F468755
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 607 | 402 | 564 | 317 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2945984333|2945990784 |
| Length | 381 |
| Sequence | DIYQSLRQRAELVQKASQWITTIARIENTVHPVLNRAVILHIYRYHPENVHADAAYILGFPSMSAPQHAKVLILGSGPAGYTAAVYAARANLQPLLITGIAQGGQLMTTTEVDNWPADVHGVQGPELMQRFLEHAERFKTQIVFDHINKVDLSKRPFTLTGDSGTYTCDSLIIATGASAKYLGLDSEEKFMGRGVSACATCDGFFYREQEVCVIGGGNTAVEEALYLANIANKVTLVHRRDKFRAEPILIDKVKEKVAEGKIVLKLHNELDEVLGDGTGVTGIRIKNTQTGETEQIDLKGCFIAIGHHPNTDIFQGQLEMKDNYILTRSGLQGFATMTSIPGVFAAGDVQDNVYRQAITSAGTGCMAALDAQRFLEQDGTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 7 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 8 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 9 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 10 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 11 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 12 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 13 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 14 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 15 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 16 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 17 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 18 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 19 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 20 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 21 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 22 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 23 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 24 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 25 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 26 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 27 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 28 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 29 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 30 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 31 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 32 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 33 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 34 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 35 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 36 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 37 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 38 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 39 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 40 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 41 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 42 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 43 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 44 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 45 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 46 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 47 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 48 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 49 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 50 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 51 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 52 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 53 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 54 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 63 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 64 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 66 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 69 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 72 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 78 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 94 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 96 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 104 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 123 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 124 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 222 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 223 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 224 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 225 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 226 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 227 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 228 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 229 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 242 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 256 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 257 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 258 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 259 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 262 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 263 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 264 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 265 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 266 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 267 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 268 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 269 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 270 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 271 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 272 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 273 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 274 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 275 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 276 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 277 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 280 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 283 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 344 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 347 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 348 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 368 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 379 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 387 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 388 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 389 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 390 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 392 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 393 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 394 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 395 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 397 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 398 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.59 |
| Metatranscriptomes | 0.33 |
| Isolates | 7.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.7 |
| Nodule | 0.49 |
| Rhizoplane | 2.14 |
| Rhizosphere | 61.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10019146 | 3300001979 | Bacteria | 2416 |
| 2 | JGI24739J22299_10016858 | 3300001989 | Bacteria | 2641 |
| 3 | JGI25152J39213_1018360 | 3300002773 | Bacteria | 1294 |
| 4 | JGI25152J39213_1018389 | 3300002773 | Bacteria | 1293 |
| 5 | JGI25150J39212_1003566 | 3300002774 | Bacteria | 3627 |
| 6 | JGI25150J39212_1005288 | 3300002774 | Bacteria | 2771 |
| 7 | JGI25159J45721_1020142 | 3300002987 | Bacteria | 1294 |
| 8 | JGI25159J45721_1020978 | 3300002987 | Bacteria | 1244 |
| 9 | Ga0006778J45830_1008092 | 3300003162 | Bacteria | 1755 |
| 10 | JGI25151J46595_10047534 | 3300003187 | Bacteria | 1492 |
| 11 | JGI25151J46595_10056120 | 3300003187 | Bacteria | 1294 |
| 12 | JGI25153J46596_10002591 | 3300003215 | Bacteria | 10364 |
| 13 | JGI25153J46596_10023596 | 3300003215 | Bacteria | 2238 |
| 14 | JGI25153J46596_10046124 | 3300003215 | Bacteria | 1294 |
| 15 | Ga0006777J48905_1006622 | 3300003308 | Bacteria | 1620 |
| 16 | JGI25160J50197_1033412 | 3300003354 | Bacteria | 1294 |
| 17 | JGI25161J50226_1009694 | 3300003374 | Bacteria | 1347 |
| 18 | JGI25161J50226_1010172 | 3300003374 | Bacteria | 1277 |
| 19 | Ga0055539_1001372 | 3300003752 | Bacteria | 4627 |
| 20 | Ga0055533_1001365 | 3300003756 | Bacteria | 6534 |
| 21 | Ga0055525_1000023 | 3300003759 | Bacteria | 359920 |
| 22 | Ga0055525_1000211 | 3300003759 | Bacteria | 65308 |
| 23 | Ga0055527_1000257 | 3300003760 | Bacteria | 32518 |
| 24 | Ga0055527_1000263 | 3300003760 | Bacteria | 31815 |
| 25 | Ga0055527_1004752 | 3300003760 | Bacteria | 1832 |
| 26 | Ga0055535_1000142 | 3300003761 | Bacteria | 75104 |
| 27 | Ga0055535_1000541 | 3300003761 | Bacteria | 32518 |
| 28 | Ga0055535_1000731 | 3300003761 | Bacteria | 24696 |
| 29 | Ga0055542_1000022 | 3300003762 | Bacteria | 302315 |
| 30 | Ga0055542_1000567 | 3300003762 | Bacteria | 32518 |
| 31 | Ga0055542_1000578 | 3300003762 | Bacteria | 31815 |
| 32 | Ga0055529_1000538 | 3300003763 | Bacteria | 32518 |
| 33 | Ga0055529_1000850 | 3300003763 | Bacteria | 17724 |
| 34 | Ga0055526_1036732 | 3300003771 | Bacteria | 1294 |
| 35 | Ga0055526_1036769 | 3300003771 | Bacteria | 1293 |
| 36 | Ga0055537_1004361 | 3300003773 | Bacteria | 4060 |
| 37 | Ga0055537_1015934 | 3300003773 | Bacteria | 1294 |
| 38 | Ga0055524_1037208 | 3300003775 | Bacteria | 1294 |
| 39 | Ga0055524_1037260 | 3300003775 | Bacteria | 1293 |
| 40 | Ga0055536_1009893 | 3300003781 | Bacteria | 3872 |
| 41 | Ga0055536_1010815 | 3300003781 | Bacteria | 3572 |
| 42 | Ga0055536_1033967 | 3300003781 | Bacteria | 1295 |
| 43 | Ga0055534_1016999 | 3300003784 | Bacteria | 1294 |
| 44 | Ga0055528_1027956 | 3300003790 | Bacteria | 1568 |
| 45 | Ga0055528_1033313 | 3300003790 | Bacteria | 1294 |
| 46 | Ga0055530_10000962 | 3300003791 | Bacteria | 23389 |
| 47 | Ga0055530_10008102 | 3300003791 | Bacteria | 4276 |
| 48 | Ga0055540_1006373 | 3300003792 | Bacteria | 4698 |
| 49 | Ga0055540_1008199 | 3300003792 | Bacteria | 3800 |
| 50 | Ga0055540_1009514 | 3300003792 | Bacteria | 3348 |
| 51 | Ga0055540_1029134 | 3300003792 | Bacteria | 1296 |
| 52 | Ga0055540_1029152 | 3300003792 | Bacteria | 1295 |
| 53 | Ga0055531_10003806 | 3300003794 | Bacteria | 9468 |
| 54 | Ga0055531_10042577 | 3300003794 | Bacteria | 1296 |
| 55 | Ga0055531_10042605 | 3300003794 | Bacteria | 1295 |
| 56 | Ga0055543_1004383 | 3300004625 | Bacteria | 3866 |
| 57 | Ga0055543_1017930 | 3300004625 | Bacteria | 1325 |
| 58 | Ga0065165_1042862 | 3300005262 | Bacteria | 1332 |
| 59 | Ga0065704_10008104 | 3300005289 | Bacteria | 2354 |
| 60 | Ga0070658_10113308 | 3300005327 | Bacteria | 2248 |
| 61 | Ga0070676_10001955 | 3300005328 | Bacteria | 10482 |
| 62 | Ga0070670_100056138 | 3300005331 | Bacteria | 3379 |
| 63 | Ga0070680_100196269 | 3300005336 | Bacteria | 1702 |
| 64 | Ga0068868_100234608 | 3300005338 | Bacteria | 1540 |
| 65 | Ga0068868_100496209 | 3300005338 | Bacteria | 1068 |
| 66 | Ga0070660_100096218 | 3300005339 | Bacteria | 2341 |
| 67 | Ga0070661_100073493 | 3300005344 | Bacteria | 2517 |
| 68 | Ga0070668_100184608 | 3300005347 | Bacteria | 1705 |
| 69 | Ga0070669_100118760 | 3300005353 | Bacteria | 2014 |
| 70 | Ga0070675_100040843 | 3300005354 | Bacteria | 3789 |
| 71 | Ga0070675_100096127 | 3300005354 | Bacteria | 2488 |
| 72 | Ga0070675_100205043 | 3300005354 | Bacteria | 1712 |
| 73 | Ga0070675_100357887 | 3300005354 | Bacteria | 1295 |
| 74 | Ga0070675_100373559 | 3300005354 | Bacteria | 1268 |
| 75 | Ga0070671_100150526 | 3300005355 | Bacteria | 1965 |
| 76 | Ga0070674_100073733 | 3300005356 | Bacteria | 2420 |
| 77 | Ga0070667_100039880 | 3300005367 | Bacteria | 3937 |
| 78 | Ga0070667_100221688 | 3300005367 | Bacteria | 1683 |
| 79 | Ga0070694_100044052 | 3300005444 | Bacteria | 2986 |
| 80 | Ga0070663_100149220 | 3300005455 | Bacteria | 1791 |
| 81 | Ga0070663_100150644 | 3300005455 | Bacteria | 1783 |
| 82 | Ga0070678_100149019 | 3300005456 | Bacteria | 1882 |
| 83 | Ga0070662_100216278 | 3300005457 | Bacteria | 1527 |
| 84 | Ga0070681_10000172 | 3300005458 | Bacteria | 49288 |
| 85 | Ga0068867_100003928 | 3300005459 | Bacteria | 10466 |
| 86 | Ga0068867_100051581 | 3300005459 | Bacteria | 3034 |
| 87 | Ga0068867_100093997 | 3300005459 | Bacteria | 2279 |
| 88 | Ga0070706_100232321 | 3300005467 | Bacteria | 1722 |
| 89 | Ga0070679_100328715 | 3300005530 | Bacteria | 1477 |
| 90 | Ga0070697_100000484 | 3300005536 | Bacteria | 30233 |
| 91 | Ga0070697_100042206 | 3300005536 | Bacteria | 3691 |
| 92 | Ga0068853_100170070 | 3300005539 | Bacteria | 1971 |
| 93 | Ga0070672_100060070 | 3300005543 | Bacteria | 2993 |
| 94 | Ga0070672_100152473 | 3300005543 | Bacteria | 1912 |
| 95 | Ga0070672_100223915 | 3300005543 | Bacteria | 1578 |
| 96 | Ga0070695_100002049 | 3300005545 | Bacteria | 11523 |
| 97 | Ga0070696_100005276 | 3300005546 | Bacteria | 8626 |
| 98 | Ga0070696_100024909 | 3300005546 | Bacteria | 4066 |
| 99 | Ga0070693_100033981 | 3300005547 | Bacteria | 2818 |
| 100 | Ga0070665_100471013 | 3300005548 | Bacteria | 1266 |
| 101 | Ga0068855_100055122 | 3300005563 | Bacteria | 4670 |
| 102 | Ga0068855_100292992 | 3300005563 | Bacteria | 1804 |
| 103 | Ga0068855_100507589 | 3300005563 | Bacteria | 1310 |
| 104 | Ga0068854_100186977 | 3300005578 | Bacteria | 1621 |
| 105 | Ga0068856_100003150 | 3300005614 | Bacteria | 16818 |
| 106 | Ga0068856_100261142 | 3300005614 | Bacteria | 1747 |
| 107 | Ga0070702_100052304 | 3300005615 | Bacteria | 2342 |
| 108 | Ga0068852_100065994 | 3300005616 | Bacteria | 3159 |
| 109 | Ga0068852_100459095 | 3300005616 | Bacteria | 1262 |
| 110 | Ga0068859_100012039 | 3300005617 | Bacteria | 8689 |
| 111 | Ga0068864_100202000 | 3300005618 | Bacteria | 1826 |
| 112 | Ga0068861_100210225 | 3300005719 | Bacteria | 1638 |
| 113 | Ga0068851_10011655 | 3300005834 | Bacteria | 4126 |
| 114 | Ga0068851_10027065 | 3300005834 | Bacteria | 2823 |
| 115 | Ga0068862_100120064 | 3300005844 | Bacteria | 2316 |
| 116 | Ga0068862_100256601 | 3300005844 | Bacteria | 1595 |
| 117 | Ga0081539_10000276 | 3300005985 | Bacteria | 117151 |
| 118 | Ga0075363_100010719 | 3300006048 | Bacteria | 4366 |
| 119 | Ga0075363_100080599 | 3300006048 | Bacteria | 1780 |
| 120 | Ga0075364_10014953 | 3300006051 | Bacteria | 4803 |
| 121 | Ga0075364_10023105 | 3300006051 | Bacteria | 3934 |
| 122 | Ga0075362_10019512 | 3300006177 | Bacteria | 2821 |
| 123 | Ga0075369_10024516 | 3300006186 | Bacteria | 2500 |
| 124 | Ga0075366_10007213 | 3300006195 | Bacteria | 6127 |
| 125 | Ga0075366_10017732 | 3300006195 | Bacteria | 4103 |
| 126 | Ga0075366_10157533 | 3300006195 | Bacteria | 1376 |
| 127 | Ga0075370_10019036 | 3300006353 | Bacteria | 3731 |
| 128 | Ga0075370_10050324 | 3300006353 | Bacteria | 2363 |
| 129 | Ga0075370_10163990 | 3300006353 | Bacteria | 1305 |
| 130 | Ga0075370_10185073 | 3300006353 | Bacteria | 1226 |
| 131 | Ga0075428_100285350 | 3300006844 | Bacteria | 1776 |
| 132 | Ga0068865_100265147 | 3300006881 | Bacteria | 1361 |
| 133 | Ga0075436_100072456 | 3300006914 | Bacteria | 2384 |
| 134 | Ga0075436_100156505 | 3300006914 | Bacteria | 1605 |
| 135 | Ga0097620_100012039 | 3300006931 | Bacteria | 8689 |
| 136 | Ga0079104_1033298 | 3300006946 | Bacteria | 1262 |
| 137 | Ga0099826_10172907 | 3300006948 | Bacteria | 1210 |
| 138 | Ga0075435_100133477 | 3300007076 | Bacteria | 2078 |
| 139 | Ga0105244_10004004 | 3300009036 | Bacteria | 10303 |
| 140 | Ga0105240_10005483 | 3300009093 | Bacteria | 18913 |
| 141 | Ga0105240_10117301 | 3300009093 | Bacteria | 3210 |
| 142 | Ga0105245_10136105 | 3300009098 | Bacteria | 2309 |
| 143 | Ga0105247_10027085 | 3300009101 | Bacteria | 3466 |
| 144 | Ga0114129_10085181 | 3300009147 | Bacteria | 4385 |
| 145 | Ga0114129_10534478 | 3300009147 | Bacteria | 1527 |
| 146 | Ga0105243_10006812 | 3300009148 | Bacteria | 8809 |
| 147 | Ga0105243_10208970 | 3300009148 | Bacteria | 1717 |
| 148 | Ga0105243_10231207 | 3300009148 | Bacteria | 1640 |
| 149 | Ga0105241_10169035 | 3300009174 | Bacteria | 1804 |
| 150 | Ga0105242_10056360 | 3300009176 | Bacteria | 3216 |
| 151 | Ga0105242_10309203 | 3300009176 | Bacteria | 1445 |
| 152 | Ga0105248_10357074 | 3300009177 | Bacteria | 1645 |
| 153 | Ga0105237_10034309 | 3300009545 | Bacteria | 5139 |
| 154 | Ga0105237_10352706 | 3300009545 | Bacteria | 1476 |
| 155 | Ga0105238_10017534 | 3300009551 | Bacteria | 7280 |
| 156 | Ga0105249_10141075 | 3300009553 | Bacteria | 2311 |
| 157 | Ga0105239_10105623 | 3300010375 | Bacteria | 3119 |
| 158 | Ga0105239_10115930 | 3300010375 | Bacteria | 2972 |
| 159 | Ga0105239_10285640 | 3300010375 | Bacteria | 1858 |
| 160 | Ga0105246_10020815 | 3300011119 | Bacteria | 4212 |
| 161 | Ga0105246_10036655 | 3300011119 | Bacteria | 3287 |
| 162 | Ga0157373_10044073 | 3300013100 | Bacteria | 3185 |
| 163 | Ga0157370_10043977 | 3300013104 | Bacteria | 4296 |
| 164 | Ga0157369_10011577 | 3300013105 | Bacteria | 10013 |
| 165 | Ga0157374_10508558 | 3300013296 | Bacteria | 1210 |
| 166 | Ga0157378_10042027 | 3300013297 | Bacteria | 4056 |
| 167 | Ga0157378_10304683 | 3300013297 | Bacteria | 1543 |
| 168 | Ga0163162_10355996 | 3300013306 | Bacteria | 1597 |
| 169 | Ga0163162_10742372 | 3300013306 | Bacteria | 1101 |
| 170 | Ga0157372_10547459 | 3300013307 | Bacteria | 1349 |
| 171 | Ga0157375_10628751 | 3300013308 | Bacteria | 1231 |
| 172 | Ga0157375_10673053 | 3300013308 | Bacteria | 1190 |
| 173 | Ga0182008_10016794 | 3300014497 | Bacteria | 3797 |
| 174 | Ga0182008_10060321 | 3300014497 | Bacteria | 1870 |
| 175 | Ga0157379_10010131 | 3300014968 | Bacteria | 8217 |
| 176 | Ga0157379_10046800 | 3300014968 | Bacteria | 3860 |
| 177 | Ga0182006_1012034 | 3300015261 | Bacteria | 3789 |
| 178 | Ga0182007_10002886 | 3300015262 | Bacteria | 8357 |
| 179 | Ga0163161_10008638 | 3300017792 | Bacteria | 7044 |
| 180 | Ga0163161_10127069 | 3300017792 | Bacteria | 1921 |
| 181 | Ga0209674_100108 | 3300025226 | Bacteria | 150893 |
| 182 | Ga0209674_101427 | 3300025226 | Bacteria | 6364 |
| 183 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 184 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 185 | Ga0209672_100689 | 3300025228 | Bacteria | 16922 |
| 186 | Ga0209147_100794 | 3300025229 | Bacteria | 15311 |
| 187 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 188 | Ga0209563_100079 | 3300025230 | Bacteria | 203017 |
| 189 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 190 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 191 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 192 | Ga0207425_1002257 | 3300025245 | Bacteria | 6971 |
| 193 | Ga0209677_103790 | 3300025253 | Bacteria | 4694 |
| 194 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 195 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 196 | Ga0209148_1000084 | 3300025254 | Bacteria | 268147 |
| 197 | Ga0209148_1000199 | 3300025254 | Bacteria | 108936 |
| 198 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 199 | Ga0209129_1000085 | 3300025258 | Bacteria | 181765 |
| 200 | Ga0209565_1001386 | 3300025263 | Bacteria | 10846 |
| 201 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 202 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 203 | Ga0209673_1000615 | 3300025273 | Bacteria | 54497 |
| 204 | Ga0209673_1002626 | 3300025273 | Bacteria | 12066 |
| 205 | Ga0209673_1006510 | 3300025273 | Bacteria | 5620 |
| 206 | Ga0209673_1012617 | 3300025273 | Bacteria | 3394 |
| 207 | Ga0209130_1001597 | 3300025284 | Bacteria | 14166 |
| 208 | Ga0209130_1002030 | 3300025284 | Bacteria | 11020 |
| 209 | Ga0209675_1002464 | 3300025291 | Bacteria | 9498 |
| 210 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 211 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 212 | Ga0209676_1000194 | 3300025292 | Bacteria | 136666 |
| 213 | Ga0209676_1003187 | 3300025292 | Bacteria | 10411 |
| 214 | Ga0209025_1017372 | 3300025294 | Bacteria | 4159 |
| 215 | Ga0209025_1033643 | 3300025294 | Bacteria | 2363 |
| 216 | Ga0209025_1052688 | 3300025294 | Bacteria | 1604 |
| 217 | Ga0209564_1000183 | 3300025295 | Bacteria | 150409 |
| 218 | Ga0209564_1000198 | 3300025295 | Bacteria | 138511 |
| 219 | Ga0209758_1000049 | 3300025297 | Bacteria | 345104 |
| 220 | Ga0209758_1000204 | 3300025297 | Bacteria | 131754 |
| 221 | Ga0209758_1005124 | 3300025297 | Bacteria | 10354 |
| 222 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 223 | Ga0209050_1000122 | 3300025298 | Bacteria | 195305 |
| 224 | Ga0209050_1001124 | 3300025298 | Bacteria | 32325 |
| 225 | Ga0209050_1003795 | 3300025298 | Bacteria | 10793 |
| 226 | Ga0209256_1000098 | 3300025299 | Bacteria | 204152 |
| 227 | Ga0209256_1000140 | 3300025299 | Bacteria | 152770 |
| 228 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 229 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 230 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 231 | Ga0209051_1000159 | 3300025303 | Bacteria | 126836 |
| 232 | Ga0209051_1000168 | 3300025303 | Bacteria | 119312 |
| 233 | Ga0209051_1000179 | 3300025303 | Bacteria | 114055 |
| 234 | Ga0209051_1003104 | 3300025303 | Bacteria | 11203 |
| 235 | Ga0209051_1003161 | 3300025303 | Bacteria | 11046 |
| 236 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 237 | Ga0209257_1004330 | 3300025304 | Bacteria | 11115 |
| 238 | Ga0209257_1012245 | 3300025304 | Bacteria | 3993 |
| 239 | Ga0207656_10008267 | 3300025321 | Bacteria | 3821 |
| 240 | Ga0207655_1003001 | 3300025728 | Bacteria | 12929 |
| 241 | Ga0207682_10008598 | 3300025893 | Bacteria | 4036 |
| 242 | Ga0207645_10007443 | 3300025907 | Bacteria | 7732 |
| 243 | Ga0207705_10242982 | 3300025909 | Bacteria | 1372 |
| 244 | Ga0207684_10285567 | 3300025910 | Bacteria | 1423 |
| 245 | Ga0207654_10105147 | 3300025911 | Bacteria | 1746 |
| 246 | Ga0207707_10004410 | 3300025912 | Bacteria | 12423 |
| 247 | Ga0207695_10029800 | 3300025913 | Bacteria | 6021 |
| 248 | Ga0207671_10040139 | 3300025914 | Bacteria | 3465 |
| 249 | Ga0207671_10144983 | 3300025914 | Bacteria | 1831 |
| 250 | Ga0207657_10153442 | 3300025919 | Bacteria | 1874 |
| 251 | Ga0207652_10276992 | 3300025921 | Bacteria | 1513 |
| 252 | Ga0207694_10019947 | 3300025924 | Bacteria | 5071 |
| 253 | Ga0207694_10054411 | 3300025924 | Bacteria | 3105 |
| 254 | Ga0207659_10003471 | 3300025926 | Bacteria | 9455 |
| 255 | Ga0207659_10151698 | 3300025926 | Bacteria | 1810 |
| 256 | Ga0207687_10154543 | 3300025927 | Bacteria | 1754 |
| 257 | Ga0207644_10171981 | 3300025931 | Bacteria | 1692 |
| 258 | Ga0207690_10050236 | 3300025932 | Bacteria | 2783 |
| 259 | Ga0207706_10013193 | 3300025933 | Bacteria | 7518 |
| 260 | Ga0207706_10283538 | 3300025933 | Bacteria | 1444 |
| 261 | Ga0207709_10001694 | 3300025935 | Bacteria | 14834 |
| 262 | Ga0207709_10002682 | 3300025935 | Bacteria | 11029 |
| 263 | Ga0207709_10035853 | 3300025935 | Bacteria | 2936 |
| 264 | Ga0207709_10181440 | 3300025935 | Bacteria | 1487 |
| 265 | Ga0207704_10196170 | 3300025938 | Bacteria | 1473 |
| 266 | Ga0207665_10024609 | 3300025939 | Bacteria | 3971 |
| 267 | Ga0207691_10033715 | 3300025940 | Bacteria | 4767 |
| 268 | Ga0207691_10135769 | 3300025940 | Bacteria | 2169 |
| 269 | Ga0207691_10181075 | 3300025940 | Bacteria | 1841 |
| 270 | Ga0207691_10216981 | 3300025940 | Bacteria | 1660 |
| 271 | Ga0207711_10034128 | 3300025941 | Bacteria | 4309 |
| 272 | Ga0207689_10036877 | 3300025942 | Bacteria | 4057 |
| 273 | Ga0207679_10004143 | 3300025945 | Bacteria | 9009 |
| 274 | Ga0207679_10041704 | 3300025945 | Bacteria | 3293 |
| 275 | Ga0207667_10060956 | 3300025949 | Bacteria | 3948 |
| 276 | Ga0207667_10226574 | 3300025949 | Bacteria | 1915 |
| 277 | Ga0207667_10511418 | 3300025949 | Bacteria | 1217 |
| 278 | Ga0207668_10177763 | 3300025972 | Bacteria | 1676 |
| 279 | Ga0207640_10107962 | 3300025981 | Bacteria | 1966 |
| 280 | Ga0207658_10120856 | 3300025986 | Bacteria | 2088 |
| 281 | Ga0207677_10002517 | 3300026023 | Bacteria | 9609 |
| 282 | Ga0207677_10131809 | 3300026023 | Bacteria | 1899 |
| 283 | Ga0207703_10082857 | 3300026035 | Bacteria | 2678 |
| 284 | Ga0207678_10000966 | 3300026067 | Bacteria | 26297 |
| 285 | Ga0207708_10256894 | 3300026075 | Bacteria | 1409 |
| 286 | Ga0207702_10005766 | 3300026078 | Bacteria | 10771 |
| 287 | Ga0207702_10199014 | 3300026078 | Bacteria | 1856 |
| 288 | Ga0207648_10013431 | 3300026089 | Bacteria | 7621 |
| 289 | Ga0207648_10308790 | 3300026089 | Bacteria | 1419 |
| 290 | Ga0207676_10063803 | 3300026095 | Bacteria | 2927 |
| 291 | Ga0207674_10012238 | 3300026116 | Bacteria | 9598 |
| 292 | Ga0207675_100038504 | 3300026118 | Bacteria | 4463 |
| 293 | Ga0207683_10063312 | 3300026121 | Bacteria | 3258 |
| 294 | Ga0207683_10194424 | 3300026121 | Bacteria | 1843 |
| 295 | Ga0207683_10217258 | 3300026121 | Bacteria | 1741 |
| 296 | Ga0207683_10462981 | 3300026121 | Bacteria | 1169 |
| 297 | Ga0207698_10265856 | 3300026142 | Bacteria | 1578 |
| 298 | Ga0207698_10371672 | 3300026142 | Bacteria | 1357 |
| 299 | Ga0209970_1000017 | 3300027614 | Bacteria | 21804 |
| 300 | Ga0209588_1021228 | 3300027671 | Bacteria | 2038 |
| 301 | Ga0209974_10001308 | 3300027876 | Bacteria | 8953 |
| 302 | Ga0207428_10102069 | 3300027907 | Bacteria | 2215 |
| 303 | Ga0268265_10030448 | 3300028380 | Bacteria | 3887 |
| 304 | Ga0307515_10000188 | 3300028794 | Bacteria | 151439 |
| 305 | Ga0307515_10000213 | 3300028794 | Bacteria | 142742 |
| 306 | Ga0307515_10000708 | 3300028794 | Bacteria | 76903 |
| 307 | Ga0307515_10002971 | 3300028794 | Bacteria | 35983 |
| 308 | Ga0307515_10012188 | 3300028794 | Bacteria | 16207 |
| 309 | Ga0307515_10013083 | 3300028794 | Bacteria | 15535 |
| 310 | Ga0307512_10111196 | 3300030522 | Bacteria | 1804 |
| 311 | Ga0316177_1169476 | 3300030731 | Bacteria | 2939 |
| 312 | Ga0316176_1023454 | 3300030732 | Bacteria | 2941 |
| 313 | Ga0314311_1040207 | 3300030733 | Bacteria | 5569 |
| 314 | Ga0316179_1015655 | 3300030734 | Bacteria | 2497 |
| 315 | Ga0316180_1121156 | 3300030736 | Bacteria | 5577 |
| 316 | Ga0316183_1091139 | 3300030742 | Bacteria | 8181 |
| 317 | Ga0316181_1025223 | 3300030744 | Bacteria | 5418 |
| 318 | Ga0316182_1079883 | 3300030745 | Bacteria | 3734 |
| 319 | Ga0307513_10002965 | 3300031456 | Bacteria | 23158 |
| 320 | Ga0307513_10042931 | 3300031456 | Bacteria | 4972 |
| 321 | Ga0307513_10138740 | 3300031456 | Bacteria | 2362 |
| 322 | Ga0307513_10255435 | 3300031456 | Bacteria | 1546 |
| 323 | Ga0307509_10048637 | 3300031507 | Bacteria | 4552 |
| 324 | Ga0307509_10049375 | 3300031507 | Bacteria | 4511 |
| 325 | Ga0307408_100067059 | 3300031548 | Bacteria | 2638 |
| 326 | Ga0307408_100078955 | 3300031548 | Bacteria | 2454 |
| 327 | Ga0307408_100117457 | 3300031548 | Bacteria | 2054 |
| 328 | Ga0307508_10000169 | 3300031616 | Bacteria | 78769 |
| 329 | Ga0307514_10007800 | 3300031649 | Bacteria | 9197 |
| 330 | Ga0307514_10014677 | 3300031649 | Bacteria | 6481 |
| 331 | Ga0307514_10063252 | 3300031649 | Bacteria | 2810 |
| 332 | Ga0307514_10120357 | 3300031649 | Bacteria | 1833 |
| 333 | Ga0307516_10005212 | 3300031730 | Bacteria | 15650 |
| 334 | Ga0307516_10123683 | 3300031730 | Bacteria | 2374 |
| 335 | Ga0307413_10104799 | 3300031824 | Bacteria | 1878 |
| 336 | Ga0307406_10022724 | 3300031901 | Bacteria | 3723 |
| 337 | Ga0307412_10103455 | 3300031911 | Bacteria | 2018 |
| 338 | Ga0307416_100040223 | 3300032002 | Bacteria | 3629 |
| 339 | Ga0307416_100078067 | 3300032002 | Bacteria | 2784 |
| 340 | Ga0307416_100078731 | 3300032002 | Bacteria | 2775 |
| 341 | Ga0307416_100398009 | 3300032002 | Bacteria | 1414 |
| 342 | Ga0307411_10052538 | 3300032005 | Bacteria | 2665 |
| 343 | Ga0307507_10018253 | 3300033179 | Bacteria | 7989 |
| 344 | Ga0373958_0023793 | 3300034819 | Bacteria | 1155 |
| 345 | Ga0373929_0006344 | 3300035085 | Bacteria | 2137 |
| 346 | Ga0373960_0003082 | 3300035121 | Bacteria | 3765 |
| 347 | Ga0373955_0006177 | 3300035172 | Bacteria | 5447 |
| 348 | Ga0373962_0036338 | 3300035242 | Bacteria | 1371 |
| 349 | Ga0373924_0004289 | 3300035410 | Bacteria | 4974 |
| 350 | Ga0373931_0009317 | 3300035691 | Bacteria | 4689 |
| 351 | Ga0373931_0105765 | 3300035691 | Bacteria | 1590 |
| 352 | Ga0373931_0150365 | 3300035691 | Bacteria | 1357 |
| 353 | Ga0373933_0003218 | 3300035724 | Bacteria | 9119 |
| 354 | Ga0373937_0036959 | 3300036401 | Bacteria | 4450 |
| 355 | Ga0395899_0022621 | 3300037312 | Bacteria | 4762 |
| 356 | Ga0395899_0125367 | 3300037312 | Bacteria | 1837 |
| 357 | Ga0395900_0071266 | 3300037418 | Bacteria | 3572 |
| 358 | Ga0395900_0138075 | 3300037418 | Bacteria | 2497 |
| 359 | Ga0395900_0177644 | 3300037418 | Bacteria | 2165 |
| 360 | Ga0395900_0380594 | 3300037418 | Bacteria | 1379 |
| 361 | Ga0395905_0014616 | 3300037471 | Bacteria | 7488 |
| 362 | Ga0395905_0066409 | 3300037471 | Bacteria | 3378 |
| 363 | Ga0395905_0102869 | 3300037471 | Bacteria | 2682 |
| 364 | Ga0395905_0175098 | 3300037471 | Bacteria | 2014 |
| 365 | Ga0395905_0196312 | 3300037471 | Bacteria | 1892 |
| 366 | Ga0395901_0000278 | 3300038443 | Bacteria | 63368 |
| 367 | Ga0395901_0161394 | 3300038443 | Bacteria | 2354 |
| 368 | Ga0395901_0173613 | 3300038443 | Bacteria | 2261 |
| 369 | Ga0439436_0000635 | 3300041404 | Bacteria | 9346 |
| 370 | Ga0439436_0008849 | 3300041404 | Bacteria | 3089 |
| 371 | Ga0439439_0000329 | 3300041406 | Bacteria | 7680 |
| 372 | Ga0439466_0004216 | 3300041411 | Bacteria | 5551 |
| 373 | Ga0439466_0034072 | 3300041411 | Bacteria | 1728 |
| 374 | Ga0439465_0000176 | 3300041413 | Bacteria | 16369 |
| 375 | Ga0451791_0852696 | 3300041451 | Bacteria | 1294 |
| 376 | Ga0451807_0287218 | 3300041486 | Bacteria | 3567 |
| 377 | Ga0451837_0502835 | 3300041494 | Bacteria | 1503 |
| 378 | Ga0439431_0002901 | 3300041997 | Bacteria | 3773 |
| 379 | Ga0439442_023339 | 3300042002 | Bacteria | 1285 |
| 380 | Ga0439448_0079393 | 3300042005 | Bacteria | 1100 |
| 381 | Ga0439432_011896 | 3300042006 | Bacteria | 2990 |
| 382 | Ga0439449_0000632 | 3300042007 | Bacteria | 13206 |
| 383 | Ga0439449_0000947 | 3300042007 | Bacteria | 11364 |
| 384 | Ga0439449_0001266 | 3300042007 | Bacteria | 9907 |
| 385 | Ga0439449_0012954 | 3300042007 | Bacteria | 3135 |
| 386 | Ga0439449_0080520 | 3300042007 | Bacteria | 1201 |
| 387 | Ga0439452_007456 | 3300042010 | Bacteria | 3349 |
| 388 | Ga0439462_0002245 | 3300042015 | Bacteria | 4461 |
| 389 | Ga0450923_010055 | 3300042125 | Bacteria | 1669 |
| 390 | Ga0450894_005010 | 3300042131 | Bacteria | 1712 |
| 391 | Ga0450896_003216 | 3300042133 | Bacteria | 2158 |
| 392 | Ga0450906_006009 | 3300042145 | Bacteria | 2470 |
| 393 | Ga0450910_005952 | 3300042147 | Bacteria | 1674 |
| 394 | Ga0450910_006634 | 3300042147 | Bacteria | 1603 |
| 395 | Ga0439446_0007798 | 3300042156 | Bacteria | 2821 |
| 396 | Ga0439446_0013740 | 3300042156 | Bacteria | 2227 |
| 397 | Ga0450908_001714 | 3300042184 | Bacteria | 4276 |
| 398 | Ga0450908_013820 | 3300042184 | Bacteria | 1456 |
| 399 | Ga0439434_0003310 | 3300042435 | Bacteria | 4734 |
| 400 | Ga0439434_0034341 | 3300042435 | Bacteria | 1548 |
| 401 | Ga0450918_002415 | 3300042531 | Bacteria | 3529 |
| 402 | Ga0451577_0018873 | 3300042876 | Bacteria | 6347 |
| 403 | Ga0466969_0006732 | 3300044656 | Bacteria | 6111 |
| 404 | Ga0466969_0094914 | 3300044656 | Bacteria | 1409 |
| 405 | Ga0466965_0150659 | 3300044683 | Bacteria | 1215 |
| 406 | Ga0466966_0003207 | 3300044684 | Bacteria | 10777 |
| 407 | Ga0466966_0024310 | 3300044684 | Bacteria | 3963 |
| 408 | Ga0466961_0032923 | 3300044693 | Bacteria | 3330 |
| 409 | Ga0453684_0000419 | 3300044712 | Bacteria | 173463 |
| 410 | Ga0453684_0599544 | 3300044712 | Bacteria | 1207 |
| 411 | Ga0466957_0124376 | 3300044842 | Bacteria | 1647 |
| 412 | Ga0466957_0356659 | 3300044842 | Bacteria | 993 |
| 413 | Ga0466960_0037302 | 3300044901 | Bacteria | 2279 |
| 414 | Ga0466959_0040342 | 3300045049 | Bacteria | 3448 |
| 415 | Ga0466959_0040630 | 3300045049 | Bacteria | 3435 |
| 416 | Ga0451576_0230948 | 3300045051 | Bacteria | 1932 |
| 417 | Ga0466958_0159985 | 3300045836 | Bacteria | 1422 |
| 418 | Ga0495627_006476 | 3300046453 | Bacteria | 4586 |
| 419 | Ga0495592_0000330 | 3300046454 | Bacteria | 39376 |
| 420 | Ga0495650_0020417 | 3300046471 | Bacteria | 3231 |
| 421 | Ga0495605_0000830 | 3300046474 | Bacteria | 21843 |
| 422 | Ga0495639_0032220 | 3300046475 | Bacteria | 2337 |
| 423 | Ga0495662_0007567 | 3300046476 | Bacteria | 5361 |
| 424 | Ga0495584_0003615 | 3300046491 | Bacteria | 8432 |
| 425 | Ga0495607_0001878 | 3300046501 | Bacteria | 17819 |
| 426 | Ga0495608_0000582 | 3300046511 | Bacteria | 25075 |
| 427 | Ga0495620_0015787 | 3300046515 | Bacteria | 3804 |
| 428 | Ga0495620_0059825 | 3300046515 | Bacteria | 1591 |
| 429 | Ga0495628_0023314 | 3300046516 | Bacteria | 5081 |
| 430 | Ga0495630_0003958 | 3300046517 | Bacteria | 10354 |
| 431 | Ga0495637_0003930 | 3300046520 | Bacteria | 7787 |
| 432 | Ga0495643_0027862 | 3300046522 | Bacteria | 3171 |
| 433 | Ga0495643_0050136 | 3300046522 | Bacteria | 2249 |
| 434 | Ga0495663_0026887 | 3300046525 | Bacteria | 1686 |
| 435 | Ga0495666_0029460 | 3300046526 | Bacteria | 2700 |
| 436 | Ga0495652_0085622 | 3300046529 | Bacteria | 2589 |
| 437 | Ga0495654_0004569 | 3300046530 | Bacteria | 8186 |
| 438 | Ga0495640_0000361 | 3300046533 | Bacteria | 31989 |
| 439 | Ga0495586_0001795 | 3300046535 | Bacteria | 11724 |
| 440 | Ga0495587_0013730 | 3300046536 | Bacteria | 5089 |
| 441 | Ga0495598_0029235 | 3300046537 | Bacteria | 1535 |
| 442 | Ga0495598_0057519 | 3300046537 | Bacteria | 1190 |
| 443 | Ga0495621_0086755 | 3300046539 | Bacteria | 1174 |
| 444 | Ga0495667_0001990 | 3300046559 | Bacteria | 13534 |
| 445 | Ga0495667_0022413 | 3300046559 | Bacteria | 4254 |
| 446 | Ga0495656_0000087 | 3300046615 | Bacteria | 40520 |
| 447 | Ga0495656_0039910 | 3300046615 | Bacteria | 1953 |
| 448 | Ga0495634_0002172 | 3300046642 | Bacteria | 16474 |
| 449 | Ga0495625_0033336 | 3300046660 | Bacteria | 3809 |
| 450 | Ga0495625_0079748 | 3300046660 | Bacteria | 2281 |
| 451 | Ga0495625_0137941 | 3300046660 | Bacteria | 1647 |
| 452 | Ga0495635_0027700 | 3300046663 | Bacteria | 3941 |
| 453 | Ga0495661_0001417 | 3300046665 | Bacteria | 20092 |
| 454 | Ga0495661_0068337 | 3300046665 | Bacteria | 2084 |
| 455 | Ga0495588_0000141 | 3300046674 | Bacteria | 104615 |
| 456 | Ga0495658_0002569 | 3300046683 | Bacteria | 9129 |
| 457 | Ga0495658_0012080 | 3300046683 | Bacteria | 4361 |
| 458 | Ga0495613_0003055 | 3300046689 | Bacteria | 12507 |
| 459 | Ga0495624_0092319 | 3300046690 | Bacteria | 1867 |
| 460 | Ga0495670_0075575 | 3300046691 | Bacteria | 1710 |
| 461 | Ga0495649_0006020 | 3300046694 | Bacteria | 7592 |
| 462 | Ga0495649_0013627 | 3300046694 | Bacteria | 4687 |
| 463 | Ga0495589_0000439 | 3300046794 | Bacteria | 30550 |
| 464 | Ga0495600_0001984 | 3300046809 | Bacteria | 11501 |
| 465 | Ga0495660_0000002 | 3300046810 | Bacteria | 1229481 |
| 466 | Ga0495660_0000200 | 3300046810 | Bacteria | 62557 |
| 467 | Ga0495660_0039930 | 3300046810 | Bacteria | 2603 |
| 468 | Ga0495674_0091211 | 3300047319 | Bacteria | 2603 |
| 469 | Ga0495672_0000977 | 3300047320 | Bacteria | 29598 |
| 470 | Ga0495680_0017719 | 3300047322 | Bacteria | 6066 |
| 471 | Ga0495683_0099996 | 3300047323 | Bacteria | 1395 |
| 472 | Ga0495687_001379 | 3300047443 | Bacteria | 22465 |
| 473 | Ga0495687_016288 | 3300047443 | Bacteria | 3740 |
| 474 | Ga0495593_0010510 | 3300047673 | Bacteria | 5342 |
| 475 | Ga0495614_0003596 | 3300048089 | Bacteria | 6947 |
| 476 | Ga0495626_0000182 | 3300048091 | Bacteria | 76384 |
| 477 | Ga0496100_0127053 | 3300048903 | Bacteria | 1791 |
| 478 | Ga0496101_0005305 | 3300048904 | Bacteria | 8210 |
| 479 | Ga0496102_0051880 | 3300048905 | Bacteria | 3736 |
| 480 | Ga0496103_0066729 | 3300048906 | Bacteria | 2246 |
| 481 | Ga0496106_0043124 | 3300048909 | Bacteria | 3384 |
| 482 | Ga0496107_0038329 | 3300048910 | Bacteria | 3439 |
| 483 | Ga0496113_0036113 | 3300048916 | Bacteria | 3619 |
| 484 | Ga0496114_0205600 | 3300048917 | Bacteria | 1726 |
| 485 | Ga0496116_0026980 | 3300048919 | Bacteria | 4188 |
| 486 | Ga0496116_0075080 | 3300048919 | Bacteria | 2123 |
| 487 | Ga0496117_0009871 | 3300048920 | Bacteria | 8790 |
| 488 | Ga0496117_0024214 | 3300048920 | Bacteria | 4809 |
| 489 | Ga0496118_0029354 | 3300048921 | Bacteria | 4613 |
| 490 | Ga0496121_0179289 | 3300048924 | Bacteria | 1531 |
| 491 | Ga0496122_0004105 | 3300048925 | Bacteria | 18443 |
| 492 | Ga0496122_0055825 | 3300048925 | Bacteria | 2951 |
| 493 | Ga0496122_0179834 | 3300048925 | Bacteria | 1263 |
| 494 | Ga0496123_0005358 | 3300048926 | Bacteria | 12953 |
| 495 | Ga0496124_0000138 | 3300048927 | Bacteria | 150311 |
| 496 | Ga0496124_0062120 | 3300048927 | Bacteria | 3127 |
| 497 | Ga0496124_0112561 | 3300048927 | Bacteria | 2188 |
| 498 | Ga0496124_0200832 | 3300048927 | Bacteria | 1516 |
| 499 | Ga0496125_0031422 | 3300048928 | Bacteria | 4733 |
| 500 | Ga0496125_0050031 | 3300048928 | Bacteria | 3465 |
| 501 | Ga0496126_0153355 | 3300048929 | Bacteria | 1973 |
| 502 | Ga0501036_0223135 | 3300049572 | Bacteria | 1582 |
| 503 | Ga0501038_0160696 | 3300049574 | Bacteria | 1826 |
| 504 | Ga0501039_0040575 | 3300049575 | Bacteria | 3593 |
| 505 | Ga0501039_0290618 | 3300049575 | Bacteria | 1285 |
| 506 | Ga0501040_0033539 | 3300049576 | Bacteria | 3478 |
| 507 | Ga0501042_0152012 | 3300049578 | Bacteria | 1669 |
| 508 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 509 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 510 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 511 | Ga0501048_0009085 | 3300049582 | Bacteria | 7480 |
| 512 | Ga0501048_0019035 | 3300049582 | Bacteria | 5045 |
| 513 | Ga0501071_0092361 | 3300049587 | Bacteria | 2224 |
| 514 | Ga0501072_0282786 | 3300049588 | Bacteria | 1319 |
| 515 | Ga0501074_0142227 | 3300049590 | Bacteria | 1716 |
| 516 | Ga0501075_0030571 | 3300049591 | Bacteria | 3990 |
| 517 | Ga0501076_0013791 | 3300049592 | Bacteria | 6065 |
| 518 | Ga0501077_0081313 | 3300049593 | Bacteria | 2052 |
| 519 | Ga0501221_044007 | 3300049704 | Bacteria | 984 |
| 520 | Ga0501225_0001352 | 3300049705 | Bacteria | 7631 |
| 521 | Ga0501079_0008396 | 3300049741 | Bacteria | 7828 |
| 522 | Ga0501080_0117148 | 3300049742 | Bacteria | 2469 |
| 523 | Ga0501081_0014387 | 3300049743 | Bacteria | 5219 |
| 524 | Ga0501083_0187483 | 3300049744 | Bacteria | 1350 |
| 525 | Ga0501035_0000430 | 3300049822 | Bacteria | 47325 |
| 526 | Ga0501044_0227265 | 3300049823 | Bacteria | 1815 |
| 527 | Ga0501045_0039184 | 3300049824 | Bacteria | 3448 |
| 528 | nmdc:mga03n38_45006_c1 | 3300050490 | Bacteria | 1942 |
| 529 | nmdc:mga00v17_15488_c1 | 3300050491 | Bacteria | 4281 |
| 530 | nmdc:mga0k408_15212_c1 | 3300050493 | Bacteria | 4251 |
| 531 | nmdc:mga0k408_1969_c1 | 3300050493 | Bacteria | 11007 |
| 532 | nmdc:mga0k408_23388_c1 | 3300050493 | Bacteria | 3485 |
| 533 | nmdc:mga0k408_35418_c1 | 3300050493 | Bacteria | 2863 |
| 534 | nmdc:mga0k408_769_c1 | 3300050493 | Bacteria | 17593 |
| 535 | nmdc:mga0k408_82559_c1 | 3300050493 | Bacteria | 1883 |
| 536 | nmdc:mga06z11_22994_c1 | 3300050494 | Bacteria | 2921 |
| 537 | nmdc:mga07m45_104352_c1 | 3300050496 | Bacteria | 1630 |
| 538 | nmdc:mga07m45_187765_c1 | 3300050496 | Bacteria | 1202 |
| 539 | nmdc:mga07m45_93727_c1 | 3300050496 | Bacteria | 1721 |
| 540 | nmdc:mga07m45_969_c1 | 3300050496 | Bacteria | 12632 |
| 541 | nmdc:mga0rr50_145120_c1 | 3300050513 | Bacteria | 1913 |
| 542 | nmdc:mga08x19_18296_c1 | 3300050514 | Bacteria | 4295 |
| 543 | nmdc:mga08x19_26554_c1 | 3300050514 | Bacteria | 3614 |
| 544 | nmdc:mga08x19_27548_c1 | 3300050514 | Bacteria | 3554 |
| 545 | nmdc:mga0a205_32392_c1 | 3300050515 | Bacteria | 5012 |
| 546 | Ga0495601_0016509 | 3300053077 | Bacteria | 4475 |
| 547 | Ga0500610_0014027 | 3300053079 | Bacteria | 3748 |
| 548 | Ga0500635_0000005 | 3300053080 | Bacteria | 187821 |
| 549 | Ga0500578_0000058 | 3300053086 | Bacteria | 119650 |
| 550 | Ga0500643_009686 | 3300053087 | Bacteria | 3658 |
| 551 | Ga0500651_0000125 | 3300053093 | Bacteria | 47146 |
| 552 | Ga0500571_006911 | 3300053110 | Bacteria | 6150 |
| 553 | Ga0500607_015269 | 3300053121 | Bacteria | 4431 |
| 554 | Ga0500642_0000990 | 3300053130 | Bacteria | 8165 |
| 555 | Ga0500652_000300 | 3300053131 | Bacteria | 17910 |
| 556 | Ga0500655_002364 | 3300053133 | Bacteria | 3454 |
| 557 | Ga0500658_0002237 | 3300053134 | Bacteria | 7509 |
| 558 | Ga0500574_000720 | 3300053141 | Bacteria | 4384 |
| 559 | Ga0500622_0000094 | 3300053156 | Bacteria | 91975 |
| 560 | Ga0500622_0007719 | 3300053156 | Bacteria | 6075 |
| 561 | Ga0500627_0054268 | 3300053158 | Bacteria | 1752 |
| 562 | Ga0500636_0041368 | 3300053177 | Bacteria | 2726 |
| 563 | Ga0500587_000079 | 3300053739 | Bacteria | 8123 |
| 564 | Ga0501084_0099090 | 3300054114 | Bacteria | 2447 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028794 | Ga0307515_10000708 | Ga0307515_1000070825 | 300 |
| 2 | 3300030522 | Ga0307512_10111196 | Ga0307512_101111962 | 300 |
| 3 | 3300053080 | Ga0500635_0000005 | Ga0500635_0000005_87634_88599 | 301 |
| 4 | 3300013306 | Ga0163162_10742372 | Ga0163162_107423721 | 302 |
| 5 | 3300009177 | Ga0105248_10357074 | Ga0105248_103570742 | 304 |
| 6 | 3300005355 | Ga0070671_100150526 | Ga0070671_1001505262 | 305 |
| 7 | 3300013306 | Ga0163162_10355996 | Ga0163162_103559962 | 305 |
| 8 | 3300025931 | Ga0207644_10171981 | Ga0207644_101719812 | 305 |
| 9 | 3300006195 | Ga0075366_10017732 | Ga0075366_100177322 | 306 |
| 10 | 3300006353 | Ga0075370_10163990 | Ga0075370_101639902 | 306 |
| 11 | 3300027876 | Ga0209974_10001308 | Ga0209974_100013086 | 306 |
| 12 | 3300028794 | Ga0307515_10002971 | Ga0307515_100029718 | 306 |
| 13 | 3300028794 | Ga0307515_10013083 | Ga0307515_100130839 | 306 |
| 14 | 3300031456 | Ga0307513_10042931 | Ga0307513_100429314 | 306 |
| 15 | 3300031507 | Ga0307509_10048637 | Ga0307509_100486374 | 306 |
| 16 | 3300031616 | Ga0307508_10000169 | Ga0307508_1000016954 | 306 |
| 17 | 3300031649 | Ga0307514_10014677 | Ga0307514_100146773 | 306 |
| 18 | 3300033179 | Ga0307507_10018253 | Ga0307507_100182533 | 306 |
| 19 | 3300041451 | Ga0451791_0852696 | Ga0451791_0852696_282_1232 | 306 |
| 20 | 3300042876 | Ga0451577_0018873 | Ga0451577_0018873_1994_2953 | 306 |
| 21 | 3300046515 | Ga0495620_0059825 | Ga0495620_0059825_188_1138 | 306 |
| 22 | 3300046522 | Ga0495643_0027862 | Ga0495643_0027862_2008_2958 | 306 |
| 23 | 3300046660 | Ga0495625_0079748 | Ga0495625_0079748_603_1553 | 306 |
| 24 | 3300050493 | nmdc:mga0k408_23388_c1 | nmdc:mga0k408_23388_c1_2461_3408 | 306 |
| 25 | 3300050496 | nmdc:mga07m45_187765_c1 | nmdc:mga07m45_187765_c1_166_1116 | 306 |
| 26 | 3300053739 | Ga0500587_000079 | Ga0500587_000079_5097_6047 | 306 |
| 27 | 3300049572 | Ga0501036_0223135 | Ga0501036_0223135_19_945 | 307 |
| 28 | 3300003752 | Ga0055539_1001372 | Ga0055539_10013723 | 308 |
| 29 | 3300003756 | Ga0055533_1001365 | Ga0055533_10013653 | 308 |
| 30 | 3300003759 | Ga0055525_1000211 | Ga0055525_100021148 | 308 |
| 31 | 3300003760 | Ga0055527_1000257 | Ga0055527_100025718 | 308 |
| 32 | 3300003760 | Ga0055527_1000263 | Ga0055527_100026317 | 308 |
| 33 | 3300003761 | Ga0055535_1000541 | Ga0055535_100054111 | 308 |
| 34 | 3300003761 | Ga0055535_1000731 | Ga0055535_100073110 | 308 |
| 35 | 3300003762 | Ga0055542_1000567 | Ga0055542_100056711 | 308 |
| 36 | 3300003762 | Ga0055542_1000578 | Ga0055542_100057817 | 308 |
| 37 | 3300003763 | Ga0055529_1000538 | Ga0055529_100053811 | 308 |
| 38 | 3300003763 | Ga0055529_1000850 | Ga0055529_10008508 | 308 |
| 39 | 3300005614 | Ga0068856_100003150 | Ga0068856_10000315011 | 308 |
| 40 | 3300013307 | Ga0157372_10547459 | Ga0157372_105474592 | 308 |
| 41 | 3300025226 | Ga0209674_100108 | Ga0209674_10010834 | 308 |
| 42 | 3300025226 | Ga0209674_101427 | Ga0209674_1014273 | 308 |
| 43 | 3300025228 | Ga0209672_100007 | Ga0209672_100007319 | 308 |
| 44 | 3300025228 | Ga0209672_100009 | Ga0209672_10000944 | 308 |
| 45 | 3300025230 | Ga0209563_100079 | Ga0209563_100079186 | 308 |
| 46 | 3300025242 | Ga0209258_100011 | Ga0209258_100011598 | 308 |
| 47 | 3300025242 | Ga0209258_100046 | Ga0209258_10004618 | 308 |
| 48 | 3300025253 | Ga0209677_103790 | Ga0209677_1037903 | 308 |
| 49 | 3300025254 | Ga0209148_1000013 | Ga0209148_1000013598 | 308 |
| 50 | 3300025254 | Ga0209148_1000084 | Ga0209148_1000084112 | 308 |
| 51 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010319 | 308 |
| 52 | 3300025272 | Ga0209455_1000012 | Ga0209455_1000012598 | 308 |
| 53 | 3300026075 | Ga0207708_10256894 | Ga0207708_102568942 | 308 |
| 54 | 3300026078 | Ga0207702_10005766 | Ga0207702_100057666 | 308 |
| 55 | 3300045049 | Ga0466959_0040342 | Ga0466959_0040342_592_1518 | 308 |
| 56 | iso_pu_bacteria | 2643221556 | 2643801831 | 308 |
| 57 | iso_pu_bacteria | 2643221684 | 2644474375 | 308 |
| 58 | iso_pu_bacteria | 8047673197 | 8047676399 | 308 |
| 59 | 3300009176 | Ga0105242_10056360 | Ga0105242_100563602 | 309 |
| 60 | 3300013297 | Ga0157378_10042027 | Ga0157378_100420275 | 309 |
| 61 | 3300003759 | Ga0055525_1000023 | Ga0055525_1000023112 | 310 |
| 62 | 3300005339 | Ga0070660_100096218 | Ga0070660_1000962181 | 310 |
| 63 | 3300005458 | Ga0070681_10000172 | Ga0070681_1000017240 | 310 |
| 64 | 3300005563 | Ga0068855_100507589 | Ga0068855_1005075892 | 310 |
| 65 | 3300009176 | Ga0105242_10309203 | Ga0105242_103092031 | 310 |
| 66 | 3300025230 | Ga0209563_100011 | Ga0209563_100011426 | 310 |
| 67 | 3300025254 | Ga0209148_1000199 | Ga0209148_100019959 | 310 |
| 68 | 3300025912 | Ga0207707_10004410 | Ga0207707_1000441014 | 310 |
| 69 | 3300025919 | Ga0207657_10153442 | Ga0207657_101534422 | 310 |
| 70 | 3300025932 | Ga0207690_10050236 | Ga0207690_100502362 | 310 |
| 71 | 3300034819 | Ga0373958_0023793 | Ga0373958_0023793_130_1092 | 310 |
| 72 | 3300035085 | Ga0373929_0006344 | Ga0373929_0006344_654_1616 | 310 |
| 73 | 3300035121 | Ga0373960_0003082 | Ga0373960_0003082_949_1911 | 310 |
| 74 | 3300035242 | Ga0373962_0036338 | Ga0373962_0036338_247_1209 | 310 |
| 75 | 3300035691 | Ga0373931_0009317 | Ga0373931_0009317_3691_4653 | 310 |
| 76 | 3300037312 | Ga0395899_0022621 | Ga0395899_0022621_1538_2473 | 310 |
| 77 | 3300037418 | Ga0395900_0071266 | Ga0395900_0071266_2492_3427 | 310 |
| 78 | 3300037418 | Ga0395900_0138075 | Ga0395900_0138075_1551_2486 | 310 |
| 79 | 3300038443 | Ga0395901_0000278 | Ga0395901_0000278_1035_1970 | 310 |
| 80 | 3300041494 | Ga0451837_0502835 | Ga0451837_0502835_85_1071 | 310 |
| 81 | 3300042005 | Ga0439448_0079393 | Ga0439448_0079393_53_988 | 310 |
| 82 | 3300044656 | Ga0466969_0094914 | Ga0466969_0094914_221_1156 | 310 |
| 83 | 3300044683 | Ga0466965_0150659 | Ga0466965_0150659_17_952 | 310 |
| 84 | 3300044684 | Ga0466966_0003207 | Ga0466966_0003207_9591_10526 | 310 |
| 85 | 3300044684 | Ga0466966_0024310 | Ga0466966_0024310_2775_3713 | 310 |
| 86 | 3300044842 | Ga0466957_0356659 | Ga0466957_0356659_16_951 | 310 |
| 87 | 3300045049 | Ga0466959_0040630 | Ga0466959_0040630_679_1614 | 310 |
| 88 | 3300048905 | Ga0496102_0051880 | Ga0496102_0051880_265_1200 | 310 |
| 89 | 3300048906 | Ga0496103_0066729 | Ga0496103_0066729_673_1608 | 310 |
| 90 | 3300048916 | Ga0496113_0036113 | Ga0496113_0036113_681_1616 | 310 |
| 91 | 3300048925 | Ga0496122_0004105 | Ga0496122_0004105_1638_2573 | 310 |
| 92 | 3300048927 | Ga0496124_0112561 | Ga0496124_0112561_729_1664 | 310 |
| 93 | 3300049574 | Ga0501038_0160696 | Ga0501038_0160696_502_1452 | 310 |
| 94 | 3300049575 | Ga0501039_0040575 | Ga0501039_0040575_1243_2193 | 310 |
| 95 | 3300049575 | Ga0501039_0290618 | Ga0501039_0290618_209_1159 | 310 |
| 96 | 3300049576 | Ga0501040_0033539 | Ga0501040_0033539_2250_3200 | 310 |
| 97 | 3300049578 | Ga0501042_0152012 | Ga0501042_0152012_400_1350 | 310 |
| 98 | 3300049582 | Ga0501048_0019035 | Ga0501048_0019035_3742_4692 | 310 |
| 99 | 3300049587 | Ga0501071_0092361 | Ga0501071_0092361_187_1137 | 310 |
| 100 | 3300049588 | Ga0501072_0282786 | Ga0501072_0282786_95_1045 | 310 |
| 101 | 3300049590 | Ga0501074_0142227 | Ga0501074_0142227_603_1553 | 310 |
| 102 | 3300049591 | Ga0501075_0030571 | Ga0501075_0030571_2009_2959 | 310 |
| 103 | 3300049592 | Ga0501076_0013791 | Ga0501076_0013791_782_1732 | 310 |
| 104 | 3300049593 | Ga0501077_0081313 | Ga0501077_0081313_614_1564 | 310 |
| 105 | 3300049741 | Ga0501079_0008396 | Ga0501079_0008396_1806_2756 | 310 |
| 106 | 3300049742 | Ga0501080_0117148 | Ga0501080_0117148_1137_2087 | 310 |
| 107 | 3300049743 | Ga0501081_0014387 | Ga0501081_0014387_1569_2519 | 310 |
| 108 | 3300049744 | Ga0501083_0187483 | Ga0501083_0187483_46_996 | 310 |
| 109 | 3300049822 | Ga0501035_0000430 | Ga0501035_0000430_25211_26146 | 310 |
| 110 | 3300049823 | Ga0501044_0227265 | Ga0501044_0227265_452_1387 | 310 |
| 111 | 3300049824 | Ga0501045_0039184 | Ga0501045_0039184_294_1244 | 310 |
| 112 | 3300006914 | Ga0075436_100156505 | Ga0075436_1001565052 | 311 |
| 113 | 3300007076 | Ga0075435_100133477 | Ga0075435_1001334772 | 311 |
| 114 | 3300035691 | Ga0373931_0150365 | Ga0373931_0150365_160_1119 | 311 |
| 115 | 3300037418 | Ga0395900_0380594 | Ga0395900_0380594_240_1178 | 311 |
| 116 | 3300037471 | Ga0395905_0196312 | Ga0395905_0196312_834_1772 | 311 |
| 117 | 3300045836 | Ga0466958_0159985 | Ga0466958_0159985_29_967 | 311 |
| 118 | 3300046474 | Ga0495605_0000830 | Ga0495605_0000830_711_1649 | 311 |
| 119 | 3300046491 | Ga0495584_0003615 | Ga0495584_0003615_6591_7529 | 311 |
| 120 | 3300046501 | Ga0495607_0001878 | Ga0495607_0001878_720_1658 | 311 |
| 121 | 3300046522 | Ga0495643_0050136 | Ga0495643_0050136_947_1885 | 311 |
| 122 | 3300046615 | Ga0495656_0039910 | Ga0495656_0039910_361_1299 | 311 |
| 123 | 3300046665 | Ga0495661_0001417 | Ga0495661_0001417_11284_12222 | 311 |
| 124 | 3300046665 | Ga0495661_0068337 | Ga0495661_0068337_78_1016 | 311 |
| 125 | 3300046674 | Ga0495588_0000141 | Ga0495588_0000141_75249_76187 | 311 |
| 126 | 3300046694 | Ga0495649_0013627 | Ga0495649_0013627_3507_4445 | 311 |
| 127 | 3300046794 | Ga0495589_0000439 | Ga0495589_0000439_1231_2169 | 311 |
| 128 | 3300046810 | Ga0495660_0000200 | Ga0495660_0000200_40910_41848 | 311 |
| 129 | 3300047320 | Ga0495672_0000977 | Ga0495672_0000977_28444_29382 | 311 |
| 130 | 3300047323 | Ga0495683_0099996 | Ga0495683_0099996_211_1149 | 311 |
| 131 | 3300047443 | Ga0495687_001379 | Ga0495687_001379_20530_21468 | 311 |
| 132 | 3300048091 | Ga0495626_0000182 | Ga0495626_0000182_67233_68171 | 311 |
| 133 | 3300048903 | Ga0496100_0127053 | Ga0496100_0127053_332_1270 | 311 |
| 134 | 3300048909 | Ga0496106_0043124 | Ga0496106_0043124_332_1270 | 311 |
| 135 | 3300048910 | Ga0496107_0038329 | Ga0496107_0038329_779_1717 | 311 |
| 136 | 3300048925 | Ga0496122_0055825 | Ga0496122_0055825_1749_2687 | 311 |
| 137 | 3300048926 | Ga0496123_0005358 | Ga0496123_0005358_11889_12827 | 311 |
| 138 | 3300050513 | nmdc:mga0rr50_145120_c1 | nmdc:mga0rr50_145120_c1_109_1071 | 311 |
| 139 | 3300050514 | nmdc:mga08x19_27548_c1 | nmdc:mga08x19_27548_c1_2447_3409 | 311 |
| 140 | iso_pu_bacteria | 2585428062 | 2587754599 | 311 |
| 141 | 3300038443 | Ga0395901_0161394 | Ga0395901_0161394_999_1937 | 312 |
| 142 | iso_pu_bacteria | 2643221654 | 2644303911 | 312 |
| 143 | iso_pu_bacteria | 2643221683 | 2644464745 | 312 |
| 144 | 3300003215 | JGI25153J46596_10002591 | JGI25153J46596_100025912 | 313 |
| 145 | 3300025273 | Ga0209673_1012617 | Ga0209673_10126174 | 313 |
| 146 | 3300025297 | Ga0209758_1000204 | Ga0209758_1000204119 | 313 |
| 147 | 3300025298 | Ga0209050_1001124 | Ga0209050_100112430 | 313 |
| 148 | 3300049704 | Ga0501221_044007 | Ga0501221_044007_33_974 | 313 |
| 149 | 3300053086 | Ga0500578_0000058 | Ga0500578_0000058_97955_98914 | 313 |
| 150 | 3300009147 | Ga0114129_10534478 | Ga0114129_105344782 | 314 |
| 151 | 3300050493 | nmdc:mga0k408_82559_c1 | nmdc:mga0k408_82559_c1_690_1634 | 314 |
| 152 | 3300050496 | nmdc:mga07m45_93727_c1 | nmdc:mga07m45_93727_c1_344_1288 | 314 |
| 153 | 3300003162 | Ga0006778J45830_1008092 | Ga0006778J45830_10080921 | 315 |
| 154 | 3300003308 | Ga0006777J48905_1006622 | Ga0006777J48905_10066221 | 315 |
| 155 | 3300005328 | Ga0070676_10001955 | Ga0070676_100019555 | 315 |
| 156 | 3300005331 | Ga0070670_100056138 | Ga0070670_1000561384 | 315 |
| 157 | 3300005338 | Ga0068868_100234608 | Ga0068868_1002346081 | 315 |
| 158 | 3300005354 | Ga0070675_100040843 | Ga0070675_1000408434 | 315 |
| 159 | 3300005354 | Ga0070675_100373559 | Ga0070675_1003735591 | 315 |
| 160 | 3300005367 | Ga0070667_100039880 | Ga0070667_1000398803 | 315 |
| 161 | 3300005455 | Ga0070663_100149220 | Ga0070663_1001492201 | 315 |
| 162 | 3300005457 | Ga0070662_100216278 | Ga0070662_1002162781 | 315 |
| 163 | 3300005459 | Ga0068867_100003928 | Ga0068867_1000039286 | 315 |
| 164 | 3300006195 | Ga0075366_10157533 | Ga0075366_101575332 | 315 |
| 165 | 3300006353 | Ga0075370_10185073 | Ga0075370_101850731 | 315 |
| 166 | 3300014968 | Ga0157379_10010131 | Ga0157379_100101313 | 315 |
| 167 | 3300025907 | Ga0207645_10007443 | Ga0207645_100074434 | 315 |
| 168 | 3300025926 | Ga0207659_10003471 | Ga0207659_100034715 | 315 |
| 169 | 3300025933 | Ga0207706_10283538 | Ga0207706_102835382 | 315 |
| 170 | 3300025935 | Ga0207709_10035853 | Ga0207709_100358534 | 315 |
| 171 | 3300025986 | Ga0207658_10120856 | Ga0207658_101208562 | 315 |
| 172 | 3300026023 | Ga0207677_10131809 | Ga0207677_101318092 | 315 |
| 173 | 3300026067 | Ga0207678_10000966 | Ga0207678_1000096625 | 315 |
| 174 | 3300026089 | Ga0207648_10013431 | Ga0207648_100134317 | 315 |
| 175 | 3300026116 | Ga0207674_10012238 | Ga0207674_100122382 | 315 |
| 176 | 3300026121 | Ga0207683_10194424 | Ga0207683_101944244 | 315 |
| 177 | 3300027614 | Ga0209970_1000017 | Ga0209970_100001716 | 315 |
| 178 | 3300028794 | Ga0307515_10012188 | Ga0307515_100121888 | 315 |
| 179 | 3300031456 | Ga0307513_10138740 | Ga0307513_101387402 | 315 |
| 180 | 3300031507 | Ga0307509_10049375 | Ga0307509_100493756 | 315 |
| 181 | 3300031730 | Ga0307516_10005212 | Ga0307516_1000521212 | 315 |
| 182 | 3300042007 | Ga0439449_0000947 | Ga0439449_0000947_2485_3432 | 315 |
| 183 | 3300044712 | Ga0453684_0599544 | Ga0453684_0599544_207_1157 | 315 |
| 184 | 3300046694 | Ga0495649_0006020 | Ga0495649_0006020_2490_3449 | 315 |
| 185 | 3300046810 | Ga0495660_0000002 | Ga0495660_0000002_146028_146978 | 315 |
| 186 | 3300046810 | Ga0495660_0039930 | Ga0495660_0039930_1349_2308 | 315 |
| 187 | 3300047443 | Ga0495687_016288 | Ga0495687_016288_2758_3717 | 315 |
| 188 | 3300049579 | Ga0501043_0000002 | Ga0501043_0000002_103035_103988 | 315 |
| 189 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_103118_104071 | 315 |
| 190 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_126300_127253 | 315 |
| 191 | 3300049582 | Ga0501048_0009085 | Ga0501048_0009085_4002_4955 | 315 |
| 192 | 3300050493 | nmdc:mga0k408_15212_c1 | nmdc:mga0k408_15212_c1_931_1881 | 315 |
| 193 | 3300050493 | nmdc:mga0k408_1969_c1 | nmdc:mga0k408_1969_c1_334_1284 | 315 |
| 194 | 3300054114 | Ga0501084_0099090 | Ga0501084_0099090_1242_2192 | 315 |
| 195 | iso_pu_bacteria | 2513020051 | 2513227669 | 315 |
| 196 | iso_pu_bacteria | 2585428057 | 2587728347 | 315 |
| 197 | iso_pu_bacteria | 2585428058 | 2587735520 | 315 |
| 198 | iso_pu_bacteria | 2588253510 | 2588294089 | 315 |
| 199 | iso_pu_bacteria | 2599185214 | 2599625699 | 315 |
| 200 | iso_pu_bacteria | 2599185226 | 2599673712 | 315 |
| 201 | iso_pu_bacteria | 2599185227 | 2599683382 | 315 |
| 202 | iso_pu_bacteria | 2599185229 | 2599695130 | 315 |
| 203 | iso_pu_bacteria | 2643221628 | 2644162280 | 315 |
| 204 | iso_pu_bacteria | 2643221658 | 2644324430 | 315 |
| 205 | iso_pu_bacteria | 2643221672 | 2644396279 | 315 |
| 206 | iso_pu_bacteria | 2738541277 | 2738719218 | 315 |
| 207 | iso_pu_bacteria | 2738541307 | 2738880237 | 315 |
| 208 | iso_pu_bacteria | 2738543019 | 2739281980 | 315 |
| 209 | iso_pu_bacteria | 2818991446 | 2819599721 | 315 |
| 210 | iso_pu_bacteria | 2831265667 | 2831271682 | 315 |
| 211 | iso_pu_bacteria | 2838054893 | 2838055595 | 315 |
| 212 | iso_pu_bacteria | 2842677519 | 2842681198 | 315 |
| 213 | iso_pu_bacteria | 2885198086 | 2885200871 | 315 |
| 214 | iso_pu_bacteria | 2885211737 | 2885214346 | 315 |
| 215 | iso_pu_bacteria | 2899924645 | 2899927646 | 315 |
| 216 | iso_pu_bacteria | 2904449895 | 2904450650 | 315 |
| 217 | iso_pu_bacteria | 2904456579 | 2904459850 | 315 |
| 218 | iso_pu_bacteria | 2919462493 | 2919462822 | 315 |
| 219 | iso_pu_bacteria | 2928037797 | 2928042077 | 315 |
| 220 | iso_pu_bacteria | 2928044640 | 2928049641 | 315 |
| 221 | iso_pu_bacteria | 2928051484 | 2928051685 | 315 |
| 222 | iso_pu_bacteria | 2928064002 | 2928065624 | 315 |
| 223 | iso_pu_bacteria | 2928070936 | 2928073091 | 315 |
| 224 | iso_pu_bacteria | 2928084124 | 2928086875 | 315 |
| 225 | iso_pu_bacteria | 2929520902 | 2929521367 | 315 |
| 226 | iso_pu_bacteria | 2945945610 | 2945949381 | 315 |
| 227 | iso_pu_bacteria | 2945972063 | 2945973426 | 315 |
| 228 | iso_pu_bacteria | 2954767861 | 2954770967 | 315 |
| 229 | 3300003781 | Ga0055536_1009893 | Ga0055536_10098931 | 316 |
| 230 | 3300003792 | Ga0055540_1009514 | Ga0055540_10095141 | 316 |
| 231 | 3300005347 | Ga0070668_100184608 | Ga0070668_1001846083 | 316 |
| 232 | 3300005353 | Ga0070669_100118760 | Ga0070669_1001187602 | 316 |
| 233 | 3300005354 | Ga0070675_100096127 | Ga0070675_1000961272 | 316 |
| 234 | 3300005354 | Ga0070675_100205043 | Ga0070675_1002050431 | 316 |
| 235 | 3300005354 | Ga0070675_100357887 | Ga0070675_1003578872 | 316 |
| 236 | 3300005356 | Ga0070674_100073733 | Ga0070674_1000737334 | 316 |
| 237 | 3300005367 | Ga0070667_100221688 | Ga0070667_1002216881 | 316 |
| 238 | 3300005455 | Ga0070663_100150644 | Ga0070663_1001506442 | 316 |
| 239 | 3300005456 | Ga0070678_100149019 | Ga0070678_1001490192 | 316 |
| 240 | 3300005459 | Ga0068867_100051581 | Ga0068867_1000515812 | 316 |
| 241 | 3300005459 | Ga0068867_100093997 | Ga0068867_1000939973 | 316 |
| 242 | 3300005536 | Ga0070697_100000484 | Ga0070697_10000048432 | 316 |
| 243 | 3300005543 | Ga0070672_100060070 | Ga0070672_1000600702 | 316 |
| 244 | 3300005543 | Ga0070672_100152473 | Ga0070672_1001524732 | 316 |
| 245 | 3300005543 | Ga0070672_100223915 | Ga0070672_1002239152 | 316 |
| 246 | 3300005546 | Ga0070696_100024909 | Ga0070696_1000249092 | 316 |
| 247 | 3300005547 | Ga0070693_100033981 | Ga0070693_1000339813 | 316 |
| 248 | 3300005548 | Ga0070665_100471013 | Ga0070665_1004710132 | 316 |
| 249 | 3300005578 | Ga0068854_100186977 | Ga0068854_1001869772 | 316 |
| 250 | 3300005614 | Ga0068856_100261142 | Ga0068856_1002611422 | 316 |
| 251 | 3300005615 | Ga0070702_100052304 | Ga0070702_1000523043 | 316 |
| 252 | 3300005616 | Ga0068852_100065994 | Ga0068852_1000659944 | 316 |
| 253 | 3300005616 | Ga0068852_100459095 | Ga0068852_1004590951 | 316 |
| 254 | 3300005617 | Ga0068859_100012039 | Ga0068859_1000120398 | 316 |
| 255 | 3300005618 | Ga0068864_100202000 | Ga0068864_1002020002 | 316 |
| 256 | 3300005719 | Ga0068861_100210225 | Ga0068861_1002102251 | 316 |
| 257 | 3300005834 | Ga0068851_10011655 | Ga0068851_100116554 | 316 |
| 258 | 3300005844 | Ga0068862_100120064 | Ga0068862_1001200642 | 316 |
| 259 | 3300005844 | Ga0068862_100256601 | Ga0068862_1002566012 | 316 |
| 260 | 3300006844 | Ga0075428_100285350 | Ga0075428_1002853502 | 316 |
| 261 | 3300006881 | Ga0068865_100265147 | Ga0068865_1002651472 | 316 |
| 262 | 3300006931 | Ga0097620_100012039 | Ga0097620_1000120398 | 316 |
| 263 | 3300006948 | Ga0099826_10172907 | Ga0099826_101729072 | 316 |
| 264 | 3300009098 | Ga0105245_10136105 | Ga0105245_101361053 | 316 |
| 265 | 3300009101 | Ga0105247_10027085 | Ga0105247_100270852 | 316 |
| 266 | 3300009148 | Ga0105243_10006812 | Ga0105243_100068127 | 316 |
| 267 | 3300009148 | Ga0105243_10231207 | Ga0105243_102312071 | 316 |
| 268 | 3300009553 | Ga0105249_10141075 | Ga0105249_101410751 | 316 |
| 269 | 3300010375 | Ga0105239_10105623 | Ga0105239_101056232 | 316 |
| 270 | 3300010375 | Ga0105239_10115930 | Ga0105239_101159302 | 316 |
| 271 | 3300013296 | Ga0157374_10508558 | Ga0157374_105085581 | 316 |
| 272 | 3300013308 | Ga0157375_10628751 | Ga0157375_106287511 | 316 |
| 273 | 3300014968 | Ga0157379_10046800 | Ga0157379_100468003 | 316 |
| 274 | 3300017792 | Ga0163161_10127069 | Ga0163161_101270692 | 316 |
| 275 | 3300025292 | Ga0209676_1000098 | Ga0209676_1000098173 | 316 |
| 276 | 3300025303 | Ga0209051_1003104 | Ga0209051_10031042 | 316 |
| 277 | 3300025304 | Ga0209257_1012245 | Ga0209257_10122453 | 316 |
| 278 | 3300025893 | Ga0207682_10008598 | Ga0207682_100085982 | 316 |
| 279 | 3300025926 | Ga0207659_10151698 | Ga0207659_101516982 | 316 |
| 280 | 3300025927 | Ga0207687_10154543 | Ga0207687_101545432 | 316 |
| 281 | 3300025935 | Ga0207709_10001694 | Ga0207709_100016949 | 316 |
| 282 | 3300025935 | Ga0207709_10181440 | Ga0207709_101814401 | 316 |
| 283 | 3300025938 | Ga0207704_10196170 | Ga0207704_101961702 | 316 |
| 284 | 3300025940 | Ga0207691_10135769 | Ga0207691_101357692 | 316 |
| 285 | 3300025940 | Ga0207691_10181075 | Ga0207691_101810752 | 316 |
| 286 | 3300025940 | Ga0207691_10216981 | Ga0207691_102169812 | 316 |
| 287 | 3300025941 | Ga0207711_10034128 | Ga0207711_100341284 | 316 |
| 288 | 3300025942 | Ga0207689_10036877 | Ga0207689_100368773 | 316 |
| 289 | 3300025972 | Ga0207668_10177763 | Ga0207668_101777632 | 316 |
| 290 | 3300025981 | Ga0207640_10107962 | Ga0207640_101079622 | 316 |
| 291 | 3300026035 | Ga0207703_10082857 | Ga0207703_100828572 | 316 |
| 292 | 3300026078 | Ga0207702_10199014 | Ga0207702_101990142 | 316 |
| 293 | 3300026089 | Ga0207648_10308790 | Ga0207648_103087902 | 316 |
| 294 | 3300026095 | Ga0207676_10063803 | Ga0207676_100638032 | 316 |
| 295 | 3300026118 | Ga0207675_100038504 | Ga0207675_1000385041 | 316 |
| 296 | 3300026121 | Ga0207683_10217258 | Ga0207683_102172582 | 316 |
| 297 | 3300026142 | Ga0207698_10265856 | Ga0207698_102658562 | 316 |
| 298 | 3300027671 | Ga0209588_1021228 | Ga0209588_10212281 | 316 |
| 299 | 3300028380 | Ga0268265_10030448 | Ga0268265_100304482 | 316 |
| 300 | 3300028794 | Ga0307515_10000213 | Ga0307515_100002134 | 316 |
| 301 | 3300030745 | Ga0316182_1079883 | Ga0316182_10798832 | 316 |
| 302 | 3300031456 | Ga0307513_10002965 | Ga0307513_100029659 | 316 |
| 303 | 3300031548 | Ga0307408_100067059 | Ga0307408_1000670594 | 316 |
| 304 | 3300031649 | Ga0307514_10007800 | Ga0307514_100078004 | 316 |
| 305 | 3300031649 | Ga0307514_10120357 | Ga0307514_101203572 | 316 |
| 306 | 3300032002 | Ga0307416_100078067 | Ga0307416_1000780673 | 316 |
| 307 | 3300032005 | Ga0307411_10052538 | Ga0307411_100525381 | 316 |
| 308 | 3300035172 | Ga0373955_0006177 | Ga0373955_0006177_2783_3736 | 316 |
| 309 | 3300035410 | Ga0373924_0004289 | Ga0373924_0004289_527_1480 | 316 |
| 310 | 3300035691 | Ga0373931_0105765 | Ga0373931_0105765_414_1370 | 316 |
| 311 | 3300035724 | Ga0373933_0003218 | Ga0373933_0003218_5184_6137 | 316 |
| 312 | 3300036401 | Ga0373937_0036959 | Ga0373937_0036959_1404_2357 | 316 |
| 313 | 3300037312 | Ga0395899_0125367 | Ga0395899_0125367_803_1753 | 316 |
| 314 | 3300037471 | Ga0395905_0175098 | Ga0395905_0175098_835_1785 | 316 |
| 315 | 3300041486 | Ga0451807_0287218 | Ga0451807_0287218_2586_3539 | 316 |
| 316 | 3300044712 | Ga0453684_0000419 | Ga0453684_0000419_58513_59466 | 316 |
| 317 | 3300044842 | Ga0466957_0124376 | Ga0466957_0124376_129_1079 | 316 |
| 318 | 3300045051 | Ga0451576_0230948 | Ga0451576_0230948_298_1248 | 316 |
| 319 | 3300046454 | Ga0495592_0000330 | Ga0495592_0000330_30653_31606 | 316 |
| 320 | 3300046471 | Ga0495650_0020417 | Ga0495650_0020417_335_1297 | 316 |
| 321 | 3300046475 | Ga0495639_0032220 | Ga0495639_0032220_916_1869 | 316 |
| 322 | 3300046476 | Ga0495662_0007567 | Ga0495662_0007567_1440_2393 | 316 |
| 323 | 3300046511 | Ga0495608_0000582 | Ga0495608_0000582_5775_6728 | 316 |
| 324 | 3300046516 | Ga0495628_0023314 | Ga0495628_0023314_386_1339 | 316 |
| 325 | 3300046517 | Ga0495630_0003958 | Ga0495630_0003958_1273_2226 | 316 |
| 326 | 3300046526 | Ga0495666_0029460 | Ga0495666_0029460_215_1168 | 316 |
| 327 | 3300046529 | Ga0495652_0085622 | Ga0495652_0085622_1434_2387 | 316 |
| 328 | 3300046533 | Ga0495640_0000361 | Ga0495640_0000361_12019_12972 | 316 |
| 329 | 3300046535 | Ga0495586_0001795 | Ga0495586_0001795_8357_9310 | 316 |
| 330 | 3300046536 | Ga0495587_0013730 | Ga0495587_0013730_1968_2921 | 316 |
| 331 | 3300046537 | Ga0495598_0029235 | Ga0495598_0029235_37_990 | 316 |
| 332 | 3300046537 | Ga0495598_0057519 | Ga0495598_0057519_96_1052 | 316 |
| 333 | 3300046559 | Ga0495667_0001990 | Ga0495667_0001990_6634_7587 | 316 |
| 334 | 3300046559 | Ga0495667_0022413 | Ga0495667_0022413_3109_4062 | 316 |
| 335 | 3300046642 | Ga0495634_0002172 | Ga0495634_0002172_8418_9371 | 316 |
| 336 | 3300046663 | Ga0495635_0027700 | Ga0495635_0027700_46_999 | 316 |
| 337 | 3300046683 | Ga0495658_0012080 | Ga0495658_0012080_706_1659 | 316 |
| 338 | 3300046689 | Ga0495613_0003055 | Ga0495613_0003055_8765_9718 | 316 |
| 339 | 3300046690 | Ga0495624_0092319 | Ga0495624_0092319_167_1120 | 316 |
| 340 | 3300046809 | Ga0495600_0001984 | Ga0495600_0001984_4631_5584 | 316 |
| 341 | 3300047319 | Ga0495674_0091211 | Ga0495674_0091211_22_975 | 316 |
| 342 | 3300047322 | Ga0495680_0017719 | Ga0495680_0017719_2221_3174 | 316 |
| 343 | 3300048917 | Ga0496114_0205600 | Ga0496114_0205600_634_1590 | 316 |
| 344 | 3300048928 | Ga0496125_0031422 | Ga0496125_0031422_2621_3571 | 316 |
| 345 | 3300048929 | Ga0496126_0153355 | Ga0496126_0153355_782_1732 | 316 |
| 346 | 3300050493 | nmdc:mga0k408_769_c1 | nmdc:mga0k408_769_c1_5918_6877 | 316 |
| 347 | 3300053077 | Ga0495601_0016509 | Ga0495601_0016509_927_1880 | 316 |
| 348 | iso_pu_bacteria | 2885192300 | 2885194756 | 316 |
| 349 | 3300005327 | Ga0070658_10113308 | Ga0070658_101133082 | 317 |
| 350 | 3300005336 | Ga0070680_100196269 | Ga0070680_1001962693 | 317 |
| 351 | 3300005444 | Ga0070694_100044052 | Ga0070694_1000440522 | 317 |
| 352 | 3300005467 | Ga0070706_100232321 | Ga0070706_1002323212 | 317 |
| 353 | 3300005530 | Ga0070679_100328715 | Ga0070679_1003287151 | 317 |
| 354 | 3300005536 | Ga0070697_100042206 | Ga0070697_1000422062 | 317 |
| 355 | 3300005545 | Ga0070695_100002049 | Ga0070695_10000204915 | 317 |
| 356 | 3300005546 | Ga0070696_100005276 | Ga0070696_1000052766 | 317 |
| 357 | 3300005563 | Ga0068855_100055122 | Ga0068855_1000551223 | 317 |
| 358 | 3300005985 | Ga0081539_10000276 | Ga0081539_1000027612 | 317 |
| 359 | 3300006914 | Ga0075436_100072456 | Ga0075436_1000724563 | 317 |
| 360 | 3300009093 | Ga0105240_10005483 | Ga0105240_1000548312 | 317 |
| 361 | 3300009147 | Ga0114129_10085181 | Ga0114129_100851813 | 317 |
| 362 | 3300009551 | Ga0105238_10017534 | Ga0105238_100175343 | 317 |
| 363 | 3300025909 | Ga0207705_10242982 | Ga0207705_102429822 | 317 |
| 364 | 3300025910 | Ga0207684_10285567 | Ga0207684_102855672 | 317 |
| 365 | 3300025913 | Ga0207695_10029800 | Ga0207695_100298003 | 317 |
| 366 | 3300025921 | Ga0207652_10276992 | Ga0207652_102769921 | 317 |
| 367 | 3300025924 | Ga0207694_10019947 | Ga0207694_100199475 | 317 |
| 368 | 3300025939 | Ga0207665_10024609 | Ga0207665_100246092 | 317 |
| 369 | 3300025949 | Ga0207667_10060956 | Ga0207667_100609563 | 317 |
| 370 | 3300025949 | Ga0207667_10511418 | Ga0207667_105114181 | 317 |
| 371 | 3300026121 | Ga0207683_10462981 | Ga0207683_104629811 | 317 |
| 372 | 3300032002 | Ga0307416_100398009 | Ga0307416_1003980091 | 317 |
| 373 | 3300037418 | Ga0395900_0177644 | Ga0395900_0177644_685_1638 | 317 |
| 374 | 3300037471 | Ga0395905_0014616 | Ga0395905_0014616_5039_5992 | 317 |
| 375 | 3300037471 | Ga0395905_0066409 | Ga0395905_0066409_302_1255 | 317 |
| 376 | 3300037471 | Ga0395905_0102869 | Ga0395905_0102869_1500_2453 | 317 |
| 377 | 3300038443 | Ga0395901_0173613 | Ga0395901_0173613_1101_2054 | 317 |
| 378 | 3300042156 | Ga0439446_0013740 | Ga0439446_0013740_450_1406 | 317 |
| 379 | 3300044656 | Ga0466969_0006732 | Ga0466969_0006732_4591_5544 | 317 |
| 380 | 3300044693 | Ga0466961_0032923 | Ga0466961_0032923_345_1298 | 317 |
| 381 | 3300044901 | Ga0466960_0037302 | Ga0466960_0037302_1308_2261 | 317 |
| 382 | 3300048927 | Ga0496124_0000138 | Ga0496124_0000138_106585_107538 | 317 |
| 383 | 3300050514 | nmdc:mga08x19_18296_c1 | nmdc:mga08x19_18296_c1_656_1618 | 317 |
| 384 | 3300050514 | nmdc:mga08x19_26554_c1 | nmdc:mga08x19_26554_c1_835_1797 | 317 |
| 385 | 3300050515 | nmdc:mga0a205_32392_c1 | nmdc:mga0a205_32392_c1_227_1189 | 317 |
| 386 | 3300053156 | Ga0500622_0007719 | Ga0500622_0007719_2399_3358 | 317 |
| 387 | 3300005338 | Ga0068868_100496209 | Ga0068868_1004962091 | 318 |
| 388 | 3300006048 | Ga0075363_100010719 | Ga0075363_1000107195 | 318 |
| 389 | 3300006051 | Ga0075364_10014953 | Ga0075364_100149533 | 318 |
| 390 | 3300006186 | Ga0075369_10024516 | Ga0075369_100245162 | 318 |
| 391 | 3300006353 | Ga0075370_10050324 | Ga0075370_100503243 | 318 |
| 392 | 3300009174 | Ga0105241_10169035 | Ga0105241_101690352 | 318 |
| 393 | 3300025911 | Ga0207654_10105147 | Ga0207654_101051471 | 318 |
| 394 | 3300026023 | Ga0207677_10002517 | Ga0207677_100025176 | 318 |
| 395 | 3300031730 | Ga0307516_10123683 | Ga0307516_101236832 | 318 |
| 396 | 3300042007 | Ga0439449_0080520 | Ga0439449_0080520_177_1133 | 318 |
| 397 | 3300046530 | Ga0495654_0004569 | Ga0495654_0004569_5846_6802 | 318 |
| 398 | 3300050493 | nmdc:mga0k408_35418_c1 | nmdc:mga0k408_35418_c1_873_1832 | 318 |
| 399 | 3300050496 | nmdc:mga07m45_969_c1 | nmdc:mga07m45_969_c1_8566_9525 | 318 |
| 400 | 3300053130 | Ga0500642_0000990 | Ga0500642_0000990_6682_7722 | 318 |
| 401 | 3300053131 | Ga0500652_000300 | Ga0500652_000300_2214_3254 | 318 |
| 402 | 3300053156 | Ga0500622_0000094 | Ga0500622_0000094_50016_51056 | 318 |
| 403 | 3300001979 | JGI24740J21852_10019146 | JGI24740J21852_100191463 | 319 |
| 404 | 3300001989 | JGI24739J22299_10016858 | JGI24739J22299_100168582 | 319 |
| 405 | 3300002773 | JGI25152J39213_1018360 | JGI25152J39213_10183601 | 319 |
| 406 | 3300002773 | JGI25152J39213_1018389 | JGI25152J39213_10183891 | 319 |
| 407 | 3300002774 | JGI25150J39212_1003566 | JGI25150J39212_10035661 | 319 |
| 408 | 3300002774 | JGI25150J39212_1005288 | JGI25150J39212_10052884 | 319 |
| 409 | 3300002987 | JGI25159J45721_1020142 | JGI25159J45721_10201421 | 319 |
| 410 | 3300002987 | JGI25159J45721_1020978 | JGI25159J45721_10209781 | 319 |
| 411 | 3300003187 | JGI25151J46595_10047534 | JGI25151J46595_100475341 | 319 |
| 412 | 3300003187 | JGI25151J46595_10056120 | JGI25151J46595_100561201 | 319 |
| 413 | 3300003215 | JGI25153J46596_10023596 | JGI25153J46596_100235964 | 319 |
| 414 | 3300003215 | JGI25153J46596_10046124 | JGI25153J46596_100461241 | 319 |
| 415 | 3300003354 | JGI25160J50197_1033412 | JGI25160J50197_10334121 | 319 |
| 416 | 3300003374 | JGI25161J50226_1009694 | JGI25161J50226_10096942 | 319 |
| 417 | 3300003374 | JGI25161J50226_1010172 | JGI25161J50226_10101721 | 319 |
| 418 | 3300003760 | Ga0055527_1004752 | Ga0055527_10047522 | 319 |
| 419 | 3300003761 | Ga0055535_1000142 | Ga0055535_100014245 | 319 |
| 420 | 3300003762 | Ga0055542_1000022 | Ga0055542_1000022186 | 319 |
| 421 | 3300003771 | Ga0055526_1036732 | Ga0055526_10367321 | 319 |
| 422 | 3300003771 | Ga0055526_1036769 | Ga0055526_10367691 | 319 |
| 423 | 3300003773 | Ga0055537_1004361 | Ga0055537_10043615 | 319 |
| 424 | 3300003773 | Ga0055537_1015934 | Ga0055537_10159341 | 319 |
| 425 | 3300003775 | Ga0055524_1037208 | Ga0055524_10372081 | 319 |
| 426 | 3300003775 | Ga0055524_1037260 | Ga0055524_10372601 | 319 |
| 427 | 3300003781 | Ga0055536_1010815 | Ga0055536_10108151 | 319 |
| 428 | 3300003781 | Ga0055536_1033967 | Ga0055536_10339671 | 319 |
| 429 | 3300003784 | Ga0055534_1016999 | Ga0055534_10169991 | 319 |
| 430 | 3300003790 | Ga0055528_1027956 | Ga0055528_10279562 | 319 |
| 431 | 3300003790 | Ga0055528_1033313 | Ga0055528_10333131 | 319 |
| 432 | 3300003791 | Ga0055530_10000962 | Ga0055530_1000096221 | 319 |
| 433 | 3300003791 | Ga0055530_10008102 | Ga0055530_100081023 | 319 |
| 434 | 3300003792 | Ga0055540_1006373 | Ga0055540_10063734 | 319 |
| 435 | 3300003792 | Ga0055540_1008199 | Ga0055540_10081991 | 319 |
| 436 | 3300003792 | Ga0055540_1029134 | Ga0055540_10291341 | 319 |
| 437 | 3300003792 | Ga0055540_1029152 | Ga0055540_10291521 | 319 |
| 438 | 3300003794 | Ga0055531_10003806 | Ga0055531_100038069 | 319 |
| 439 | 3300003794 | Ga0055531_10042577 | Ga0055531_100425771 | 319 |
| 440 | 3300003794 | Ga0055531_10042605 | Ga0055531_100426051 | 319 |
| 441 | 3300004625 | Ga0055543_1004383 | Ga0055543_10043831 | 319 |
| 442 | 3300004625 | Ga0055543_1017930 | Ga0055543_10179301 | 319 |
| 443 | 3300005262 | Ga0065165_1042862 | Ga0065165_10428621 | 319 |
| 444 | 3300005289 | Ga0065704_10008104 | Ga0065704_100081042 | 319 |
| 445 | 3300005344 | Ga0070661_100073493 | Ga0070661_1000734932 | 319 |
| 446 | 3300005539 | Ga0068853_100170070 | Ga0068853_1001700702 | 319 |
| 447 | 3300005563 | Ga0068855_100292992 | Ga0068855_1002929922 | 319 |
| 448 | 3300005834 | Ga0068851_10027065 | Ga0068851_100270653 | 319 |
| 449 | 3300006048 | Ga0075363_100080599 | Ga0075363_1000805992 | 319 |
| 450 | 3300006051 | Ga0075364_10023105 | Ga0075364_100231053 | 319 |
| 451 | 3300006177 | Ga0075362_10019512 | Ga0075362_100195123 | 319 |
| 452 | 3300006195 | Ga0075366_10007213 | Ga0075366_100072132 | 319 |
| 453 | 3300006353 | Ga0075370_10019036 | Ga0075370_100190361 | 319 |
| 454 | 3300006946 | Ga0079104_1033298 | Ga0079104_10332981 | 319 |
| 455 | 3300009036 | Ga0105244_10004004 | Ga0105244_100040044 | 319 |
| 456 | 3300009093 | Ga0105240_10117301 | Ga0105240_101173013 | 319 |
| 457 | 3300009148 | Ga0105243_10208970 | Ga0105243_102089702 | 319 |
| 458 | 3300009545 | Ga0105237_10034309 | Ga0105237_100343094 | 319 |
| 459 | 3300009545 | Ga0105237_10352706 | Ga0105237_103527062 | 319 |
| 460 | 3300010375 | Ga0105239_10285640 | Ga0105239_102856402 | 319 |
| 461 | 3300011119 | Ga0105246_10020815 | Ga0105246_100208153 | 319 |
| 462 | 3300011119 | Ga0105246_10036655 | Ga0105246_100366552 | 319 |
| 463 | 3300013100 | Ga0157373_10044073 | Ga0157373_100440732 | 319 |
| 464 | 3300013104 | Ga0157370_10043977 | Ga0157370_100439773 | 319 |
| 465 | 3300013105 | Ga0157369_10011577 | Ga0157369_1001157710 | 319 |
| 466 | 3300013297 | Ga0157378_10304683 | Ga0157378_103046832 | 319 |
| 467 | 3300013308 | Ga0157375_10673053 | Ga0157375_106730531 | 319 |
| 468 | 3300014497 | Ga0182008_10016794 | Ga0182008_100167943 | 319 |
| 469 | 3300014497 | Ga0182008_10060321 | Ga0182008_100603212 | 319 |
| 470 | 3300015261 | Ga0182006_1012034 | Ga0182006_10120343 | 319 |
| 471 | 3300015262 | Ga0182007_10002886 | Ga0182007_100028868 | 319 |
| 472 | 3300017792 | Ga0163161_10008638 | Ga0163161_100086382 | 319 |
| 473 | 3300025228 | Ga0209672_100689 | Ga0209672_1006895 | 319 |
| 474 | 3300025229 | Ga0209147_100794 | Ga0209147_1007946 | 319 |
| 475 | 3300025242 | Ga0209258_100009 | Ga0209258_100009849 | 319 |
| 476 | 3300025245 | Ga0207425_1002257 | Ga0207425_10022572 | 319 |
| 477 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007849 | 319 |
| 478 | 3300025258 | Ga0209129_1000024 | Ga0209129_1000024222 | 319 |
| 479 | 3300025258 | Ga0209129_1000085 | Ga0209129_10000852 | 319 |
| 480 | 3300025263 | Ga0209565_1001386 | Ga0209565_10013865 | 319 |
| 481 | 3300025273 | Ga0209673_1000615 | Ga0209673_100061550 | 319 |
| 482 | 3300025273 | Ga0209673_1002626 | Ga0209673_100262610 | 319 |
| 483 | 3300025273 | Ga0209673_1006510 | Ga0209673_10065105 | 319 |
| 484 | 3300025284 | Ga0209130_1001597 | Ga0209130_10015975 | 319 |
| 485 | 3300025284 | Ga0209130_1002030 | Ga0209130_10020303 | 319 |
| 486 | 3300025291 | Ga0209675_1002464 | Ga0209675_10024642 | 319 |
| 487 | 3300025292 | Ga0209676_1000028 | Ga0209676_1000028117 | 319 |
| 488 | 3300025292 | Ga0209676_1000194 | Ga0209676_100019416 | 319 |
| 489 | 3300025292 | Ga0209676_1003187 | Ga0209676_100318710 | 319 |
| 490 | 3300025294 | Ga0209025_1017372 | Ga0209025_10173723 | 319 |
| 491 | 3300025294 | Ga0209025_1033643 | Ga0209025_10336433 | 319 |
| 492 | 3300025294 | Ga0209025_1052688 | Ga0209025_10526882 | 319 |
| 493 | 3300025295 | Ga0209564_1000183 | Ga0209564_1000183116 | 319 |
| 494 | 3300025295 | Ga0209564_1000198 | Ga0209564_1000198106 | 319 |
| 495 | 3300025297 | Ga0209758_1000049 | Ga0209758_1000049141 | 319 |
| 496 | 3300025297 | Ga0209758_1005124 | Ga0209758_10051244 | 319 |
| 497 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002126 | 319 |
| 498 | 3300025298 | Ga0209050_1000122 | Ga0209050_1000122114 | 319 |
| 499 | 3300025298 | Ga0209050_1003795 | Ga0209050_10037953 | 319 |
| 500 | 3300025299 | Ga0209256_1000098 | Ga0209256_1000098181 | 319 |
| 501 | 3300025299 | Ga0209256_1000140 | Ga0209256_1000140116 | 319 |
| 502 | 3300025302 | Ga0207426_1000038 | Ga0207426_1000038181 | 319 |
| 503 | 3300025302 | Ga0207426_1000053 | Ga0207426_1000053177 | 319 |
| 504 | 3300025303 | Ga0209051_1000015 | Ga0209051_100001546 | 319 |
| 505 | 3300025303 | Ga0209051_1000159 | Ga0209051_10001592 | 319 |
| 506 | 3300025303 | Ga0209051_1000168 | Ga0209051_1000168119 | 319 |
| 507 | 3300025303 | Ga0209051_1000179 | Ga0209051_10001791 | 319 |
| 508 | 3300025303 | Ga0209051_1003161 | Ga0209051_100316111 | 319 |
| 509 | 3300025304 | Ga0209257_1000002 | Ga0209257_100000235 | 319 |
| 510 | 3300025304 | Ga0209257_1004330 | Ga0209257_100433011 | 319 |
| 511 | 3300025321 | Ga0207656_10008267 | Ga0207656_100082673 | 319 |
| 512 | 3300025728 | Ga0207655_1003001 | Ga0207655_100300112 | 319 |
| 513 | 3300025914 | Ga0207671_10040139 | Ga0207671_100401393 | 319 |
| 514 | 3300025914 | Ga0207671_10144983 | Ga0207671_101449832 | 319 |
| 515 | 3300025924 | Ga0207694_10054411 | Ga0207694_100544113 | 319 |
| 516 | 3300025933 | Ga0207706_10013193 | Ga0207706_100131937 | 319 |
| 517 | 3300025935 | Ga0207709_10002682 | Ga0207709_100026821 | 319 |
| 518 | 3300025940 | Ga0207691_10033715 | Ga0207691_100337155 | 319 |
| 519 | 3300025945 | Ga0207679_10004143 | Ga0207679_100041434 | 319 |
| 520 | 3300025945 | Ga0207679_10041704 | Ga0207679_100417044 | 319 |
| 521 | 3300025949 | Ga0207667_10226574 | Ga0207667_102265743 | 319 |
| 522 | 3300026121 | Ga0207683_10063312 | Ga0207683_100633122 | 319 |
| 523 | 3300026142 | Ga0207698_10371672 | Ga0207698_103716721 | 319 |
| 524 | 3300027907 | Ga0207428_10102069 | Ga0207428_101020692 | 319 |
| 525 | 3300028794 | Ga0307515_10000188 | Ga0307515_1000018851 | 319 |
| 526 | 3300030731 | Ga0316177_1169476 | Ga0316177_11694763 | 319 |
| 527 | 3300030732 | Ga0316176_1023454 | Ga0316176_10234544 | 319 |
| 528 | 3300030733 | Ga0314311_1040207 | Ga0314311_10402075 | 319 |
| 529 | 3300030734 | Ga0316179_1015655 | Ga0316179_10156554 | 319 |
| 530 | 3300030736 | Ga0316180_1121156 | Ga0316180_11211562 | 319 |
| 531 | 3300030742 | Ga0316183_1091139 | Ga0316183_10911396 | 319 |
| 532 | 3300030744 | Ga0316181_1025223 | Ga0316181_10252231 | 319 |
| 533 | 3300031456 | Ga0307513_10255435 | Ga0307513_102554352 | 319 |
| 534 | 3300031548 | Ga0307408_100078955 | Ga0307408_1000789553 | 319 |
| 535 | 3300031548 | Ga0307408_100117457 | Ga0307408_1001174572 | 319 |
| 536 | 3300031649 | Ga0307514_10063252 | Ga0307514_100632522 | 319 |
| 537 | 3300031824 | Ga0307413_10104799 | Ga0307413_101047992 | 319 |
| 538 | 3300031901 | Ga0307406_10022724 | Ga0307406_100227243 | 319 |
| 539 | 3300031911 | Ga0307412_10103455 | Ga0307412_101034551 | 319 |
| 540 | 3300032002 | Ga0307416_100040223 | Ga0307416_1000402233 | 319 |
| 541 | 3300032002 | Ga0307416_100078731 | Ga0307416_1000787313 | 319 |
| 542 | 3300041404 | Ga0439436_0000635 | Ga0439436_0000635_2440_3402 | 319 |
| 543 | 3300041404 | Ga0439436_0008849 | Ga0439436_0008849_1861_2820 | 319 |
| 544 | 3300041406 | Ga0439439_0000329 | Ga0439439_0000329_77_1039 | 319 |
| 545 | 3300041411 | Ga0439466_0004216 | Ga0439466_0004216_2557_3519 | 319 |
| 546 | 3300041411 | Ga0439466_0034072 | Ga0439466_0034072_401_1363 | 319 |
| 547 | 3300041413 | Ga0439465_0000176 | Ga0439465_0000176_14137_15099 | 319 |
| 548 | 3300041997 | Ga0439431_0002901 | Ga0439431_0002901_2666_3628 | 319 |
| 549 | 3300042002 | Ga0439442_023339 | Ga0439442_023339_283_1242 | 319 |
| 550 | 3300042006 | Ga0439432_011896 | Ga0439432_011896_290_1252 | 319 |
| 551 | 3300042007 | Ga0439449_0000632 | Ga0439449_0000632_8876_9838 | 319 |
| 552 | 3300042007 | Ga0439449_0001266 | Ga0439449_0001266_875_1837 | 319 |
| 553 | 3300042007 | Ga0439449_0012954 | Ga0439449_0012954_259_1221 | 319 |
| 554 | 3300042010 | Ga0439452_007456 | Ga0439452_007456_1299_2261 | 319 |
| 555 | 3300042015 | Ga0439462_0002245 | Ga0439462_0002245_3024_3986 | 319 |
| 556 | 3300042125 | Ga0450923_010055 | Ga0450923_010055_564_1523 | 319 |
| 557 | 3300042131 | Ga0450894_005010 | Ga0450894_005010_201_1163 | 319 |
| 558 | 3300042133 | Ga0450896_003216 | Ga0450896_003216_582_1541 | 319 |
| 559 | 3300042145 | Ga0450906_006009 | Ga0450906_006009_1366_2328 | 319 |
| 560 | 3300042147 | Ga0450910_005952 | Ga0450910_005952_665_1624 | 319 |
| 561 | 3300042147 | Ga0450910_006634 | Ga0450910_006634_416_1378 | 319 |
| 562 | 3300042156 | Ga0439446_0007798 | Ga0439446_0007798_1582_2544 | 319 |
| 563 | 3300042184 | Ga0450908_001714 | Ga0450908_001714_2241_3200 | 319 |
| 564 | 3300042184 | Ga0450908_013820 | Ga0450908_013820_155_1117 | 319 |
| 565 | 3300042435 | Ga0439434_0003310 | Ga0439434_0003310_3366_4325 | 319 |
| 566 | 3300042435 | Ga0439434_0034341 | Ga0439434_0034341_278_1240 | 319 |
| 567 | 3300042531 | Ga0450918_002415 | Ga0450918_002415_1831_2790 | 319 |
| 568 | 3300046453 | Ga0495627_006476 | Ga0495627_006476_1520_2479 | 319 |
| 569 | 3300046515 | Ga0495620_0015787 | Ga0495620_0015787_2320_3279 | 319 |
| 570 | 3300046520 | Ga0495637_0003930 | Ga0495637_0003930_4163_5122 | 319 |
| 571 | 3300046525 | Ga0495663_0026887 | Ga0495663_0026887_378_1337 | 319 |
| 572 | 3300046539 | Ga0495621_0086755 | Ga0495621_0086755_139_1098 | 319 |
| 573 | 3300046615 | Ga0495656_0000087 | Ga0495656_0000087_18365_19324 | 319 |
| 574 | 3300046660 | Ga0495625_0033336 | Ga0495625_0033336_2584_3543 | 319 |
| 575 | 3300046660 | Ga0495625_0137941 | Ga0495625_0137941_301_1260 | 319 |
| 576 | 3300046683 | Ga0495658_0002569 | Ga0495658_0002569_2585_3544 | 319 |
| 577 | 3300046691 | Ga0495670_0075575 | Ga0495670_0075575_253_1212 | 319 |
| 578 | 3300047673 | Ga0495593_0010510 | Ga0495593_0010510_617_1576 | 319 |
| 579 | 3300048089 | Ga0495614_0003596 | Ga0495614_0003596_4488_5447 | 319 |
| 580 | 3300048904 | Ga0496101_0005305 | Ga0496101_0005305_4900_5859 | 319 |
| 581 | 3300048919 | Ga0496116_0026980 | Ga0496116_0026980_1323_2282 | 319 |
| 582 | 3300048919 | Ga0496116_0075080 | Ga0496116_0075080_787_1746 | 319 |
| 583 | 3300048920 | Ga0496117_0009871 | Ga0496117_0009871_7456_8415 | 319 |
| 584 | 3300048920 | Ga0496117_0024214 | Ga0496117_0024214_1534_2493 | 319 |
| 585 | 3300048921 | Ga0496118_0029354 | Ga0496118_0029354_2034_2993 | 319 |
| 586 | 3300048924 | Ga0496121_0179289 | Ga0496121_0179289_270_1229 | 319 |
| 587 | 3300048925 | Ga0496122_0179834 | Ga0496122_0179834_229_1188 | 319 |
| 588 | 3300048927 | Ga0496124_0062120 | Ga0496124_0062120_1721_2680 | 319 |
| 589 | 3300048927 | Ga0496124_0200832 | Ga0496124_0200832_538_1497 | 319 |
| 590 | 3300048928 | Ga0496125_0050031 | Ga0496125_0050031_2273_3232 | 319 |
| 591 | 3300049705 | Ga0501225_0001352 | Ga0501225_0001352_1543_2502 | 319 |
| 592 | 3300050490 | nmdc:mga03n38_45006_c1 | nmdc:mga03n38_45006_c1_727_1686 | 319 |
| 593 | 3300050491 | nmdc:mga00v17_15488_c1 | nmdc:mga00v17_15488_c1_1169_2128 | 319 |
| 594 | 3300050494 | nmdc:mga06z11_22994_c1 | nmdc:mga06z11_22994_c1_903_1862 | 319 |
| 595 | 3300050496 | nmdc:mga07m45_104352_c1 | nmdc:mga07m45_104352_c1_136_1095 | 319 |
| 596 | 3300053079 | Ga0500610_0014027 | Ga0500610_0014027_2174_3133 | 319 |
| 597 | 3300053087 | Ga0500643_009686 | Ga0500643_009686_345_1304 | 319 |
| 598 | 3300053093 | Ga0500651_0000125 | Ga0500651_0000125_22684_23643 | 319 |
| 599 | 3300053110 | Ga0500571_006911 | Ga0500571_006911_2813_3772 | 319 |
| 600 | 3300053121 | Ga0500607_015269 | Ga0500607_015269_2179_3138 | 319 |
| 601 | 3300053133 | Ga0500655_002364 | Ga0500655_002364_878_1837 | 319 |
| 602 | 3300053134 | Ga0500658_0002237 | Ga0500658_0002237_2096_3055 | 319 |
| 603 | 3300053141 | Ga0500574_000720 | Ga0500574_000720_701_1660 | 319 |
| 604 | 3300053158 | Ga0500627_0054268 | Ga0500627_0054268_611_1570 | 319 |
| 605 | 3300053177 | Ga0500636_0041368 | Ga0500636_0041368_693_1652 | 319 |
| 606 | iso_pu_bacteria | 2945909444 | 2945913817 | 319 |
| 607 | iso_pu_bacteria | 2945984333 | 2945990784 | 319 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ccr-assembly2.cif.gz_D | crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor | 0.8988 | 5 | 314 |
| 5utx-assembly1.cif.gz_B | crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form | 0.893 | 5 | 314 |
| 4ccr-assembly2.cif.gz_D | crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor | 0.8807 | 5 | 314 |
| 5utx-assembly1.cif.gz_B | crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form | 0.8781 | 5 | 314 |
| 4mo2-assembly1.cif.gz_B-2 | crystal structure of udp-n-acetylgalactopyranose mutase from campylobacter jejuni | 0.8683 | 7 | 35 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5u63A02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9871 | 118 | 244 | 3.50.50.60 |
| 5u63A02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9795 | 118 | 244 | 3.50.50.60 |
| 3f8rD02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9662 | 118 | 244 | 3.50.50.60 |
| 4ykgA03 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.96 | 118 | 244 | 3.50.50.60 |
| 2q0kA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9584 | 118 | 244 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6GBR0-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9384 | 1 | 135 |
GO:0016491
|
| AF-A0A353D0T2-F1-model_v4 | Thioredoxin-disulfide reductase | 0.936 | 1 | 114 |
GO:0016491
|
| AF-A0A4Q6GBR0-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9318 | 1 | 135 |
GO:0016491
|
| AF-A0A520GV49-F1-model_v4 | Thioredoxin-disulfide reductase | 0.931 | 1 | 108 |
GO:0016491
|
| AF-A0A353D0T2-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9282 | 1 | 114 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar