F468768

General Info

Members Datasets Scaffolds Average Seq Length
608 277 1216 403

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100111071|Ga0070708_1001110712
Length 447
Sequence MTSPTNARKVRSDTQEASIGGVPEYRSILRWPTALERRIAARYLQSRRSSRAASLNTIIAIGGVAVGVMALIVVLGVMNGLRDDLRERILVANPHLRVLTFGAGLRVDDWRRVLAEVKRDPEVVAAAPEVISQAGISAGHDYGEGVNLLGFDPDTGSRSVTTFPQSIKKGDLSFRPTRTDVDGAVLLGTRLSSRLTVYPGDVVTLVPVTQAKVNPALGVAVPKFWKFEVTGLFDTGMFQYDNQFVVVSREMAQKFTGLNDAVSGIAVRVTDPELAPEVGRRIEDRLGYPFRTLDWQTQNASLFSALELEKLAMGLIIFFIMVVAAFNIVGTLTMVVTDKTREIGILQAMGVTAPSVARVFLAQGAIIGLAGTVLGLLGGLAVSYVVDRSGWIRINPAVYFIDHLPVHVEAVDVLWVVLASLAIAVLATLYPSRSAARLTPVDAIRHE

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
251 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
252 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
253 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
254 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
260 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
261 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.58
Rhizosphere 92.76
Stem 0
Stem Tuber 0
Unclassified 2.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100111071 3300005445 Bacteria 2520
2 JGI25406J46586_10015546 3300003203 Bacteria 3206
3 Ga0058863_11778499 3300004799 Bacteria 1904
4 Ga0065712_10093215 3300005290 Bacteria 2301
5 Ga0070676_10006398 3300005328 Bacteria 6292
6 Ga0070683_100030849 3300005329 Bacteria 4870
7 Ga0070683_100044943 3300005329 Bacteria 4076
8 Ga0070683_100044960 3300005329 Bacteria 4075
9 Ga0070690_100006496 3300005330 Bacteria 6629
10 Ga0070690_100057097 3300005330 Bacteria 2505
11 Ga0070670_100146323 3300005331 Bacteria 2044
12 Ga0068869_100002242 3300005334 Bacteria 11635
13 Ga0068869_100187683 3300005334 Bacteria 1624
14 Ga0070680_100000558 3300005336 Bacteria 25472
15 Ga0070680_100002002 3300005336 Bacteria 15003
16 Ga0070680_100003736 3300005336 Bacteria 11374
17 Ga0070680_100012464 3300005336 Bacteria 6608
18 Ga0070680_100013520 3300005336 Bacteria 6357
19 Ga0070680_100130169 3300005336 Bacteria 2105
20 Ga0068868_100183916 3300005338 Bacteria 1735
21 Ga0070660_100163593 3300005339 Bacteria 1794
22 Ga0070689_100226722 3300005340 Bacteria 1535
23 Ga0070661_100092678 3300005344 Bacteria 2238
24 Ga0070692_10037769 3300005345 Bacteria 2457
25 Ga0070668_100054518 3300005347 Bacteria 3084
26 Ga0070669_100048795 3300005353 Bacteria 3090
27 Ga0070669_100052740 3300005353 Bacteria 2976
28 Ga0070669_100090300 3300005353 Bacteria 2296
29 Ga0070671_100014663 3300005355 Bacteria 6335
30 Ga0070674_100001370 3300005356 Bacteria 12875
31 Ga0070688_100038814 3300005365 Bacteria 2911
32 Ga0070659_100034222 3300005366 Bacteria 3951
33 Ga0070667_100029790 3300005367 Bacteria 4550
34 Ga0070667_100084534 3300005367 Bacteria 2720
35 Ga0070709_10002852 3300005434 Bacteria 9346
36 Ga0070709_10008991 3300005434 Bacteria 5503
37 Ga0070709_10040093 3300005434 Bacteria 2877
38 Ga0070714_100009070 3300005435 Bacteria 7798
39 Ga0070714_100078417 3300005435 Bacteria 2871
40 Ga0070714_100116051 3300005435 Unclassified 2377
41 Ga0070713_100013406 3300005436 Bacteria 6052
42 Ga0070713_100038541 3300005436 Bacteria 3874
43 Ga0070711_100000223 3300005439 Bacteria 29981
44 Ga0070711_100138455 3300005439 Bacteria 1822
45 Ga0070705_100000569 3300005440 Bacteria 21356
46 Ga0070705_100003821 3300005440 Bacteria 7367
47 Ga0070705_100003887 3300005440 Bacteria 7306
48 Ga0070705_100012632 3300005440 Bacteria 4298
49 Ga0070705_100034405 3300005440 Bacteria 2832
50 Ga0070700_100042871 3300005441 Bacteria 2781
51 Ga0070694_100001157 3300005444 Bacteria 15167
52 Ga0070694_100004255 3300005444 Bacteria 8611
53 Ga0070694_100006788 3300005444 Bacteria 6952
54 Ga0070694_100019778 3300005444 Bacteria 4285
55 Ga0070694_100200131 3300005444 Bacteria 1488
56 Ga0070708_100002696 3300005445 Bacteria 13759
57 Ga0070708_100003391 3300005445 Bacteria 12477
58 Ga0070708_100005490 3300005445 Bacteria 10053
59 Ga0070708_100005892 3300005445 Bacteria 9736
60 Ga0070708_100018602 3300005445 Bacteria 5816
61 Ga0070708_100055730 3300005445 Bacteria 3515
62 Ga0070662_100000543 3300005457 Bacteria 22925
63 Ga0070681_10006250 3300005458 Bacteria 11584
64 Ga0070681_10009690 3300005458 Bacteria 9477
65 Ga0070681_10016776 3300005458 Bacteria 7312
66 Ga0070681_10031248 3300005458 Bacteria 5344
67 Ga0070681_10045250 3300005458 Bacteria 4403
68 Ga0070681_10056000 3300005458 Bacteria 3925
69 Ga0068867_100000355 3300005459 Bacteria 30494
70 Ga0070706_100002854 3300005467 Bacteria 17247
71 Ga0070706_100005685 3300005467 Bacteria 11856
72 Ga0070706_100007185 3300005467 Bacteria 10469
73 Ga0070706_100020965 3300005467 Bacteria 6016
74 Ga0070706_100081715 3300005467 Bacteria 2992
75 Ga0070706_100138074 3300005467 Bacteria 2275
76 Ga0070706_100221890 3300005467 Bacteria 1764
77 Ga0070706_100247604 3300005467 Bacteria 1664
78 Ga0070707_100004428 3300005468 Bacteria 13157
79 Ga0070707_100006131 3300005468 Bacteria 11204
80 Ga0070707_100033386 3300005468 Bacteria 4907
81 Ga0070707_100049410 3300005468 Bacteria 4032
82 Ga0070707_100079968 3300005468 Bacteria 3155
83 Ga0070698_100002481 3300005471 Bacteria 20329
84 Ga0070698_100021840 3300005471 Bacteria 6703
85 Ga0070698_100027940 3300005471 Bacteria 5861
86 Ga0070698_100038236 3300005471 Bacteria 4945
87 Ga0070698_100044198 3300005471 Bacteria 4564
88 Ga0070698_100306644 3300005471 Bacteria 1518
89 Ga0070699_100001629 3300005518 Bacteria 20473
90 Ga0070699_100011435 3300005518 Bacteria 7663
91 Ga0070699_100021613 3300005518 Bacteria 5549
92 Ga0070699_100029595 3300005518 Bacteria 4722
93 Ga0070699_100038781 3300005518 Bacteria 4124
94 Ga0070699_100064902 3300005518 Bacteria 3167
95 Ga0070699_100277520 3300005518 Bacteria 1501
96 Ga0070679_100006256 3300005530 Bacteria 11087
97 Ga0070679_100019751 3300005530 Bacteria 6558
98 Ga0070679_100024551 3300005530 Bacteria 5908
99 Ga0070679_100070313 3300005530 Bacteria 3492
100 Ga0070679_100086037 3300005530 Bacteria 3130
101 Ga0070684_100003746 3300005535 Bacteria 11474
102 Ga0070684_100023120 3300005535 Bacteria 5192
103 Ga0070684_100120610 3300005535 Bacteria 2359
104 Ga0070684_100123585 3300005535 Bacteria 2329
105 Ga0070684_100147462 3300005535 Bacteria 2130
106 Ga0070684_100152956 3300005535 Bacteria 2091
107 Ga0070684_100235150 3300005535 Bacteria 1674
108 Ga0070697_100007074 3300005536 Bacteria 8727
109 Ga0070697_100010202 3300005536 Bacteria 7326
110 Ga0070697_100014351 3300005536 Bacteria 6223
111 Ga0070697_100020401 3300005536 Bacteria 5242
112 Ga0070697_100042698 3300005536 Bacteria 3669
113 Ga0068853_100025431 3300005539 Bacteria 4967
114 Ga0068853_100200324 3300005539 Bacteria 1817
115 Ga0070686_100181093 3300005544 Bacteria 1497
116 Ga0070695_100004109 3300005545 Bacteria 8513
117 Ga0070695_100004336 3300005545 Bacteria 8311
118 Ga0070695_100009614 3300005545 Bacteria 5759
119 Ga0070695_100012699 3300005545 Bacteria 5056
120 Ga0070695_100012975 3300005545 Bacteria 5004
121 Ga0070695_100016660 3300005545 Bacteria 4451
122 Ga0070695_100058324 3300005545 Bacteria 2496
123 Ga0070695_100131729 3300005545 Bacteria 1724
124 Ga0070696_100000351 3300005546 Bacteria 28000
125 Ga0070696_100003650 3300005546 Bacteria 10262
126 Ga0070696_100008031 3300005546 Bacteria 7051
127 Ga0070696_100020533 3300005546 Bacteria 4475
128 Ga0070696_100039539 3300005546 Bacteria 3256
129 Ga0070696_100053047 3300005546 Bacteria 2821
130 Ga0070696_100090416 3300005546 Bacteria 2178
131 Ga0070696_100156311 3300005546 Bacteria 1677
132 Ga0070693_100004721 3300005547 Bacteria 6478
133 Ga0070704_100001793 3300005549 Bacteria 11792
134 Ga0070704_100003829 3300005549 Bacteria 8657
135 Ga0070704_100008218 3300005549 Bacteria 6242
136 Ga0070704_100011025 3300005549 Bacteria 5516
137 Ga0070704_100036582 3300005549 Bacteria 3347
138 Ga0070704_100215846 3300005549 Bacteria 1557
139 Ga0070664_100018894 3300005564 Bacteria 5667
140 Ga0070664_100022159 3300005564 Bacteria 5241
141 Ga0068857_100029939 3300005577 Bacteria 4804
142 Ga0068854_100005997 3300005578 Bacteria 7696
143 Ga0068856_100058396 3300005614 Bacteria 3810
144 Ga0068856_100136910 3300005614 Bacteria 2454
145 Ga0068856_100253998 3300005614 Bacteria 1773
146 Ga0068852_100167855 3300005616 Bacteria 2055
147 Ga0068859_100152834 3300005617 Bacteria 2384
148 Ga0068859_100272288 3300005617 Bacteria 1785
149 Ga0068864_100000396 3300005618 Bacteria 37849
150 Ga0068866_10000078 3300005718 Bacteria 39112
151 Ga0068861_100016698 3300005719 Bacteria 5200
152 Ga0068870_10017797 3300005840 Bacteria 3420
153 Ga0068858_100076066 3300005842 Bacteria 3118
154 Ga0068858_100237335 3300005842 Bacteria 1729
155 Ga0068860_100021207 3300005843 Bacteria 6294
156 Ga0068862_100014173 3300005844 Bacteria 6609
157 Ga0068862_100029490 3300005844 Bacteria 4623
158 Ga0081539_10000103 3300005985 Bacteria 197839
159 Ga0070717_10043011 3300006028 Bacteria 3686
160 Ga0070717_10127122 3300006028 Bacteria 2189
161 Ga0070716_100016868 3300006173 Bacteria 3777
162 Ga0070712_100113451 3300006175 Bacteria 2027
163 Ga0097621_100210716 3300006237 Bacteria 1690
164 Ga0068871_100152562 3300006358 Bacteria 1971
165 Ga0075428_100125129 3300006844 Bacteria 2798
166 Ga0075430_100043571 3300006846 Bacteria 3793
167 Ga0075431_100011804 3300006847 Bacteria 8816
168 Ga0075431_100031698 3300006847 Bacteria 5445
169 Ga0075431_100039433 3300006847 Bacteria 4865
170 Ga0075431_100043847 3300006847 Bacteria 4613
171 Ga0075431_100075240 3300006847 Bacteria 3484
172 Ga0075431_100087959 3300006847 Bacteria 3206
173 Ga0075433_10009264 3300006852 Bacteria 7873
174 Ga0075433_10011604 3300006852 Bacteria 7097
175 Ga0075433_10018327 3300006852 Bacteria 5816
176 Ga0075433_10043428 3300006852 Bacteria 3901
177 Ga0075433_10057704 3300006852 Bacteria 3394
178 Ga0075433_10059359 3300006852 Bacteria 3347
179 Ga0075433_10061234 3300006852 Bacteria 3297
180 Ga0075434_100000094 3300006871 Bacteria 48967
181 Ga0075434_100004121 3300006871 Bacteria 13040
182 Ga0075434_100030000 3300006871 Bacteria 5354
183 Ga0075434_100031074 3300006871 Bacteria 5263
184 Ga0075434_100041267 3300006871 Bacteria 4572
185 Ga0075434_100046780 3300006871 Bacteria 4293
186 Ga0075434_100107976 3300006871 Bacteria 2794
187 Ga0075434_100159930 3300006871 Bacteria 2272
188 Ga0075429_100002592 3300006880 Bacteria 15238
189 Ga0075429_100030097 3300006880 Bacteria 4716
190 Ga0068865_100002608 3300006881 Bacteria 10711
191 Ga0075436_100003771 3300006914 Bacteria 10390
192 Ga0075436_100005681 3300006914 Bacteria 8560
193 Ga0075436_100049478 3300006914 Bacteria 2900
194 Ga0075436_100065497 3300006914 Bacteria 2511
195 Ga0097620_100152834 3300006931 Bacteria 2384
196 Ga0097620_100272276 3300006931 Bacteria 1785
197 Ga0075435_100016234 3300007076 Bacteria 5613
198 Ga0075435_100159961 3300007076 Bacteria 1896
199 Ga0075435_100200611 3300007076 Bacteria 1690
200 Ga0075435_100223340 3300007076 Unclassified 1600
201 Ga0099794_10000220 3300007265 Bacteria 20477
202 Ga0105240_10020766 3300009093 Bacteria 8749
203 Ga0105240_10073640 3300009093 Bacteria 4217
204 Ga0111539_10290158 3300009094 Bacteria 1904
205 Ga0111539_10344725 3300009094 Bacteria 1734
206 Ga0105245_10112701 3300009098 Bacteria 2532
207 Ga0114129_10015106 3300009147 Bacteria 10988
208 Ga0114129_10071300 3300009147 Bacteria 4845
209 Ga0114129_10279439 3300009147 Bacteria 2231
210 Ga0105242_10001568 3300009176 Bacteria 17985
211 Ga0105242_10003865 3300009176 Bacteria 11648
212 Ga0105248_10019045 3300009177 Bacteria 7589
213 Ga0105248_10200635 3300009177 Bacteria 2247
214 Ga0105237_10156587 3300009545 Bacteria 2275
215 Ga0105249_10035026 3300009553 Bacteria 4550
216 Ga0105249_10111129 3300009553 Bacteria 2591
217 Ga0105246_10013852 3300011119 Bacteria 5061
218 Ga0157373_10024135 3300013100 Bacteria 4407
219 Ga0157371_10124257 3300013102 Bacteria 1835
220 Ga0157370_10009192 3300013104 Bacteria 10597
221 Ga0157370_10017846 3300013104 Bacteria 7151
222 Ga0157370_10082231 3300013104 Bacteria 3029
223 Ga0157369_10033290 3300013105 Bacteria 5664
224 Ga0157369_10099634 3300013105 Bacteria 3098
225 Ga0157369_10379341 3300013105 Unclassified 1467
226 Ga0157374_10112072 3300013296 Bacteria 2625
227 Ga0157378_10001907 3300013297 Bacteria 18712
228 Ga0163162_10019790 3300013306 Bacteria 6609
229 Ga0163162_10101003 3300013306 Bacteria 2976
230 Ga0157372_10011825 3300013307 Bacteria 9298
231 Ga0157372_10032542 3300013307 Bacteria 5719
232 Ga0157372_10046982 3300013307 Bacteria 4795
233 Ga0157372_10088750 3300013307 Bacteria 3511
234 Ga0157375_10012708 3300013308 Bacteria 7473
235 Ga0157375_10095989 3300013308 Bacteria 3036
236 Ga0157379_10018866 3300014968 Bacteria 6086
237 Ga0157379_10172181 3300014968 Bacteria 1954
238 Ga0163161_10020093 3300017792 Bacteria 4686
239 Ga0213876_10010473 3300021384 Bacteria 4973
240 Ga0207653_10000200 3300025885 Bacteria 40543
241 Ga0207653_10011645 3300025885 Bacteria 2745
242 Ga0207642_10002766 3300025899 Bacteria 5473
243 Ga0207699_10002247 3300025906 Bacteria 9112
244 Ga0207645_10109357 3300025907 Bacteria 1788
245 Ga0207643_10009928 3300025908 Bacteria 5115
246 Ga0207684_10002224 3300025910 Bacteria 19792
247 Ga0207684_10009565 3300025910 Bacteria 8550
248 Ga0207684_10018933 3300025910 Bacteria 5889
249 Ga0207684_10021303 3300025910 Bacteria 5534
250 Ga0207684_10192520 3300025910 Bacteria 1759
251 Ga0207684_10283066 3300025910 Bacteria 1430
252 Ga0207707_10002691 3300025912 Bacteria 15871
253 Ga0207707_10023184 3300025912 Bacteria 5431
254 Ga0207707_10064045 3300025912 Bacteria 3200
255 Ga0207707_10140484 3300025912 Bacteria 2112
256 Ga0207707_10181322 3300025912 Bacteria 1838
257 Ga0207695_10037395 3300025913 Bacteria 5238
258 Ga0207693_10118800 3300025915 Bacteria 2076
259 Ga0207660_10003134 3300025917 Bacteria 10809
260 Ga0207660_10007126 3300025917 Bacteria 7242
261 Ga0207660_10016081 3300025917 Bacteria 4946
262 Ga0207660_10018968 3300025917 Bacteria 4594
263 Ga0207660_10031007 3300025917 Bacteria 3678
264 Ga0207660_10076073 3300025917 Bacteria 2454
265 Ga0207662_10033889 3300025918 Bacteria 2980
266 Ga0207649_10054947 3300025920 Bacteria 2480
267 Ga0207652_10001581 3300025921 Bacteria 20038
268 Ga0207652_10004283 3300025921 Bacteria 11640
269 Ga0207652_10005079 3300025921 Bacteria 10680
270 Ga0207652_10020953 3300025921 Bacteria 5391
271 Ga0207652_10212124 3300025921 Bacteria 1744
272 Ga0207652_10245943 3300025921 Bacteria 1613
273 Ga0207646_10002297 3300025922 Bacteria 22704
274 Ga0207646_10002751 3300025922 Bacteria 20560
275 Ga0207646_10016953 3300025922 Bacteria 6826
276 Ga0207646_10028228 3300025922 Bacteria 5110
277 Ga0207646_10088948 3300025922 Bacteria 2764
278 Ga0207681_10040277 3300025923 Bacteria 3108
279 Ga0207681_10086526 3300025923 Bacteria 2227
280 Ga0207694_10032235 3300025924 Bacteria 4009
281 Ga0207650_10025334 3300025925 Bacteria 4225
282 Ga0207700_10000255 3300025928 Bacteria 31822
283 Ga0207700_10035387 3300025928 Unclassified 3597
284 Ga0207700_10102939 3300025928 Bacteria 2282
285 Ga0207664_10010660 3300025929 Bacteria 6498
286 Ga0207664_10068586 3300025929 Unclassified 2849
287 Ga0207644_10013663 3300025931 Bacteria 5419
288 Ga0207690_10096527 3300025932 Bacteria 2102
289 Ga0207706_10000146 3300025933 Bacteria 76821
290 Ga0207706_10122905 3300025933 Bacteria 2283
291 Ga0207686_10000143 3300025934 Bacteria 56102
292 Ga0207686_10069779 3300025934 Bacteria 2256
293 Ga0207669_10000209 3300025937 Bacteria 26615
294 Ga0207669_10048093 3300025937 Bacteria 2532
295 Ga0207704_10000443 3300025938 Bacteria 18522
296 Ga0207665_10003149 3300025939 Bacteria 11055
297 Ga0207665_10030502 3300025939 Bacteria 3563
298 Ga0207665_10091079 3300025939 Bacteria 2114
299 Ga0207691_10149490 3300025940 Bacteria 2054
300 Ga0207711_10095645 3300025941 Bacteria 2620
301 Ga0207689_10001318 3300025942 Bacteria 23906
302 Ga0207661_10018879 3300025944 Bacteria 5131
303 Ga0207661_10044332 3300025944 Bacteria 3515
304 Ga0207661_10116496 3300025944 Bacteria 2268
305 Ga0207661_10130941 3300025944 Bacteria 2148
306 Ga0207661_10141301 3300025944 Bacteria 2072
307 Ga0207640_10033398 3300025981 Bacteria 3201
308 Ga0207639_10028655 3300026041 Bacteria 4068
309 Ga0207678_10125477 3300026067 Bacteria 2190
310 Ga0207708_10018861 3300026075 Bacteria 5195
311 Ga0207708_10021246 3300026075 Bacteria 4894
312 Ga0207708_10045682 3300026075 Bacteria 3337
313 Ga0207702_10082488 3300026078 Bacteria 2796
314 Ga0207702_10098622 3300026078 Bacteria 2574
315 Ga0207648_10000905 3300026089 Bacteria 33390
316 Ga0207648_10187623 3300026089 Bacteria 1831
317 Ga0207676_10000870 3300026095 Bacteria 23405
318 Ga0207676_10040837 3300026095 Bacteria 3558
319 Ga0207674_10029136 3300026116 Bacteria 5817
320 Ga0207675_100043155 3300026118 Bacteria 4211
321 Ga0207683_10009788 3300026121 Bacteria 8173
322 Ga0207698_10033791 3300026142 Bacteria 3720
323 Ga0207698_10406624 3300026142 Bacteria 1302
324 Ga0209588_1000939 3300027671 Bacteria 7442
325 Ga0209588_1002453 3300027671 Bacteria 5031
326 Ga0207428_10122981 3300027907 Bacteria 1988
327 Ga0268266_10242318 3300028379 Bacteria 1665
328 Ga0268264_10024500 3300028381 Bacteria 4927
329 Ga0265332_10001866 3300031238 Bacteria 11199
330 Ga0265327_10012725 3300031251 Bacteria 5651
331 Ga0307408_100004254 3300031548 Bacteria 9742
332 Ga0307408_100010284 3300031548 Bacteria 6170
333 Ga0307408_100139583 3300031548 Bacteria 1901
334 Ga0316575_10014704 3300031665 Bacteria 2942
335 Ga0265314_10001702 3300031711 Bacteria 23888
336 Ga0316576_10009443 3300031727 Bacteria 6295
337 Ga0307405_10070955 3300031731 Bacteria 2240
338 Ga0307405_10073515 3300031731 Bacteria 2207
339 Ga0307405_10123765 3300031731 Bacteria 1774
340 Ga0307413_10020008 3300031824 Bacteria 3550
341 Ga0307413_10037283 3300031824 Bacteria 2807
342 Ga0307410_10000586 3300031852 Bacteria 14989
343 Ga0307410_10005081 3300031852 Bacteria 6916
344 Ga0307410_10009917 3300031852 Bacteria 5371
345 Ga0307406_10023695 3300031901 Bacteria 3656
346 Ga0307406_10048869 3300031901 Bacteria 2675
347 Ga0307406_10091720 3300031901 Bacteria 2047
348 Ga0307407_10049071 3300031903 Bacteria 2407
349 Ga0307412_10020036 3300031911 Bacteria 4063
350 Ga0307412_10119485 3300031911 Unclassified 1895
351 Ga0307409_100017333 3300031995 Bacteria 4796
352 Ga0307409_100018868 3300031995 Bacteria 4653
353 Ga0307409_100039318 3300031995 Bacteria 3508
354 Ga0307409_100040775 3300031995 Bacteria 3461
355 Ga0307409_100055240 3300031995 Bacteria 3064
356 Ga0307409_100118747 3300031995 Bacteria 2234
357 Ga0307416_100001875 3300032002 Bacteria 11724
358 Ga0307416_100002280 3300032002 Bacteria 10932
359 Ga0307416_100009437 3300032002 Bacteria 6387
360 Ga0307416_100022775 3300032002 Bacteria 4531
361 Ga0307416_100042628 3300032002 Bacteria 3544
362 Ga0307416_100241424 3300032002 Bacteria 1751
363 Ga0307414_10010675 3300032004 Bacteria 5345
364 Ga0307414_10012227 3300032004 Bacteria 5066
365 Ga0307414_10059070 3300032004 Bacteria 2706
366 Ga0307414_10175987 3300032004 Unclassified 1716
367 Ga0307411_10005443 3300032005 Bacteria 6254
368 Ga0307411_10007072 3300032005 Bacteria 5679
369 Ga0307411_10009081 3300032005 Bacteria 5202
370 Ga0307411_10015261 3300032005 Bacteria 4308
371 Ga0307411_10104059 3300032005 Bacteria 2015
372 Ga0307415_100001763 3300032126 Bacteria 10571
373 Ga0307415_100003225 3300032126 Bacteria 8284
374 Ga0307415_100007113 3300032126 Bacteria 6094
375 Ga0307415_100015381 3300032126 Bacteria 4530
376 Ga0307415_100119118 3300032126 Bacteria 1975
377 Ga0316580_10007278 3300032139 Bacteria 3292
378 Ga0373926_0050738 3300035083 Bacteria 1496
379 Ga0373934_0001931 3300035086 Bacteria 7601
380 Ga0373944_0011884 3300035089 Bacteria 2392
381 Ga0373923_0022984 3300035111 Bacteria 2449
382 Ga0373956_0131178 3300035119 Bacteria 1173
383 Ga0373943_0005747 3300035170 Bacteria 5566
384 Ga0373946_0001069 3300035171 Bacteria 9436
385 Ga0373961_0013967 3300035241 Bacteria 2033
386 Ga0316574_0008052 3300035398 Bacteria 5828
387 Ga0373931_0059446 3300035691 Bacteria 2056
388 Ga0373935_0115308 3300035692 Bacteria 1788
389 Ga0373933_0003285 3300035724 Bacteria 9048
390 Ga0373933_0020469 3300035724 Bacteria 3750
391 Ga0373947_0002548 3300035725 Bacteria 10950
392 Ga0373937_0004833 3300036401 Bacteria 11451
393 Ga0316582_0019243 3300036647 Bacteria 3992
394 Ga0316582_0158545 3300036647 Bacteria 1532
395 Ga0373925_0138349 3300037068 Bacteria 1904
396 Ga0395900_0023982 3300037418 Bacteria 6243
397 Ga0395905_0059501 3300037471 Bacteria 3571
398 Ga0395905_0141148 3300037471 Bacteria 2266
399 Ga0395901_0006851 3300038443 Bacteria 11510
400 Ga0395901_0131891 3300038443 Bacteria 2626
401 Ga0436365_0153547 3300039437 Bacteria 5110
402 Ga0436365_1132264 3300039437 Bacteria 1378
403 Ga0436365_1754848 3300039437 Bacteria 2710
404 Ga0451577_0014459 3300042876 Bacteria 7359
405 Ga0451577_0031711 3300042876 Bacteria 4767
406 Ga0451577_0117748 3300042876 Bacteria 2379
407 Ga0451577_0118472 3300042876 Bacteria 2371
408 Ga0451577_0275416 3300042876 Bacteria 1524
409 Ga0453683_0016595 3300044673 Bacteria 4749
410 Ga0453683_0048217 3300044673 Bacteria 2672
411 Ga0453683_0104639 3300044673 Bacteria 1778
412 Ga0453683_0111785 3300044673 Bacteria 1718
413 Ga0466963_0112201 3300044694 Unclassified 1872
414 Ga0453684_0000886 3300044712 Bacteria 100081
415 Ga0451576_0019272 3300045051 Bacteria 7448
416 Ga0451576_0062299 3300045051 Bacteria 3888
417 Ga0451576_0066624 3300045051 Bacteria 3748
418 Ga0451576_0079046 3300045051 Bacteria 3422
419 Ga0451576_0107755 3300045051 Bacteria 2899
420 Ga0466967_0004556 3300045976 Bacteria 9383
421 Ga0495603_0019225 3300046455 Bacteria 4136
422 Ga0495651_0107926 3300046462 Bacteria 2062
423 Ga0495580_0002684 3300046472 Bacteria 15408
424 Ga0495580_0037351 3300046472 Bacteria 3487
425 Ga0495582_0017694 3300046473 Bacteria 3897
426 Ga0495639_0002914 3300046475 Bacteria 7456
427 Ga0495639_0013192 3300046475 Bacteria 3566
428 Ga0495639_0017078 3300046475 Bacteria 3151
429 Ga0495594_0032772 3300046499 Bacteria 2822
430 Ga0495594_0034060 3300046499 Bacteria 2770
431 Ga0495594_0034931 3300046499 Bacteria 2737
432 Ga0495608_0070779 3300046511 Bacteria 2276
433 Ga0495630_0001630 3300046517 Bacteria 15602
434 Ga0495630_0006141 3300046517 Bacteria 8518
435 Ga0495666_0075707 3300046526 Bacteria 1595
436 Ga0495652_0005007 3300046529 Bacteria 12554
437 Ga0495665_0002575 3300046531 Bacteria 9789
438 Ga0495665_0034205 3300046531 Bacteria 2717
439 Ga0495640_0033617 3300046533 Bacteria 3642
440 Ga0495586_0002898 3300046535 Bacteria 9263
441 Ga0495587_0001297 3300046536 Bacteria 16605
442 Ga0495645_0002144 3300046543 Bacteria 13391
443 Ga0495645_0003001 3300046543 Bacteria 11417
444 Ga0495667_0000573 3300046559 Bacteria 23475
445 Ga0495588_0006748 3300046674 Bacteria 5190
446 Ga0495657_0022781 3300046675 Bacteria 4482
447 Ga0495657_0177774 3300046675 Bacteria 1308
448 Ga0495599_0001932 3300046678 Bacteria 12002
449 Ga0495646_0032468 3300046680 Bacteria 3249
450 Ga0495658_0001005 3300046683 Bacteria 14896
451 Ga0495658_0001235 3300046683 Bacteria 13420
452 Ga0495613_0044512 3300046689 Bacteria 3283
453 Ga0495581_0002240 3300047315 Bacteria 10879
454 Ga0495636_0021167 3300047318 Bacteria 2625
455 Ga0495674_0028477 3300047319 Bacteria 5092
456 Ga0495674_0062704 3300047319 Bacteria 3236
457 Ga0495680_0005643 3300047322 Bacteria 11727
458 Ga0495677_0052915 3300047445 Bacteria 1496
459 Ga0495593_0000043 3300047673 Bacteria 50752
460 Ga0495614_0000754 3300048089 Bacteria 13735
461 Ga0496101_0035186 3300048904 Bacteria 3542
462 Ga0496101_0117149 3300048904 Bacteria 2011
463 Ga0496102_0002293 3300048905 Bacteria 16355
464 Ga0496102_0045510 3300048905 Bacteria 3985
465 Ga0496102_0052611 3300048905 Bacteria 3711
466 Ga0496102_0167768 3300048905 Bacteria 2066
467 Ga0496102_0185396 3300048905 Bacteria 1961
468 Ga0496102_0291273 3300048905 Bacteria 1539
469 Ga0496103_0009520 3300048906 Bacteria 5752
470 Ga0496104_0009797 3300048907 Bacteria 8541
471 Ga0496104_0031446 3300048907 Bacteria 4936
472 Ga0496104_0251788 3300048907 Unclassified 1679
473 Ga0496105_0084836 3300048908 Bacteria 2617
474 Ga0496107_0177406 3300048910 Bacteria 1582
475 Ga0496108_0003015 3300048911 Bacteria 13530
476 Ga0496108_0011455 3300048911 Bacteria 7206
477 Ga0496108_0014644 3300048911 Bacteria 6402
478 Ga0496108_0150513 3300048911 Bacteria 2008
479 Ga0496109_0005395 3300048912 Bacteria 10692
480 Ga0496109_0017452 3300048912 Bacteria 6293
481 Ga0496109_0059558 3300048912 Bacteria 3489
482 Ga0496109_0084389 3300048912 Bacteria 2930
483 Ga0496110_0029154 3300048913 Bacteria 4746
484 Ga0496110_0030739 3300048913 Bacteria 4631
485 Ga0496110_0039760 3300048913 Bacteria 4096
486 Ga0496111_0010574 3300048914 Bacteria 6199
487 Ga0496111_0027383 3300048914 Bacteria 4032
488 Ga0496112_0003407 3300048915 Bacteria 13133
489 Ga0496112_0006102 3300048915 Bacteria 10534
490 Ga0496112_0018415 3300048915 Bacteria 6575
491 Ga0496112_0025750 3300048915 Bacteria 5650
492 Ga0496112_0160162 3300048915 Bacteria 2217
493 Ga0496112_0187790 3300048915 Bacteria 2030
494 Ga0496113_0000406 3300048916 Bacteria 20817
495 Ga0496113_0004896 3300048916 Bacteria 8294
496 Ga0496113_0007588 3300048916 Bacteria 6997
497 Ga0496113_0011701 3300048916 Bacteria 5869
498 Ga0496114_0057250 3300048917 Bacteria 3254
499 Ga0496114_0155420 3300048917 Bacteria 1986
500 Ga0496115_0003459 3300048918 Bacteria 11345
501 Ga0501031_0031128 3300049568 Bacteria 3481
502 Ga0501032_0060887 3300049569 Bacteria 2532
503 Ga0501033_0034605 3300049570 Bacteria 3788
504 Ga0501034_0001585 3300049571 Bacteria 29606
505 Ga0501034_0043024 3300049571 Bacteria 4572
506 Ga0501038_0073132 3300049574 Bacteria 2904
507 Ga0501039_0014780 3300049575 Bacteria 5971
508 Ga0501040_0017942 3300049576 Bacteria 4698
509 Ga0501042_0015685 3300049578 Bacteria 5190
510 Ga0501043_0038443 3300049579 Bacteria 3763
511 Ga0501047_0115434 3300049581 Bacteria 2567
512 Ga0501067_0000433 3300049583 Bacteria 22891
513 Ga0501067_0009217 3300049583 Bacteria 5467
514 Ga0501067_0079545 3300049583 Bacteria 1816
515 Ga0501068_0001305 3300049584 Bacteria 13208
516 Ga0501068_0008689 3300049584 Bacteria 5664
517 Ga0501068_0079793 3300049584 Bacteria 2007
518 Ga0501069_0001662 3300049585 Bacteria 11057
519 Ga0501069_0003949 3300049585 Bacteria 7647
520 Ga0501069_0010501 3300049585 Bacteria 4905
521 Ga0501070_0001847 3300049586 Bacteria 18693
522 Ga0501070_0117963 3300049586 Bacteria 2192
523 Ga0501071_0001396 3300049587 Bacteria 13867
524 Ga0501071_0009114 3300049587 Bacteria 6590
525 Ga0501071_0009668 3300049587 Bacteria 6436
526 Ga0501071_0079588 3300049587 Bacteria 2396
527 Ga0501072_0018733 3300049588 Bacteria 5337
528 Ga0501072_0022888 3300049588 Bacteria 4849
529 Ga0501072_0041473 3300049588 Bacteria 3615
530 Ga0501073_0016640 3300049589 Bacteria 5327
531 Ga0501074_0001547 3300049590 Bacteria 15555
532 Ga0501074_0004680 3300049590 Bacteria 9796
533 Ga0501074_0019989 3300049590 Bacteria 4867
534 Ga0501074_0067135 3300049590 Bacteria 2580
535 Ga0501075_0011713 3300049591 Bacteria 6215
536 Ga0501075_0025264 3300049591 Bacteria 4365
537 Ga0501075_0040221 3300049591 Bacteria 3501
538 Ga0501075_0135341 3300049591 Bacteria 1877
539 Ga0501076_0014929 3300049592 Bacteria 5861
540 Ga0501076_0068027 3300049592 Bacteria 2845
541 Ga0501076_0081381 3300049592 Bacteria 2600
542 Ga0501076_0190365 3300049592 Bacteria 1674
543 Ga0501077_0000252 3300049593 Bacteria 31743
544 Ga0501077_0008427 3300049593 Bacteria 6387
545 Ga0501077_0029547 3300049593 Bacteria 3485
546 Ga0501077_0058500 3300049593 Bacteria 2447
547 Ga0501217_004146 3300049661 Unclassified 2970
548 Ga0501247_003085 3300049677 Bacteria 1768
549 Ga0501257_011988 3300049686 Unclassified 1982
550 Ga0501225_0012570 3300049705 Bacteria 2376
551 Ga0501234_004728 3300049707 Unclassified 2135
552 Ga0501079_0007016 3300049741 Bacteria 8497
553 Ga0501079_0055939 3300049741 Bacteria 3044
554 Ga0501080_0045519 3300049742 Bacteria 4085
555 Ga0501080_0050804 3300049742 Bacteria 3858
556 Ga0501080_0089417 3300049742 Bacteria 2861
557 Ga0501081_0026361 3300049743 Bacteria 3919
558 Ga0501083_0000713 3300049744 Bacteria 21675
559 Ga0501083_0000968 3300049744 Bacteria 19013
560 Ga0501268_000457 3300049765 Bacteria 4434
561 Ga0501270_004971 3300049767 Unclassified 1521
562 Ga0501273_002595 3300049770 Bacteria 1852
563 Ga0501044_0028688 3300049823 Bacteria 5871
564 Ga0501045_0039119 3300049824 Bacteria 3451
565 Ga0501045_0081573 3300049824 Bacteria 2385
566 nmdc:mga05p37_139613_c1 3300050507 Bacteria 2969
567 nmdc:mga05p37_143568_c1 3300050507 Bacteria 2924
568 nmdc:mga05p37_51520_c1 3300050507 Bacteria 5062
569 nmdc:mga05p37_65898_c1 3300050507 Bacteria 4456
570 nmdc:mga09592_2878_c1 3300050508 Bacteria 13951
571 nmdc:mga09592_33429_c2 3300050508 Bacteria 2008
572 nmdc:mga09592_47951_c1 3300050508 Bacteria 3600
573 nmdc:mga0qj67_1645_c1 3300050509 Bacteria 15735
574 nmdc:mga0qj67_23437_c1 3300050509 Bacteria 4749
575 nmdc:mga06r32_55928_c1 3300050510 Bacteria 3786
576 nmdc:mga06r32_75522_c1 3300050510 Bacteria 3270
577 nmdc:mga0n895_12002_c1 3300050512 Bacteria 7754
578 nmdc:mga0n895_134830_c1 3300050512 Bacteria 2495
579 nmdc:mga0n895_24465_c1 3300050512 Bacteria 5692
580 nmdc:mga0n895_3129_c1 3300050512 Bacteria 13194
581 nmdc:mga0n895_4610_c1 3300050512 Bacteria 11361
582 nmdc:mga0n895_47128_c1 3300050512 Bacteria 4214
583 nmdc:mga0rr50_170851_c1 3300050513 Unclassified 1771
584 nmdc:mga0rr50_31301_c1 3300050513 Bacteria 3777
585 nmdc:mga08x19_10733_c1 3300050514 Bacteria 5504
586 nmdc:mga08x19_119747_c1 3300050514 Bacteria 1764
587 nmdc:mga08x19_120866_c1 3300050514 Bacteria 1756
588 nmdc:mga08x19_132475_c1 3300050514 Bacteria 1678
589 nmdc:mga08x19_60270_c1 3300050514 Bacteria 2458
590 nmdc:mga08x19_75646_c1 3300050514 Bacteria 2202
591 nmdc:mga0a205_1517_c1 3300050515 Bacteria 19852
592 nmdc:mga0a205_20424_c1 3300050515 Bacteria 6248
593 nmdc:mga0a205_22398_c1 3300050515 Bacteria 5985
594 nmdc:mga0a205_24942_c1 3300050515 Bacteria 5692
595 nmdc:mga0a205_43777_c1 3300050515 Bacteria 4315
596 nmdc:mga0a205_53010_c1 3300050515 Bacteria 3915
597 nmdc:mga0a205_59072_c1 3300050515 Bacteria 3705
598 nmdc:mga0a205_7645_c1 3300050515 Bacteria 9801
599 Ga0495595_0013393 3300053084 Bacteria 3465
600 Ga0501084_0003287 3300054114 Bacteria 13083
601 Ga0501084_0011279 3300054114 Bacteria 7397
602 Ga0501084_0124109 3300054114 Bacteria 2172
603 Ga0590071_001996 3300059421 Bacteria 5218
604 Ga0590075_002901 3300059424 Bacteria 4083
605 Ga0590077_012771 3300059426 Bacteria 1743
606 Ga0501082_0001720 3300060353 Bacteria 19317
607 Ga0501082_0053339 3300060353 Bacteria 3485
608 Ga0501082_0110840 3300060353 Bacteria 2375
609 Ga0070708_100111071
610 JGI25406J46586_10015546
611 Ga0058863_11778499
612 Ga0065712_10093215
613 Ga0070676_10006398
614 Ga0070683_100030849
615 Ga0070683_100044943
616 Ga0070683_100044960
617 Ga0070690_100006496
618 Ga0070690_100057097
619 Ga0070670_100146323
620 Ga0068869_100002242
621 Ga0068869_100187683
622 Ga0070680_100000558
623 Ga0070680_100002002
624 Ga0070680_100003736
625 Ga0070680_100012464
626 Ga0070680_100013520
627 Ga0070680_100130169
628 Ga0068868_100183916
629 Ga0070660_100163593
630 Ga0070689_100226722
631 Ga0070661_100092678
632 Ga0070692_10037769
633 Ga0070668_100054518
634 Ga0070669_100048795
635 Ga0070669_100052740
636 Ga0070669_100090300
637 Ga0070671_100014663
638 Ga0070674_100001370
639 Ga0070688_100038814
640 Ga0070659_100034222
641 Ga0070667_100029790
642 Ga0070667_100084534
643 Ga0070709_10002852
644 Ga0070709_10008991
645 Ga0070709_10040093
646 Ga0070714_100009070
647 Ga0070714_100078417
648 Ga0070714_100116051
649 Ga0070713_100013406
650 Ga0070713_100038541
651 Ga0070711_100000223
652 Ga0070711_100138455
653 Ga0070705_100000569
654 Ga0070705_100003821
655 Ga0070705_100003887
656 Ga0070705_100012632
657 Ga0070705_100034405
658 Ga0070700_100042871
659 Ga0070694_100001157
660 Ga0070694_100004255
661 Ga0070694_100006788
662 Ga0070694_100019778
663 Ga0070694_100200131
664 Ga0070708_100002696
665 Ga0070708_100003391
666 Ga0070708_100005490
667 Ga0070708_100005892
668 Ga0070708_100018602
669 Ga0070708_100055730
670 Ga0070662_100000543
671 Ga0070681_10006250
672 Ga0070681_10009690
673 Ga0070681_10016776
674 Ga0070681_10031248
675 Ga0070681_10045250
676 Ga0070681_10056000
677 Ga0068867_100000355
678 Ga0070706_100002854
679 Ga0070706_100005685
680 Ga0070706_100007185
681 Ga0070706_100020965
682 Ga0070706_100081715
683 Ga0070706_100138074
684 Ga0070706_100221890
685 Ga0070706_100247604
686 Ga0070707_100004428
687 Ga0070707_100006131
688 Ga0070707_100033386
689 Ga0070707_100049410
690 Ga0070707_100079968
691 Ga0070698_100002481
692 Ga0070698_100021840
693 Ga0070698_100027940
694 Ga0070698_100038236
695 Ga0070698_100044198
696 Ga0070698_100306644
697 Ga0070699_100001629
698 Ga0070699_100011435
699 Ga0070699_100021613
700 Ga0070699_100029595
701 Ga0070699_100038781
702 Ga0070699_100064902
703 Ga0070699_100277520
704 Ga0070679_100006256
705 Ga0070679_100019751
706 Ga0070679_100024551
707 Ga0070679_100070313
708 Ga0070679_100086037
709 Ga0070684_100003746
710 Ga0070684_100023120
711 Ga0070684_100120610
712 Ga0070684_100123585
713 Ga0070684_100147462
714 Ga0070684_100152956
715 Ga0070684_100235150
716 Ga0070697_100007074
717 Ga0070697_100010202
718 Ga0070697_100014351
719 Ga0070697_100020401
720 Ga0070697_100042698
721 Ga0068853_100025431
722 Ga0068853_100200324
723 Ga0070686_100181093
724 Ga0070695_100004109
725 Ga0070695_100004336
726 Ga0070695_100009614
727 Ga0070695_100012699
728 Ga0070695_100012975
729 Ga0070695_100016660
730 Ga0070695_100058324
731 Ga0070695_100131729
732 Ga0070696_100000351
733 Ga0070696_100003650
734 Ga0070696_100008031
735 Ga0070696_100020533
736 Ga0070696_100039539
737 Ga0070696_100053047
738 Ga0070696_100090416
739 Ga0070696_100156311
740 Ga0070693_100004721
741 Ga0070704_100001793
742 Ga0070704_100003829
743 Ga0070704_100008218
744 Ga0070704_100011025
745 Ga0070704_100036582
746 Ga0070704_100215846
747 Ga0070664_100018894
748 Ga0070664_100022159
749 Ga0068857_100029939
750 Ga0068854_100005997
751 Ga0068856_100058396
752 Ga0068856_100136910
753 Ga0068856_100253998
754 Ga0068852_100167855
755 Ga0068859_100152834
756 Ga0068859_100272288
757 Ga0068864_100000396
758 Ga0068866_10000078
759 Ga0068861_100016698
760 Ga0068870_10017797
761 Ga0068858_100076066
762 Ga0068858_100237335
763 Ga0068860_100021207
764 Ga0068862_100014173
765 Ga0068862_100029490
766 Ga0081539_10000103
767 Ga0070717_10043011
768 Ga0070717_10127122
769 Ga0070716_100016868
770 Ga0070712_100113451
771 Ga0097621_100210716
772 Ga0068871_100152562
773 Ga0075428_100125129
774 Ga0075430_100043571
775 Ga0075431_100011804
776 Ga0075431_100031698
777 Ga0075431_100039433
778 Ga0075431_100043847
779 Ga0075431_100075240
780 Ga0075431_100087959
781 Ga0075433_10009264
782 Ga0075433_10011604
783 Ga0075433_10018327
784 Ga0075433_10043428
785 Ga0075433_10057704
786 Ga0075433_10059359
787 Ga0075433_10061234
788 Ga0075434_100000094
789 Ga0075434_100004121
790 Ga0075434_100030000
791 Ga0075434_100031074
792 Ga0075434_100041267
793 Ga0075434_100046780
794 Ga0075434_100107976
795 Ga0075434_100159930
796 Ga0075429_100002592
797 Ga0075429_100030097
798 Ga0068865_100002608
799 Ga0075436_100003771
800 Ga0075436_100005681
801 Ga0075436_100049478
802 Ga0075436_100065497
803 Ga0097620_100152834
804 Ga0097620_100272276
805 Ga0075435_100016234
806 Ga0075435_100159961
807 Ga0075435_100200611
808 Ga0075435_100223340
809 Ga0099794_10000220
810 Ga0105240_10020766
811 Ga0105240_10073640
812 Ga0111539_10290158
813 Ga0111539_10344725
814 Ga0105245_10112701
815 Ga0114129_10015106
816 Ga0114129_10071300
817 Ga0114129_10279439
818 Ga0105242_10001568
819 Ga0105242_10003865
820 Ga0105248_10019045
821 Ga0105248_10200635
822 Ga0105237_10156587
823 Ga0105249_10035026
824 Ga0105249_10111129
825 Ga0105246_10013852
826 Ga0157373_10024135
827 Ga0157371_10124257
828 Ga0157370_10009192
829 Ga0157370_10017846
830 Ga0157370_10082231
831 Ga0157369_10033290
832 Ga0157369_10099634
833 Ga0157369_10379341
834 Ga0157374_10112072
835 Ga0157378_10001907
836 Ga0163162_10019790
837 Ga0163162_10101003
838 Ga0157372_10011825
839 Ga0157372_10032542
840 Ga0157372_10046982
841 Ga0157372_10088750
842 Ga0157375_10012708
843 Ga0157375_10095989
844 Ga0157379_10018866
845 Ga0157379_10172181
846 Ga0163161_10020093
847 Ga0213876_10010473
848 Ga0207653_10000200
849 Ga0207653_10011645
850 Ga0207642_10002766
851 Ga0207699_10002247
852 Ga0207645_10109357
853 Ga0207643_10009928
854 Ga0207684_10002224
855 Ga0207684_10009565
856 Ga0207684_10018933
857 Ga0207684_10021303
858 Ga0207684_10192520
859 Ga0207684_10283066
860 Ga0207707_10002691
861 Ga0207707_10023184
862 Ga0207707_10064045
863 Ga0207707_10140484
864 Ga0207707_10181322
865 Ga0207695_10037395
866 Ga0207693_10118800
867 Ga0207660_10003134
868 Ga0207660_10007126
869 Ga0207660_10016081
870 Ga0207660_10018968
871 Ga0207660_10031007
872 Ga0207660_10076073
873 Ga0207662_10033889
874 Ga0207649_10054947
875 Ga0207652_10001581
876 Ga0207652_10004283
877 Ga0207652_10005079
878 Ga0207652_10020953
879 Ga0207652_10212124
880 Ga0207652_10245943
881 Ga0207646_10002297
882 Ga0207646_10002751
883 Ga0207646_10016953
884 Ga0207646_10028228
885 Ga0207646_10088948
886 Ga0207681_10040277
887 Ga0207681_10086526
888 Ga0207694_10032235
889 Ga0207650_10025334
890 Ga0207700_10000255
891 Ga0207700_10035387
892 Ga0207700_10102939
893 Ga0207664_10010660
894 Ga0207664_10068586
895 Ga0207644_10013663
896 Ga0207690_10096527
897 Ga0207706_10000146
898 Ga0207706_10122905
899 Ga0207686_10000143
900 Ga0207686_10069779
901 Ga0207669_10000209
902 Ga0207669_10048093
903 Ga0207704_10000443
904 Ga0207665_10003149
905 Ga0207665_10030502
906 Ga0207665_10091079
907 Ga0207691_10149490
908 Ga0207711_10095645
909 Ga0207689_10001318
910 Ga0207661_10018879
911 Ga0207661_10044332
912 Ga0207661_10116496
913 Ga0207661_10130941
914 Ga0207661_10141301
915 Ga0207640_10033398
916 Ga0207639_10028655
917 Ga0207678_10125477
918 Ga0207708_10018861
919 Ga0207708_10021246
920 Ga0207708_10045682
921 Ga0207702_10082488
922 Ga0207702_10098622
923 Ga0207648_10000905
924 Ga0207648_10187623
925 Ga0207676_10000870
926 Ga0207676_10040837
927 Ga0207674_10029136
928 Ga0207675_100043155
929 Ga0207683_10009788
930 Ga0207698_10033791
931 Ga0207698_10406624
932 Ga0209588_1000939
933 Ga0209588_1002453
934 Ga0207428_10122981
935 Ga0268266_10242318
936 Ga0268264_10024500
937 Ga0265332_10001866
938 Ga0265327_10012725
939 Ga0307408_100004254
940 Ga0307408_100010284
941 Ga0307408_100139583
942 Ga0316575_10014704
943 Ga0265314_10001702
944 Ga0316576_10009443
945 Ga0307405_10070955
946 Ga0307405_10073515
947 Ga0307405_10123765
948 Ga0307413_10020008
949 Ga0307413_10037283
950 Ga0307410_10000586
951 Ga0307410_10005081
952 Ga0307410_10009917
953 Ga0307406_10023695
954 Ga0307406_10048869
955 Ga0307406_10091720
956 Ga0307407_10049071
957 Ga0307412_10020036
958 Ga0307412_10119485
959 Ga0307409_100017333
960 Ga0307409_100018868
961 Ga0307409_100039318
962 Ga0307409_100040775
963 Ga0307409_100055240
964 Ga0307409_100118747
965 Ga0307416_100001875
966 Ga0307416_100002280
967 Ga0307416_100009437
968 Ga0307416_100022775
969 Ga0307416_100042628
970 Ga0307416_100241424
971 Ga0307414_10010675
972 Ga0307414_10012227
973 Ga0307414_10059070
974 Ga0307414_10175987
975 Ga0307411_10005443
976 Ga0307411_10007072
977 Ga0307411_10009081
978 Ga0307411_10015261
979 Ga0307411_10104059
980 Ga0307415_100001763
981 Ga0307415_100003225
982 Ga0307415_100007113
983 Ga0307415_100015381
984 Ga0307415_100119118
985 Ga0316580_10007278
986 Ga0373926_0050738
987 Ga0373934_0001931
988 Ga0373944_0011884
989 Ga0373923_0022984
990 Ga0373956_0131178
991 Ga0373943_0005747
992 Ga0373946_0001069
993 Ga0373961_0013967
994 Ga0316574_0008052
995 Ga0373931_0059446
996 Ga0373935_0115308
997 Ga0373933_0003285
998 Ga0373933_0020469
999 Ga0373947_0002548
1000 Ga0373937_0004833
1001 Ga0316582_0019243
1002 Ga0316582_0158545
1003 Ga0373925_0138349
1004 Ga0395900_0023982
1005 Ga0395905_0059501
1006 Ga0395905_0141148
1007 Ga0395901_0006851
1008 Ga0395901_0131891
1009 Ga0436365_0153547
1010 Ga0436365_1132264
1011 Ga0436365_1754848
1012 Ga0451577_0014459
1013 Ga0451577_0031711
1014 Ga0451577_0117748
1015 Ga0451577_0118472
1016 Ga0451577_0275416
1017 Ga0453683_0016595
1018 Ga0453683_0048217
1019 Ga0453683_0104639
1020 Ga0453683_0111785
1021 Ga0466963_0112201
1022 Ga0453684_0000886
1023 Ga0451576_0019272
1024 Ga0451576_0062299
1025 Ga0451576_0066624
1026 Ga0451576_0079046
1027 Ga0451576_0107755
1028 Ga0466967_0004556
1029 Ga0495603_0019225
1030 Ga0495651_0107926
1031 Ga0495580_0002684
1032 Ga0495580_0037351
1033 Ga0495582_0017694
1034 Ga0495639_0002914
1035 Ga0495639_0013192
1036 Ga0495639_0017078
1037 Ga0495594_0032772
1038 Ga0495594_0034060
1039 Ga0495594_0034931
1040 Ga0495608_0070779
1041 Ga0495630_0001630
1042 Ga0495630_0006141
1043 Ga0495666_0075707
1044 Ga0495652_0005007
1045 Ga0495665_0002575
1046 Ga0495665_0034205
1047 Ga0495640_0033617
1048 Ga0495586_0002898
1049 Ga0495587_0001297
1050 Ga0495645_0002144
1051 Ga0495645_0003001
1052 Ga0495667_0000573
1053 Ga0495588_0006748
1054 Ga0495657_0022781
1055 Ga0495657_0177774
1056 Ga0495599_0001932
1057 Ga0495646_0032468
1058 Ga0495658_0001005
1059 Ga0495658_0001235
1060 Ga0495613_0044512
1061 Ga0495581_0002240
1062 Ga0495636_0021167
1063 Ga0495674_0028477
1064 Ga0495674_0062704
1065 Ga0495680_0005643
1066 Ga0495677_0052915
1067 Ga0495593_0000043
1068 Ga0495614_0000754
1069 Ga0496101_0035186
1070 Ga0496101_0117149
1071 Ga0496102_0002293
1072 Ga0496102_0045510
1073 Ga0496102_0052611
1074 Ga0496102_0167768
1075 Ga0496102_0185396
1076 Ga0496102_0291273
1077 Ga0496103_0009520
1078 Ga0496104_0009797
1079 Ga0496104_0031446
1080 Ga0496104_0251788
1081 Ga0496105_0084836
1082 Ga0496107_0177406
1083 Ga0496108_0003015
1084 Ga0496108_0011455
1085 Ga0496108_0014644
1086 Ga0496108_0150513
1087 Ga0496109_0005395
1088 Ga0496109_0017452
1089 Ga0496109_0059558
1090 Ga0496109_0084389
1091 Ga0496110_0029154
1092 Ga0496110_0030739
1093 Ga0496110_0039760
1094 Ga0496111_0010574
1095 Ga0496111_0027383
1096 Ga0496112_0003407
1097 Ga0496112_0006102
1098 Ga0496112_0018415
1099 Ga0496112_0025750
1100 Ga0496112_0160162
1101 Ga0496112_0187790
1102 Ga0496113_0000406
1103 Ga0496113_0004896
1104 Ga0496113_0007588
1105 Ga0496113_0011701
1106 Ga0496114_0057250
1107 Ga0496114_0155420
1108 Ga0496115_0003459
1109 Ga0501031_0031128
1110 Ga0501032_0060887
1111 Ga0501033_0034605
1112 Ga0501034_0001585
1113 Ga0501034_0043024
1114 Ga0501038_0073132
1115 Ga0501039_0014780
1116 Ga0501040_0017942
1117 Ga0501042_0015685
1118 Ga0501043_0038443
1119 Ga0501047_0115434
1120 Ga0501067_0000433
1121 Ga0501067_0009217
1122 Ga0501067_0079545
1123 Ga0501068_0001305
1124 Ga0501068_0008689
1125 Ga0501068_0079793
1126 Ga0501069_0001662
1127 Ga0501069_0003949
1128 Ga0501069_0010501
1129 Ga0501070_0001847
1130 Ga0501070_0117963
1131 Ga0501071_0001396
1132 Ga0501071_0009114
1133 Ga0501071_0009668
1134 Ga0501071_0079588
1135 Ga0501072_0018733
1136 Ga0501072_0022888
1137 Ga0501072_0041473
1138 Ga0501073_0016640
1139 Ga0501074_0001547
1140 Ga0501074_0004680
1141 Ga0501074_0019989
1142 Ga0501074_0067135
1143 Ga0501075_0011713
1144 Ga0501075_0025264
1145 Ga0501075_0040221
1146 Ga0501075_0135341
1147 Ga0501076_0014929
1148 Ga0501076_0068027
1149 Ga0501076_0081381
1150 Ga0501076_0190365
1151 Ga0501077_0000252
1152 Ga0501077_0008427
1153 Ga0501077_0029547
1154 Ga0501077_0058500
1155 Ga0501217_004146
1156 Ga0501247_003085
1157 Ga0501257_011988
1158 Ga0501225_0012570
1159 Ga0501234_004728
1160 Ga0501079_0007016
1161 Ga0501079_0055939
1162 Ga0501080_0045519
1163 Ga0501080_0050804
1164 Ga0501080_0089417
1165 Ga0501081_0026361
1166 Ga0501083_0000713
1167 Ga0501083_0000968
1168 Ga0501268_000457
1169 Ga0501270_004971
1170 Ga0501273_002595
1171 Ga0501044_0028688
1172 Ga0501045_0039119
1173 Ga0501045_0081573
1174 nmdc:mga05p37_139613_c1
1175 nmdc:mga05p37_143568_c1
1176 nmdc:mga05p37_51520_c1
1177 nmdc:mga05p37_65898_c1
1178 nmdc:mga09592_2878_c1
1179 nmdc:mga09592_33429_c2
1180 nmdc:mga09592_47951_c1
1181 nmdc:mga0qj67_1645_c1
1182 nmdc:mga0qj67_23437_c1
1183 nmdc:mga06r32_55928_c1
1184 nmdc:mga06r32_75522_c1
1185 nmdc:mga0n895_12002_c1
1186 nmdc:mga0n895_134830_c1
1187 nmdc:mga0n895_24465_c1
1188 nmdc:mga0n895_3129_c1
1189 nmdc:mga0n895_4610_c1
1190 nmdc:mga0n895_47128_c1
1191 nmdc:mga0rr50_170851_c1
1192 nmdc:mga0rr50_31301_c1
1193 nmdc:mga08x19_10733_c1
1194 nmdc:mga08x19_119747_c1
1195 nmdc:mga08x19_120866_c1
1196 nmdc:mga08x19_132475_c1
1197 nmdc:mga08x19_60270_c1
1198 nmdc:mga08x19_75646_c1
1199 nmdc:mga0a205_1517_c1
1200 nmdc:mga0a205_20424_c1
1201 nmdc:mga0a205_22398_c1
1202 nmdc:mga0a205_24942_c1
1203 nmdc:mga0a205_43777_c1
1204 nmdc:mga0a205_53010_c1
1205 nmdc:mga0a205_59072_c1
1206 nmdc:mga0a205_7645_c1
1207 Ga0495595_0013393
1208 Ga0501084_0003287
1209 Ga0501084_0011279
1210 Ga0501084_0124109
1211 Ga0590071_001996
1212 Ga0590075_002901
1213 Ga0590077_012771
1214 Ga0501082_0001720
1215 Ga0501082_0053339
1216 Ga0501082_0110840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

314

440

0.98

PF12704

MacB_PCD

MacB-like periplasmic core domain

57

285

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.9037 279 414
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8448 52 265
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.829 52 266
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8191 52 266
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8148 52 266
ID Description Score Start End Superfamily
af_Q9BPU3_378_783_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.5372 172 207 3.40.850.10
af_A0A1D6JR45_49_209_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5254 291 415 1.10.1760.20
af_Q9VLM7_34_210_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5065 320 416 1.10.287.1260
af_K7MLI2_277_432_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4688 295 416 1.20.1250.20
af_K7MLI3_277_440_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4611 295 416 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7C4CBC7-F1-model_v4 ABC transporter permease 0.9374 1 417 GO:0044874
GO:0098797
AF-A0A7C4CBC7-F1-model_v4 ABC transporter permease 0.9352 1 417 GO:0044874
GO:0098797
AF-A0A1L6MVX8-F1-model_v4 ABC transporter permease 0.925 7 417 GO:0044874
GO:0098797
AF-A0A353CC58-F1-model_v4 ABC transporter permease 0.919 2 417 GO:0044874
GO:0098797
AF-A0A353CC58-F1-model_v4 ABC transporter permease 0.9168 2 417 GO:0044874
GO:0098797

Map