny-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense 0.8487 135 166
6yc7-assembly1.cif.gz_F structure of adenylylated c. glutamicum glnk 0.8432 135 166
4rwx-assembly1.cif.gz_C crystal structure of l. monocytogenes psta 0.8185 131 166
1hwu-assembly3.cif.gz_F-2 structure of pii protein from herbaspirillum seropedicae 0.808 133 166
4rwx-assembly1.cif.gz_B crystal structure of l. monocytogenes psta 0.8036 133 166
ID Description Score Start End Superfamily
af_Q58782_231_319_3.30.70.1380 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transcriptional regulatory protein pf0864 domain like 0.8462 135 165 3.30.70.1380
af_A0A0R0F7P8_38_136_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8162 51 119 1.10.10.1740
af_P46586_221_292_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8067 135 166 3.30.70.120
5u99A03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7677 135 166 3.30.70.120
af_Q58601_216_288_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7609 134 166 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A1F6LJ64-F1-model_v4 Uncharacterized protein 0.7516 47 114
AF-A0A1H6H2H5-F1-model_v4 Uncharacterized protein 0.7465 50 121 GO:0016020
AF-A0A6P0YWT5-F1-model_v4 HAMP domain-containing protein 0.6759 41 118 GO:0007165
GO:0016020
AF-A0A7C2F4Z7-F1-model_v4 DUF3341 domain-containing protein 0.6655 38 120 GO:0005886
AF-A0A6L8F5S8-F1-model_v4 deleted 0.6547 2 165

Map