F468755

General Info

Members Datasets Scaffolds Average Seq Length
607 402 564 317

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2945984333|2945990784
Length 381
Sequence DIYQSLRQRAELVQKASQWITTIARIENTVHPVLNRAVILHIYRYHPENVHADAAYILGFPSMSAPQHAKVLILGSGPAGYTAAVYAARANLQPLLITGIAQGGQLMTTTEVDNWPADVHGVQGPELMQRFLEHAERFKTQIVFDHINKVDLSKRPFTLTGDSGTYTCDSLIIATGASAKYLGLDSEEKFMGRGVSACATCDGFFYREQEVCVIGGGNTAVEEALYLANIANKVTLVHRRDKFRAEPILIDKVKEKVAEGKIVLKLHNELDEVLGDGTGVTGIRIKNTQTGETEQIDLKGCFIAIGHHPNTDIFQGQLEMKDNYILTRSGLQGFATMTSIPGVFAAGDVQDNVYRQAITSAGTGCMAALDAQRFLEQDGTL

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221556 Massilia sp. Root1485 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
13 2643221658 Variovorax sp. Root411 Isolate Unclassified
14 2643221672 Variovorax sp. Root434 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2643221684 Massilia sp. Root133 Isolate Unclassified
17 2738541277 Variovorax sp. GV051 Isolate Unclassified
18 2738541307 Variovorax sp. GV008 Isolate Unclassified
19 2738543019 Variovorax sp. GV040 Isolate Unclassified
20 2818991446 Variovorax sp. 1180 Isolate Unclassified
21 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
22 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
23 2842677519 Variovorax sp. R-72495 Isolate Unclassified
24 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
25 2885198086 Variovorax sp. 679 Isolate Unclassified
26 2885211737 Variovorax sp. 553 Isolate Unclassified
27 2899924645 Variovorax sp. 369 Isolate Unclassified
28 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
29 2904456579 Variovorax sp. 2002 Isolate Unclassified
30 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
31 2928037797 Variovorax sp. 1126 Isolate Unclassified
32 2928044640 Variovorax sp. 1128 Isolate Unclassified
33 2928051484 Variovorax sp. 1133 Isolate Unclassified
34 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
35 2928070936 Variovorax gossypii 1167 Isolate Unclassified
36 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
37 2929520902 Variovorax beijingensis 502 Isolate Unclassified
38 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
39 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
40 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
41 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
42 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
46 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
47 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
48 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
52 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
53 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
54 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
55 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
58 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
63 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
68 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
69 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
70 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
75 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
80 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
94 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
104 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
123 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
222 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
223 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
224 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
225 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
226 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
227 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
228 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
229 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
242 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
243 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
256 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
257 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
258 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
259 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
262 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
263 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
267 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
268 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
269 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
270 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
271 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
272 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
273 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
276 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
277 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
280 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
311 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
368 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
379 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
386 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
387 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
388 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
389 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
390 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
391 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
392 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
393 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
394 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
395 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
396 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
397 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
398 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
399 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
400 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.59
Metatranscriptomes 0.33
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.7
Nodule 0.49
Rhizoplane 2.14
Rhizosphere 61.61
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019146 3300001979 Bacteria 2416
2 JGI24739J22299_10016858 3300001989 Bacteria 2641
3 JGI25152J39213_1018360 3300002773 Bacteria 1294
4 JGI25152J39213_1018389 3300002773 Bacteria 1293
5 JGI25150J39212_1003566 3300002774 Bacteria 3627
6 JGI25150J39212_1005288 3300002774 Bacteria 2771
7 JGI25159J45721_1020142 3300002987 Bacteria 1294
8 JGI25159J45721_1020978 3300002987 Bacteria 1244
9 Ga0006778J45830_1008092 3300003162 Bacteria 1755
10 JGI25151J46595_10047534 3300003187 Bacteria 1492
11 JGI25151J46595_10056120 3300003187 Bacteria 1294
12 JGI25153J46596_10002591 3300003215 Bacteria 10364
13 JGI25153J46596_10023596 3300003215 Bacteria 2238
14 JGI25153J46596_10046124 3300003215 Bacteria 1294
15 Ga0006777J48905_1006622 3300003308 Bacteria 1620
16 JGI25160J50197_1033412 3300003354 Bacteria 1294
17 JGI25161J50226_1009694 3300003374 Bacteria 1347
18 JGI25161J50226_1010172 3300003374 Bacteria 1277
19 Ga0055539_1001372 3300003752 Bacteria 4627
20 Ga0055533_1001365 3300003756 Bacteria 6534
21 Ga0055525_1000023 3300003759 Bacteria 359920
22 Ga0055525_1000211 3300003759 Bacteria 65308
23 Ga0055527_1000257 3300003760 Bacteria 32518
24 Ga0055527_1000263 3300003760 Bacteria 31815
25 Ga0055527_1004752 3300003760 Bacteria 1832
26 Ga0055535_1000142 3300003761 Bacteria 75104
27 Ga0055535_1000541 3300003761 Bacteria 32518
28 Ga0055535_1000731 3300003761 Bacteria 24696
29 Ga0055542_1000022 3300003762 Bacteria 302315
30 Ga0055542_1000567 3300003762 Bacteria 32518
31 Ga0055542_1000578 3300003762 Bacteria 31815
32 Ga0055529_1000538 3300003763 Bacteria 32518
33 Ga0055529_1000850 3300003763 Bacteria 17724
34 Ga0055526_1036732 3300003771 Bacteria 1294
35 Ga0055526_1036769 3300003771 Bacteria 1293
36 Ga0055537_1004361 3300003773 Bacteria 4060
37 Ga0055537_1015934 3300003773 Bacteria 1294
38 Ga0055524_1037208 3300003775 Bacteria 1294
39 Ga0055524_1037260 3300003775 Bacteria 1293
40 Ga0055536_1009893 3300003781 Bacteria 3872
41 Ga0055536_1010815 3300003781 Bacteria 3572
42 Ga0055536_1033967 3300003781 Bacteria 1295
43 Ga0055534_1016999 3300003784 Bacteria 1294
44 Ga0055528_1027956 3300003790 Bacteria 1568
45 Ga0055528_1033313 3300003790 Bacteria 1294
46 Ga0055530_10000962 3300003791 Bacteria 23389
47 Ga0055530_10008102 3300003791 Bacteria 4276
48 Ga0055540_1006373 3300003792 Bacteria 4698
49 Ga0055540_1008199 3300003792 Bacteria 3800
50 Ga0055540_1009514 3300003792 Bacteria 3348
51 Ga0055540_1029134 3300003792 Bacteria 1296
52 Ga0055540_1029152 3300003792 Bacteria 1295
53 Ga0055531_10003806 3300003794 Bacteria 9468
54 Ga0055531_10042577 3300003794 Bacteria 1296
55 Ga0055531_10042605 3300003794 Bacteria 1295
56 Ga0055543_1004383 3300004625 Bacteria 3866
57 Ga0055543_1017930 3300004625 Bacteria 1325
58 Ga0065165_1042862 3300005262 Bacteria 1332
59 Ga0065704_10008104 3300005289 Bacteria 2354
60 Ga0070658_10113308 3300005327 Bacteria 2248
61 Ga0070676_10001955 3300005328 Bacteria 10482
62 Ga0070670_100056138 3300005331 Bacteria 3379
63 Ga0070680_100196269 3300005336 Bacteria 1702
64 Ga0068868_100234608 3300005338 Bacteria 1540
65 Ga0068868_100496209 3300005338 Bacteria 1068
66 Ga0070660_100096218 3300005339 Bacteria 2341
67 Ga0070661_100073493 3300005344 Bacteria 2517
68 Ga0070668_100184608 3300005347 Bacteria 1705
69 Ga0070669_100118760 3300005353 Bacteria 2014
70 Ga0070675_100040843 3300005354 Bacteria 3789
71 Ga0070675_100096127 3300005354 Bacteria 2488
72 Ga0070675_100205043 3300005354 Bacteria 1712
73 Ga0070675_100357887 3300005354 Bacteria 1295
74 Ga0070675_100373559 3300005354 Bacteria 1268
75 Ga0070671_100150526 3300005355 Bacteria 1965
76 Ga0070674_100073733 3300005356 Bacteria 2420
77 Ga0070667_100039880 3300005367 Bacteria 3937
78 Ga0070667_100221688 3300005367 Bacteria 1683
79 Ga0070694_100044052 3300005444 Bacteria 2986
80 Ga0070663_100149220 3300005455 Bacteria 1791
81 Ga0070663_100150644 3300005455 Bacteria 1783
82 Ga0070678_100149019 3300005456 Bacteria 1882
83 Ga0070662_100216278 3300005457 Bacteria 1527
84 Ga0070681_10000172 3300005458 Bacteria 49288
85 Ga0068867_100003928 3300005459 Bacteria 10466
86 Ga0068867_100051581 3300005459 Bacteria 3034
87 Ga0068867_100093997 3300005459 Bacteria 2279
88 Ga0070706_100232321 3300005467 Bacteria 1722
89 Ga0070679_100328715 3300005530 Bacteria 1477
90 Ga0070697_100000484 3300005536 Bacteria 30233
91 Ga0070697_100042206 3300005536 Bacteria 3691
92 Ga0068853_100170070 3300005539 Bacteria 1971
93 Ga0070672_100060070 3300005543 Bacteria 2993
94 Ga0070672_100152473 3300005543 Bacteria 1912
95 Ga0070672_100223915 3300005543 Bacteria 1578
96 Ga0070695_100002049 3300005545 Bacteria 11523
97 Ga0070696_100005276 3300005546 Bacteria 8626
98 Ga0070696_100024909 3300005546 Bacteria 4066
99 Ga0070693_100033981 3300005547 Bacteria 2818
100 Ga0070665_100471013 3300005548 Bacteria 1266
101 Ga0068855_100055122 3300005563 Bacteria 4670
102 Ga0068855_100292992 3300005563 Bacteria 1804
103 Ga0068855_100507589 3300005563 Bacteria 1310
104 Ga0068854_100186977 3300005578 Bacteria 1621
105 Ga0068856_100003150 3300005614 Bacteria 16818
106 Ga0068856_100261142 3300005614 Bacteria 1747
107 Ga0070702_100052304 3300005615 Bacteria 2342
108 Ga0068852_100065994 3300005616 Bacteria 3159
109 Ga0068852_100459095 3300005616 Bacteria 1262
110 Ga0068859_100012039 3300005617 Bacteria 8689
111 Ga0068864_100202000 3300005618 Bacteria 1826
112 Ga0068861_100210225 3300005719 Bacteria 1638
113 Ga0068851_10011655 3300005834 Bacteria 4126
114 Ga0068851_10027065 3300005834 Bacteria 2823
115 Ga0068862_100120064 3300005844 Bacteria 2316
116 Ga0068862_100256601 3300005844 Bacteria 1595
117 Ga0081539_10000276 3300005985 Bacteria 117151
118 Ga0075363_100010719 3300006048 Bacteria 4366
119 Ga0075363_100080599 3300006048 Bacteria 1780
120 Ga0075364_10014953 3300006051 Bacteria 4803
121 Ga0075364_10023105 3300006051 Bacteria 3934
122 Ga0075362_10019512 3300006177 Bacteria 2821
123 Ga0075369_10024516 3300006186 Bacteria 2500
124 Ga0075366_10007213 3300006195 Bacteria 6127
125 Ga0075366_10017732 3300006195 Bacteria 4103
126 Ga0075366_10157533 3300006195 Bacteria 1376
127 Ga0075370_10019036 3300006353 Bacteria 3731
128 Ga0075370_10050324 3300006353 Bacteria 2363
129 Ga0075370_10163990 3300006353 Bacteria 1305
130 Ga0075370_10185073 3300006353 Bacteria 1226
131 Ga0075428_100285350 3300006844 Bacteria 1776
132 Ga0068865_100265147 3300006881 Bacteria 1361
133 Ga0075436_100072456 3300006914 Bacteria 2384
134 Ga0075436_100156505 3300006914 Bacteria 1605
135 Ga0097620_100012039 3300006931 Bacteria 8689
136 Ga0079104_1033298 3300006946 Bacteria 1262
137 Ga0099826_10172907 3300006948 Bacteria 1210
138 Ga0075435_100133477 3300007076 Bacteria 2078
139 Ga0105244_10004004 3300009036 Bacteria 10303
140 Ga0105240_10005483 3300009093 Bacteria 18913
141 Ga0105240_10117301 3300009093 Bacteria 3210
142 Ga0105245_10136105 3300009098 Bacteria 2309
143 Ga0105247_10027085 3300009101 Bacteria 3466
144 Ga0114129_10085181 3300009147 Bacteria 4385
145 Ga0114129_10534478 3300009147 Bacteria 1527
146 Ga0105243_10006812 3300009148 Bacteria 8809
147 Ga0105243_10208970 3300009148 Bacteria 1717
148 Ga0105243_10231207 3300009148 Bacteria 1640
149 Ga0105241_10169035 3300009174 Bacteria 1804
150 Ga0105242_10056360 3300009176 Bacteria 3216
151 Ga0105242_10309203 3300009176 Bacteria 1445
152 Ga0105248_10357074 3300009177 Bacteria 1645
153 Ga0105237_10034309 3300009545 Bacteria 5139
154 Ga0105237_10352706 3300009545 Bacteria 1476
155 Ga0105238_10017534 3300009551 Bacteria 7280
156 Ga0105249_10141075 3300009553 Bacteria 2311
157 Ga0105239_10105623 3300010375 Bacteria 3119
158 Ga0105239_10115930 3300010375 Bacteria 2972
159 Ga0105239_10285640 3300010375 Bacteria 1858
160 Ga0105246_10020815 3300011119 Bacteria 4212
161 Ga0105246_10036655 3300011119 Bacteria 3287
162 Ga0157373_10044073 3300013100 Bacteria 3185
163 Ga0157370_10043977 3300013104 Bacteria 4296
164 Ga0157369_10011577 3300013105 Bacteria 10013
165 Ga0157374_10508558 3300013296 Bacteria 1210
166 Ga0157378_10042027 3300013297 Bacteria 4056
167 Ga0157378_10304683 3300013297 Bacteria 1543
168 Ga0163162_10355996 3300013306 Bacteria 1597
169 Ga0163162_10742372 3300013306 Bacteria 1101
170 Ga0157372_10547459 3300013307 Bacteria 1349
171 Ga0157375_10628751 3300013308 Bacteria 1231
172 Ga0157375_10673053 3300013308 Bacteria 1190
173 Ga0182008_10016794 3300014497 Bacteria 3797
174 Ga0182008_10060321 3300014497 Bacteria 1870
175 Ga0157379_10010131 3300014968 Bacteria 8217
176 Ga0157379_10046800 3300014968 Bacteria 3860
177 Ga0182006_1012034 3300015261 Bacteria 3789
178 Ga0182007_10002886 3300015262 Bacteria 8357
179 Ga0163161_10008638 3300017792 Bacteria 7044
180 Ga0163161_10127069 3300017792 Bacteria 1921
181 Ga0209674_100108 3300025226 Bacteria 150893
182 Ga0209674_101427 3300025226 Bacteria 6364
183 Ga0209672_100007 3300025228 Bacteria 959482
184 Ga0209672_100009 3300025228 Bacteria 883623
185 Ga0209672_100689 3300025228 Bacteria 16922
186 Ga0209147_100794 3300025229 Bacteria 15311
187 Ga0209563_100011 3300025230 Bacteria 1187808
188 Ga0209563_100079 3300025230 Bacteria 203017
189 Ga0209258_100009 3300025242 Bacteria 996276
190 Ga0209258_100011 3300025242 Bacteria 867542
191 Ga0209258_100046 3300025242 Bacteria 369794
192 Ga0207425_1002257 3300025245 Bacteria 6971
193 Ga0209677_103790 3300025253 Bacteria 4694
194 Ga0209148_1000007 3300025254 Bacteria 1592273
195 Ga0209148_1000013 3300025254 Bacteria 956684
196 Ga0209148_1000084 3300025254 Bacteria 268147
197 Ga0209148_1000199 3300025254 Bacteria 108936
198 Ga0209129_1000024 3300025258 Bacteria 417268
199 Ga0209129_1000085 3300025258 Bacteria 181765
200 Ga0209565_1001386 3300025263 Bacteria 10846
201 Ga0209455_1000010 3300025272 Bacteria 959482
202 Ga0209455_1000012 3300025272 Bacteria 867234
203 Ga0209673_1000615 3300025273 Bacteria 54497
204 Ga0209673_1002626 3300025273 Bacteria 12066
205 Ga0209673_1006510 3300025273 Bacteria 5620
206 Ga0209673_1012617 3300025273 Bacteria 3394
207 Ga0209130_1001597 3300025284 Bacteria 14166
208 Ga0209130_1002030 3300025284 Bacteria 11020
209 Ga0209675_1002464 3300025291 Bacteria 9498
210 Ga0209676_1000028 3300025292 Bacteria 559745
211 Ga0209676_1000098 3300025292 Bacteria 234305
212 Ga0209676_1000194 3300025292 Bacteria 136666
213 Ga0209676_1003187 3300025292 Bacteria 10411
214 Ga0209025_1017372 3300025294 Bacteria 4159
215 Ga0209025_1033643 3300025294 Bacteria 2363
216 Ga0209025_1052688 3300025294 Bacteria 1604
217 Ga0209564_1000183 3300025295 Bacteria 150409
218 Ga0209564_1000198 3300025295 Bacteria 138511
219 Ga0209758_1000049 3300025297 Bacteria 345104
220 Ga0209758_1000204 3300025297 Bacteria 131754
221 Ga0209758_1005124 3300025297 Bacteria 10354
222 Ga0209050_1000002 3300025298 Bacteria 1792849
223 Ga0209050_1000122 3300025298 Bacteria 195305
224 Ga0209050_1001124 3300025298 Bacteria 32325
225 Ga0209050_1003795 3300025298 Bacteria 10793
226 Ga0209256_1000098 3300025299 Bacteria 204152
227 Ga0209256_1000140 3300025299 Bacteria 152770
228 Ga0207426_1000038 3300025302 Bacteria 441522
229 Ga0207426_1000053 3300025302 Bacteria 384818
230 Ga0209051_1000015 3300025303 Bacteria 546798
231 Ga0209051_1000159 3300025303 Bacteria 126836
232 Ga0209051_1000168 3300025303 Bacteria 119312
233 Ga0209051_1000179 3300025303 Bacteria 114055
234 Ga0209051_1003104 3300025303 Bacteria 11203
235 Ga0209051_1003161 3300025303 Bacteria 11046
236 Ga0209257_1000002 3300025304 Bacteria 1767052
237 Ga0209257_1004330 3300025304 Bacteria 11115
238 Ga0209257_1012245 3300025304 Bacteria 3993
239 Ga0207656_10008267 3300025321 Bacteria 3821
240 Ga0207655_1003001 3300025728 Bacteria 12929
241 Ga0207682_10008598 3300025893 Bacteria 4036
242 Ga0207645_10007443 3300025907 Bacteria 7732
243 Ga0207705_10242982 3300025909 Bacteria 1372
244 Ga0207684_10285567 3300025910 Bacteria 1423
245 Ga0207654_10105147 3300025911 Bacteria 1746
246 Ga0207707_10004410 3300025912 Bacteria 12423
247 Ga0207695_10029800 3300025913 Bacteria 6021
248 Ga0207671_10040139 3300025914 Bacteria 3465
249 Ga0207671_10144983 3300025914 Bacteria 1831
250 Ga0207657_10153442 3300025919 Bacteria 1874
251 Ga0207652_10276992 3300025921 Bacteria 1513
252 Ga0207694_10019947 3300025924 Bacteria 5071
253 Ga0207694_10054411 3300025924 Bacteria 3105
254 Ga0207659_10003471 3300025926 Bacteria 9455
255 Ga0207659_10151698 3300025926 Bacteria 1810
256 Ga0207687_10154543 3300025927 Bacteria 1754
257 Ga0207644_10171981 3300025931 Bacteria 1692
258 Ga0207690_10050236 3300025932 Bacteria 2783
259 Ga0207706_10013193 3300025933 Bacteria 7518
260 Ga0207706_10283538 3300025933 Bacteria 1444
261 Ga0207709_10001694 3300025935 Bacteria 14834
262 Ga0207709_10002682 3300025935 Bacteria 11029
263 Ga0207709_10035853 3300025935 Bacteria 2936
264 Ga0207709_10181440 3300025935 Bacteria 1487
265 Ga0207704_10196170 3300025938 Bacteria 1473
266 Ga0207665_10024609 3300025939 Bacteria 3971
267 Ga0207691_10033715 3300025940 Bacteria 4767
268 Ga0207691_10135769 3300025940 Bacteria 2169
269 Ga0207691_10181075 3300025940 Bacteria 1841
270 Ga0207691_10216981 3300025940 Bacteria 1660
271 Ga0207711_10034128 3300025941 Bacteria 4309
272 Ga0207689_10036877 3300025942 Bacteria 4057
273 Ga0207679_10004143 3300025945 Bacteria 9009
274 Ga0207679_10041704 3300025945 Bacteria 3293
275 Ga0207667_10060956 3300025949 Bacteria 3948
276 Ga0207667_10226574 3300025949 Bacteria 1915
277 Ga0207667_10511418 3300025949 Bacteria 1217
278 Ga0207668_10177763 3300025972 Bacteria 1676
279 Ga0207640_10107962 3300025981 Bacteria 1966
280 Ga0207658_10120856 3300025986 Bacteria 2088
281 Ga0207677_10002517 3300026023 Bacteria 9609
282 Ga0207677_10131809 3300026023 Bacteria 1899
283 Ga0207703_10082857 3300026035 Bacteria 2678
284 Ga0207678_10000966 3300026067 Bacteria 26297
285 Ga0207708_10256894 3300026075 Bacteria 1409
286 Ga0207702_10005766 3300026078 Bacteria 10771
287 Ga0207702_10199014 3300026078 Bacteria 1856
288 Ga0207648_10013431 3300026089 Bacteria 7621
289 Ga0207648_10308790 3300026089 Bacteria 1419
290 Ga0207676_10063803 3300026095 Bacteria 2927
291 Ga0207674_10012238 3300026116 Bacteria 9598
292 Ga0207675_100038504 3300026118 Bacteria 4463
293 Ga0207683_10063312 3300026121 Bacteria 3258
294 Ga0207683_10194424 3300026121 Bacteria 1843
295 Ga0207683_10217258 3300026121 Bacteria 1741
296 Ga0207683_10462981 3300026121 Bacteria 1169
297 Ga0207698_10265856 3300026142 Bacteria 1578
298 Ga0207698_10371672 3300026142 Bacteria 1357
299 Ga0209970_1000017 3300027614 Bacteria 21804
300 Ga0209588_1021228 3300027671 Bacteria 2038
301 Ga0209974_10001308 3300027876 Bacteria 8953
302 Ga0207428_10102069 3300027907 Bacteria 2215
303 Ga0268265_10030448 3300028380 Bacteria 3887
304 Ga0307515_10000188 3300028794 Bacteria 151439
305 Ga0307515_10000213 3300028794 Bacteria 142742
306 Ga0307515_10000708 3300028794 Bacteria 76903
307 Ga0307515_10002971 3300028794 Bacteria 35983
308 Ga0307515_10012188 3300028794 Bacteria 16207
309 Ga0307515_10013083 3300028794 Bacteria 15535
310 Ga0307512_10111196 3300030522 Bacteria 1804
311 Ga0316177_1169476 3300030731 Bacteria 2939
312 Ga0316176_1023454 3300030732 Bacteria 2941
313 Ga0314311_1040207 3300030733 Bacteria 5569
314 Ga0316179_1015655 3300030734 Bacteria 2497
315 Ga0316180_1121156 3300030736 Bacteria 5577
316 Ga0316183_1091139 3300030742 Bacteria 8181
317 Ga0316181_1025223 3300030744 Bacteria 5418
318 Ga0316182_1079883 3300030745 Bacteria 3734
319 Ga0307513_10002965 3300031456 Bacteria 23158
320 Ga0307513_10042931 3300031456 Bacteria 4972
321 Ga0307513_10138740 3300031456 Bacteria 2362
322 Ga0307513_10255435 3300031456 Bacteria 1546
323 Ga0307509_10048637 3300031507 Bacteria 4552
324 Ga0307509_10049375 3300031507 Bacteria 4511
325 Ga0307408_100067059 3300031548 Bacteria 2638
326 Ga0307408_100078955 3300031548 Bacteria 2454
327 Ga0307408_100117457 3300031548 Bacteria 2054
328 Ga0307508_10000169 3300031616 Bacteria 78769
329 Ga0307514_10007800 3300031649 Bacteria 9197
330 Ga0307514_10014677 3300031649 Bacteria 6481
331 Ga0307514_10063252 3300031649 Bacteria 2810
332 Ga0307514_10120357 3300031649 Bacteria 1833
333 Ga0307516_10005212 3300031730 Bacteria 15650
334 Ga0307516_10123683 3300031730 Bacteria 2374
335 Ga0307413_10104799 3300031824 Bacteria 1878
336 Ga0307406_10022724 3300031901 Bacteria 3723
337 Ga0307412_10103455 3300031911 Bacteria 2018
338 Ga0307416_100040223 3300032002 Bacteria 3629
339 Ga0307416_100078067 3300032002 Bacteria 2784
340 Ga0307416_100078731 3300032002 Bacteria 2775
341 Ga0307416_100398009 3300032002 Bacteria 1414
342 Ga0307411_10052538 3300032005 Bacteria 2665
343 Ga0307507_10018253 3300033179 Bacteria 7989
344 Ga0373958_0023793 3300034819 Bacteria 1155
345 Ga0373929_0006344 3300035085 Bacteria 2137
346 Ga0373960_0003082 3300035121 Bacteria 3765
347 Ga0373955_0006177 3300035172 Bacteria 5447
348 Ga0373962_0036338 3300035242 Bacteria 1371
349 Ga0373924_0004289 3300035410 Bacteria 4974
350 Ga0373931_0009317 3300035691 Bacteria 4689
351 Ga0373931_0105765 3300035691 Bacteria 1590
352 Ga0373931_0150365 3300035691 Bacteria 1357
353 Ga0373933_0003218 3300035724 Bacteria 9119
354 Ga0373937_0036959 3300036401 Bacteria 4450
355 Ga0395899_0022621 3300037312 Bacteria 4762
356 Ga0395899_0125367 3300037312 Bacteria 1837
357 Ga0395900_0071266 3300037418 Bacteria 3572
358 Ga0395900_0138075 3300037418 Bacteria 2497
359 Ga0395900_0177644 3300037418 Bacteria 2165
360 Ga0395900_0380594 3300037418 Bacteria 1379
361 Ga0395905_0014616 3300037471 Bacteria 7488
362 Ga0395905_0066409 3300037471 Bacteria 3378
363 Ga0395905_0102869 3300037471 Bacteria 2682
364 Ga0395905_0175098 3300037471 Bacteria 2014
365 Ga0395905_0196312 3300037471 Bacteria 1892
366 Ga0395901_0000278 3300038443 Bacteria 63368
367 Ga0395901_0161394 3300038443 Bacteria 2354
368 Ga0395901_0173613 3300038443 Bacteria 2261
369 Ga0439436_0000635 3300041404 Bacteria 9346
370 Ga0439436_0008849 3300041404 Bacteria 3089
371 Ga0439439_0000329 3300041406 Bacteria 7680
372 Ga0439466_0004216 3300041411 Bacteria 5551
373 Ga0439466_0034072 3300041411 Bacteria 1728
374 Ga0439465_0000176 3300041413 Bacteria 16369
375 Ga0451791_0852696 3300041451 Bacteria 1294
376 Ga0451807_0287218 3300041486 Bacteria 3567
377 Ga0451837_0502835 3300041494 Bacteria 1503
378 Ga0439431_0002901 3300041997 Bacteria 3773
379 Ga0439442_023339 3300042002 Bacteria 1285
380 Ga0439448_0079393 3300042005 Bacteria 1100
381 Ga0439432_011896 3300042006 Bacteria 2990
382 Ga0439449_0000632 3300042007 Bacteria 13206
383 Ga0439449_0000947 3300042007 Bacteria 11364
384 Ga0439449_0001266 3300042007 Bacteria 9907
385 Ga0439449_0012954 3300042007 Bacteria 3135
386 Ga0439449_0080520 3300042007 Bacteria 1201
387 Ga0439452_007456 3300042010 Bacteria 3349
388 Ga0439462_0002245 3300042015 Bacteria 4461
389 Ga0450923_010055 3300042125 Bacteria 1669
390 Ga0450894_005010 3300042131 Bacteria 1712
391 Ga0450896_003216 3300042133 Bacteria 2158
392 Ga0450906_006009 3300042145 Bacteria 2470
393 Ga0450910_005952 3300042147 Bacteria 1674
394 Ga0450910_006634 3300042147 Bacteria 1603
395 Ga0439446_0007798 3300042156 Bacteria 2821
396 Ga0439446_0013740 3300042156 Bacteria 2227
397 Ga0450908_001714 3300042184 Bacteria 4276
398 Ga0450908_013820 3300042184 Bacteria 1456
399 Ga0439434_0003310 3300042435 Bacteria 4734
400 Ga0439434_0034341 3300042435 Bacteria 1548
401 Ga0450918_002415 3300042531 Bacteria 3529
402 Ga0451577_0018873 3300042876 Bacteria 6347
403 Ga0466969_0006732 3300044656 Bacteria 6111
404 Ga0466969_0094914 3300044656 Bacteria 1409
405 Ga0466965_0150659 3300044683 Bacteria 1215
406 Ga0466966_0003207 3300044684 Bacteria 10777
407 Ga0466966_0024310 3300044684 Bacteria 3963
408 Ga0466961_0032923 3300044693 Bacteria 3330
409 Ga0453684_0000419 3300044712 Bacteria 173463
410 Ga0453684_0599544 3300044712 Bacteria 1207
411 Ga0466957_0124376 3300044842 Bacteria 1647
412 Ga0466957_0356659 3300044842 Bacteria 993
413 Ga0466960_0037302 3300044901 Bacteria 2279
414 Ga0466959_0040342 3300045049 Bacteria 3448
415 Ga0466959_0040630 3300045049 Bacteria 3435
416 Ga0451576_0230948 3300045051 Bacteria 1932
417 Ga0466958_0159985 3300045836 Bacteria 1422
418 Ga0495627_006476 3300046453 Bacteria 4586
419 Ga0495592_0000330 3300046454 Bacteria 39376
420 Ga0495650_0020417 3300046471 Bacteria 3231
421 Ga0495605_0000830 3300046474 Bacteria 21843
422 Ga0495639_0032220 3300046475 Bacteria 2337
423 Ga0495662_0007567 3300046476 Bacteria 5361
424 Ga0495584_0003615 3300046491 Bacteria 8432
425 Ga0495607_0001878 3300046501 Bacteria 17819
426 Ga0495608_0000582 3300046511 Bacteria 25075
427 Ga0495620_0015787 3300046515 Bacteria 3804
428 Ga0495620_0059825 3300046515 Bacteria 1591
429 Ga0495628_0023314 3300046516 Bacteria 5081
430 Ga0495630_0003958 3300046517 Bacteria 10354
431 Ga0495637_0003930 3300046520 Bacteria 7787
432 Ga0495643_0027862 3300046522 Bacteria 3171
433 Ga0495643_0050136 3300046522 Bacteria 2249
434 Ga0495663_0026887 3300046525 Bacteria 1686
435 Ga0495666_0029460 3300046526 Bacteria 2700
436 Ga0495652_0085622 3300046529 Bacteria 2589
437 Ga0495654_0004569 3300046530 Bacteria 8186
438 Ga0495640_0000361 3300046533 Bacteria 31989
439 Ga0495586_0001795 3300046535 Bacteria 11724
440 Ga0495587_0013730 3300046536 Bacteria 5089
441 Ga0495598_0029235 3300046537 Bacteria 1535
442 Ga0495598_0057519 3300046537 Bacteria 1190
443 Ga0495621_0086755 3300046539 Bacteria 1174
444 Ga0495667_0001990 3300046559 Bacteria 13534
445 Ga0495667_0022413 3300046559 Bacteria 4254
446 Ga0495656_0000087 3300046615 Bacteria 40520
447 Ga0495656_0039910 3300046615 Bacteria 1953
448 Ga0495634_0002172 3300046642 Bacteria 16474
449 Ga0495625_0033336 3300046660 Bacteria 3809
450 Ga0495625_0079748 3300046660 Bacteria 2281
451 Ga0495625_0137941 3300046660 Bacteria 1647
452 Ga0495635_0027700 3300046663 Bacteria 3941
453 Ga0495661_0001417 3300046665 Bacteria 20092
454 Ga0495661_0068337 3300046665 Bacteria 2084
455 Ga0495588_0000141 3300046674 Bacteria 104615
456 Ga0495658_0002569 3300046683 Bacteria 9129
457 Ga0495658_0012080 3300046683 Bacteria 4361
458 Ga0495613_0003055 3300046689 Bacteria 12507
459 Ga0495624_0092319 3300046690 Bacteria 1867
460 Ga0495670_0075575 3300046691 Bacteria 1710
461 Ga0495649_0006020 3300046694 Bacteria 7592
462 Ga0495649_0013627 3300046694 Bacteria 4687
463 Ga0495589_0000439 3300046794 Bacteria 30550
464 Ga0495600_0001984 3300046809 Bacteria 11501
465 Ga0495660_0000002 3300046810 Bacteria 1229481
466 Ga0495660_0000200 3300046810 Bacteria 62557
467 Ga0495660_0039930 3300046810 Bacteria 2603
468 Ga0495674_0091211 3300047319 Bacteria 2603
469 Ga0495672_0000977 3300047320 Bacteria 29598
470 Ga0495680_0017719 3300047322 Bacteria 6066
471 Ga0495683_0099996 3300047323 Bacteria 1395
472 Ga0495687_001379 3300047443 Bacteria 22465
473 Ga0495687_016288 3300047443 Bacteria 3740
474 Ga0495593_0010510 3300047673 Bacteria 5342
475 Ga0495614_0003596 3300048089 Bacteria 6947
476 Ga0495626_0000182 3300048091 Bacteria 76384
477 Ga0496100_0127053 3300048903 Bacteria 1791
478 Ga0496101_0005305 3300048904 Bacteria 8210
479 Ga0496102_0051880 3300048905 Bacteria 3736
480 Ga0496103_0066729 3300048906 Bacteria 2246
481 Ga0496106_0043124 3300048909 Bacteria 3384
482 Ga0496107_0038329 3300048910 Bacteria 3439
483 Ga0496113_0036113 3300048916 Bacteria 3619
484 Ga0496114_0205600 3300048917 Bacteria 1726
485 Ga0496116_0026980 3300048919 Bacteria 4188
486 Ga0496116_0075080 3300048919 Bacteria 2123
487 Ga0496117_0009871 3300048920 Bacteria 8790
488 Ga0496117_0024214 3300048920 Bacteria 4809
489 Ga0496118_0029354 3300048921 Bacteria 4613
490 Ga0496121_0179289 3300048924 Bacteria 1531
491 Ga0496122_0004105 3300048925 Bacteria 18443
492 Ga0496122_0055825 3300048925 Bacteria 2951
493 Ga0496122_0179834 3300048925 Bacteria 1263
494 Ga0496123_0005358 3300048926 Bacteria 12953
495 Ga0496124_0000138 3300048927 Bacteria 150311
496 Ga0496124_0062120 3300048927 Bacteria 3127
497 Ga0496124_0112561 3300048927 Bacteria 2188
498 Ga0496124_0200832 3300048927 Bacteria 1516
499 Ga0496125_0031422 3300048928 Bacteria 4733
500 Ga0496125_0050031 3300048928 Bacteria 3465
501 Ga0496126_0153355 3300048929 Bacteria 1973
502 Ga0501036_0223135 3300049572 Bacteria 1582
503 Ga0501038_0160696 3300049574 Bacteria 1826
504 Ga0501039_0040575 3300049575 Bacteria 3593
505 Ga0501039_0290618 3300049575 Bacteria 1285
506 Ga0501040_0033539 3300049576 Bacteria 3478
507 Ga0501042_0152012 3300049578 Bacteria 1669
508 Ga0501043_0000002 3300049579 Bacteria 351081
509 Ga0501046_0000008 3300049580 Bacteria 351167
510 Ga0501047_0000003 3300049581 Bacteria 508375
511 Ga0501048_0009085 3300049582 Bacteria 7480
512 Ga0501048_0019035 3300049582 Bacteria 5045
513 Ga0501071_0092361 3300049587 Bacteria 2224
514 Ga0501072_0282786 3300049588 Bacteria 1319
515 Ga0501074_0142227 3300049590 Bacteria 1716
516 Ga0501075_0030571 3300049591 Bacteria 3990
517 Ga0501076_0013791 3300049592 Bacteria 6065
518 Ga0501077_0081313 3300049593 Bacteria 2052
519 Ga0501221_044007 3300049704 Bacteria 984
520 Ga0501225_0001352 3300049705 Bacteria 7631
521 Ga0501079_0008396 3300049741 Bacteria 7828
522 Ga0501080_0117148 3300049742 Bacteria 2469
523 Ga0501081_0014387 3300049743 Bacteria 5219
524 Ga0501083_0187483 3300049744 Bacteria 1350
525 Ga0501035_0000430 3300049822 Bacteria 47325
526 Ga0501044_0227265 3300049823 Bacteria 1815
527 Ga0501045_0039184 3300049824 Bacteria 3448
528 nmdc:mga03n38_45006_c1 3300050490 Bacteria 1942
529 nmdc:mga00v17_15488_c1 3300050491 Bacteria 4281
530 nmdc:mga0k408_15212_c1 3300050493 Bacteria 4251
531 nmdc:mga0k408_1969_c1 3300050493 Bacteria 11007
532 nmdc:mga0k408_23388_c1 3300050493 Bacteria 3485
533 nmdc:mga0k408_35418_c1 3300050493 Bacteria 2863
534 nmdc:mga0k408_769_c1 3300050493 Bacteria 17593
535 nmdc:mga0k408_82559_c1 3300050493 Bacteria 1883
536 nmdc:mga06z11_22994_c1 3300050494 Bacteria 2921
537 nmdc:mga07m45_104352_c1 3300050496 Bacteria 1630
538 nmdc:mga07m45_187765_c1 3300050496 Bacteria 1202
539 nmdc:mga07m45_93727_c1 3300050496 Bacteria 1721
540 nmdc:mga07m45_969_c1 3300050496 Bacteria 12632
541 nmdc:mga0rr50_145120_c1 3300050513 Bacteria 1913
542 nmdc:mga08x19_18296_c1 3300050514 Bacteria 4295
543 nmdc:mga08x19_26554_c1 3300050514 Bacteria 3614
544 nmdc:mga08x19_27548_c1 3300050514 Bacteria 3554
545 nmdc:mga0a205_32392_c1 3300050515 Bacteria 5012
546 Ga0495601_0016509 3300053077 Bacteria 4475
547 Ga0500610_0014027 3300053079 Bacteria 3748
548 Ga0500635_0000005 3300053080 Bacteria 187821
549 Ga0500578_0000058 3300053086 Bacteria 119650
550 Ga0500643_009686 3300053087 Bacteria 3658
551 Ga0500651_0000125 3300053093 Bacteria 47146
552 Ga0500571_006911 3300053110 Bacteria 6150
553 Ga0500607_015269 3300053121 Bacteria 4431
554 Ga0500642_0000990 3300053130 Bacteria 8165
555 Ga0500652_000300 3300053131 Bacteria 17910
556 Ga0500655_002364 3300053133 Bacteria 3454
557 Ga0500658_0002237 3300053134 Bacteria 7509
558 Ga0500574_000720 3300053141 Bacteria 4384
559 Ga0500622_0000094 3300053156 Bacteria 91975
560 Ga0500622_0007719 3300053156 Bacteria 6075
561 Ga0500627_0054268 3300053158 Bacteria 1752
562 Ga0500636_0041368 3300053177 Bacteria 2726
563 Ga0500587_000079 3300053739 Bacteria 8123
564 Ga0501084_0099090 3300054114 Bacteria 2447

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10000708 Ga0307515_1000070825 300
2 3300030522 Ga0307512_10111196 Ga0307512_101111962 300
3 3300053080 Ga0500635_0000005 Ga0500635_0000005_87634_88599 301
4 3300013306 Ga0163162_10742372 Ga0163162_107423721 302
5 3300009177 Ga0105248_10357074 Ga0105248_103570742 304
6 3300005355 Ga0070671_100150526 Ga0070671_1001505262 305
7 3300013306 Ga0163162_10355996 Ga0163162_103559962 305
8 3300025931 Ga0207644_10171981 Ga0207644_101719812 305
9 3300006195 Ga0075366_10017732 Ga0075366_100177322 306
10 3300006353 Ga0075370_10163990 Ga0075370_101639902 306
11 3300027876 Ga0209974_10001308 Ga0209974_100013086 306
12 3300028794 Ga0307515_10002971 Ga0307515_100029718 306
13 3300028794 Ga0307515_10013083 Ga0307515_100130839 306
14 3300031456 Ga0307513_10042931 Ga0307513_100429314 306
15 3300031507 Ga0307509_10048637 Ga0307509_100486374 306
16 3300031616 Ga0307508_10000169 Ga0307508_1000016954 306
17 3300031649 Ga0307514_10014677 Ga0307514_100146773 306
18 3300033179 Ga0307507_10018253 Ga0307507_100182533 306
19 3300041451 Ga0451791_0852696 Ga0451791_0852696_282_1232 306
20 3300042876 Ga0451577_0018873 Ga0451577_0018873_1994_2953 306
21 3300046515 Ga0495620_0059825 Ga0495620_0059825_188_1138 306
22 3300046522 Ga0495643_0027862 Ga0495643_0027862_2008_2958 306
23 3300046660 Ga0495625_0079748 Ga0495625_0079748_603_1553 306
24 3300050493 nmdc:mga0k408_23388_c1 nmdc:mga0k408_23388_c1_2461_3408 306
25 3300050496 nmdc:mga07m45_187765_c1 nmdc:mga07m45_187765_c1_166_1116 306
26 3300053739 Ga0500587_000079 Ga0500587_000079_5097_6047 306
27 3300049572 Ga0501036_0223135 Ga0501036_0223135_19_945 307
28 3300003752 Ga0055539_1001372 Ga0055539_10013723 308
29 3300003756 Ga0055533_1001365 Ga0055533_10013653 308
30 3300003759 Ga0055525_1000211 Ga0055525_100021148 308
31 3300003760 Ga0055527_1000257 Ga0055527_100025718 308
32 3300003760 Ga0055527_1000263 Ga0055527_100026317 308
33 3300003761 Ga0055535_1000541 Ga0055535_100054111 308
34 3300003761 Ga0055535_1000731 Ga0055535_100073110 308
35 3300003762 Ga0055542_1000567 Ga0055542_100056711 308
36 3300003762 Ga0055542_1000578 Ga0055542_100057817 308
37 3300003763 Ga0055529_1000538 Ga0055529_100053811 308
38 3300003763 Ga0055529_1000850 Ga0055529_10008508 308
39 3300005614 Ga0068856_100003150 Ga0068856_10000315011 308
40 3300013307 Ga0157372_10547459 Ga0157372_105474592 308
41 3300025226 Ga0209674_100108 Ga0209674_10010834 308
42 3300025226 Ga0209674_101427 Ga0209674_1014273 308
43 3300025228 Ga0209672_100007 Ga0209672_100007319 308
44 3300025228 Ga0209672_100009 Ga0209672_10000944 308
45 3300025230 Ga0209563_100079 Ga0209563_100079186 308
46 3300025242 Ga0209258_100011 Ga0209258_100011598 308
47 3300025242 Ga0209258_100046 Ga0209258_10004618 308
48 3300025253 Ga0209677_103790 Ga0209677_1037903 308
49 3300025254 Ga0209148_1000013 Ga0209148_1000013598 308
50 3300025254 Ga0209148_1000084 Ga0209148_1000084112 308
51 3300025272 Ga0209455_1000010 Ga0209455_1000010319 308
52 3300025272 Ga0209455_1000012 Ga0209455_1000012598 308
53 3300026075 Ga0207708_10256894 Ga0207708_102568942 308
54 3300026078 Ga0207702_10005766 Ga0207702_100057666 308
55 3300045049 Ga0466959_0040342 Ga0466959_0040342_592_1518 308
56 iso_pu_bacteria 2643221556 2643801831 308
57 iso_pu_bacteria 2643221684 2644474375 308
58 iso_pu_bacteria 8047673197 8047676399 308
59 3300009176 Ga0105242_10056360 Ga0105242_100563602 309
60 3300013297 Ga0157378_10042027 Ga0157378_100420275 309
61 3300003759 Ga0055525_1000023 Ga0055525_1000023112 310
62 3300005339 Ga0070660_100096218 Ga0070660_1000962181 310
63 3300005458 Ga0070681_10000172 Ga0070681_1000017240 310
64 3300005563 Ga0068855_100507589 Ga0068855_1005075892 310
65 3300009176 Ga0105242_10309203 Ga0105242_103092031 310
66 3300025230 Ga0209563_100011 Ga0209563_100011426 310
67 3300025254 Ga0209148_1000199 Ga0209148_100019959 310
68 3300025912 Ga0207707_10004410 Ga0207707_1000441014 310
69 3300025919 Ga0207657_10153442 Ga0207657_101534422 310
70 3300025932 Ga0207690_10050236 Ga0207690_100502362 310
71 3300034819 Ga0373958_0023793 Ga0373958_0023793_130_1092 310
72 3300035085 Ga0373929_0006344 Ga0373929_0006344_654_1616 310
73 3300035121 Ga0373960_0003082 Ga0373960_0003082_949_1911 310
74 3300035242 Ga0373962_0036338 Ga0373962_0036338_247_1209 310
75 3300035691 Ga0373931_0009317 Ga0373931_0009317_3691_4653 310
76 3300037312 Ga0395899_0022621 Ga0395899_0022621_1538_2473 310
77 3300037418 Ga0395900_0071266 Ga0395900_0071266_2492_3427 310
78 3300037418 Ga0395900_0138075 Ga0395900_0138075_1551_2486 310
79 3300038443 Ga0395901_0000278 Ga0395901_0000278_1035_1970 310
80 3300041494 Ga0451837_0502835 Ga0451837_0502835_85_1071 310
81 3300042005 Ga0439448_0079393 Ga0439448_0079393_53_988 310
82 3300044656 Ga0466969_0094914 Ga0466969_0094914_221_1156 310
83 3300044683 Ga0466965_0150659 Ga0466965_0150659_17_952 310
84 3300044684 Ga0466966_0003207 Ga0466966_0003207_9591_10526 310
85 3300044684 Ga0466966_0024310 Ga0466966_0024310_2775_3713 310
86 3300044842 Ga0466957_0356659 Ga0466957_0356659_16_951 310
87 3300045049 Ga0466959_0040630 Ga0466959_0040630_679_1614 310
88 3300048905 Ga0496102_0051880 Ga0496102_0051880_265_1200 310
89 3300048906 Ga0496103_0066729 Ga0496103_0066729_673_1608 310
90 3300048916 Ga0496113_0036113 Ga0496113_0036113_681_1616 310
91 3300048925 Ga0496122_0004105 Ga0496122_0004105_1638_2573 310
92 3300048927 Ga0496124_0112561 Ga0496124_0112561_729_1664 310
93 3300049574 Ga0501038_0160696 Ga0501038_0160696_502_1452 310
94 3300049575 Ga0501039_0040575 Ga0501039_0040575_1243_2193 310
95 3300049575 Ga0501039_0290618 Ga0501039_0290618_209_1159 310
96 3300049576 Ga0501040_0033539 Ga0501040_0033539_2250_3200 310
97 3300049578 Ga0501042_0152012 Ga0501042_0152012_400_1350 310
98 3300049582 Ga0501048_0019035 Ga0501048_0019035_3742_4692 310
99 3300049587 Ga0501071_0092361 Ga0501071_0092361_187_1137 310
100 3300049588 Ga0501072_0282786 Ga0501072_0282786_95_1045 310
101 3300049590 Ga0501074_0142227 Ga0501074_0142227_603_1553 310
102 3300049591 Ga0501075_0030571 Ga0501075_0030571_2009_2959 310
103 3300049592 Ga0501076_0013791 Ga0501076_0013791_782_1732 310
104 3300049593 Ga0501077_0081313 Ga0501077_0081313_614_1564 310
105 3300049741 Ga0501079_0008396 Ga0501079_0008396_1806_2756 310
106 3300049742 Ga0501080_0117148 Ga0501080_0117148_1137_2087 310
107 3300049743 Ga0501081_0014387 Ga0501081_0014387_1569_2519 310
108 3300049744 Ga0501083_0187483 Ga0501083_0187483_46_996 310
109 3300049822 Ga0501035_0000430 Ga0501035_0000430_25211_26146 310
110 3300049823 Ga0501044_0227265 Ga0501044_0227265_452_1387 310
111 3300049824 Ga0501045_0039184 Ga0501045_0039184_294_1244 310
112 3300006914 Ga0075436_100156505 Ga0075436_1001565052 311
113 3300007076 Ga0075435_100133477 Ga0075435_1001334772 311
114 3300035691 Ga0373931_0150365 Ga0373931_0150365_160_1119 311
115 3300037418 Ga0395900_0380594 Ga0395900_0380594_240_1178 311
116 3300037471 Ga0395905_0196312 Ga0395905_0196312_834_1772 311
117 3300045836 Ga0466958_0159985 Ga0466958_0159985_29_967 311
118 3300046474 Ga0495605_0000830 Ga0495605_0000830_711_1649 311
119 3300046491 Ga0495584_0003615 Ga0495584_0003615_6591_7529 311
120 3300046501 Ga0495607_0001878 Ga0495607_0001878_720_1658 311
121 3300046522 Ga0495643_0050136 Ga0495643_0050136_947_1885 311
122 3300046615 Ga0495656_0039910 Ga0495656_0039910_361_1299 311
123 3300046665 Ga0495661_0001417 Ga0495661_0001417_11284_12222 311
124 3300046665 Ga0495661_0068337 Ga0495661_0068337_78_1016 311
125 3300046674 Ga0495588_0000141 Ga0495588_0000141_75249_76187 311
126 3300046694 Ga0495649_0013627 Ga0495649_0013627_3507_4445 311
127 3300046794 Ga0495589_0000439 Ga0495589_0000439_1231_2169 311
128 3300046810 Ga0495660_0000200 Ga0495660_0000200_40910_41848 311
129 3300047320 Ga0495672_0000977 Ga0495672_0000977_28444_29382 311
130 3300047323 Ga0495683_0099996 Ga0495683_0099996_211_1149 311
131 3300047443 Ga0495687_001379 Ga0495687_001379_20530_21468 311
132 3300048091 Ga0495626_0000182 Ga0495626_0000182_67233_68171 311
133 3300048903 Ga0496100_0127053 Ga0496100_0127053_332_1270 311
134 3300048909 Ga0496106_0043124 Ga0496106_0043124_332_1270 311
135 3300048910 Ga0496107_0038329 Ga0496107_0038329_779_1717 311
136 3300048925 Ga0496122_0055825 Ga0496122_0055825_1749_2687 311
137 3300048926 Ga0496123_0005358 Ga0496123_0005358_11889_12827 311
138 3300050513 nmdc:mga0rr50_145120_c1 nmdc:mga0rr50_145120_c1_109_1071 311
139 3300050514 nmdc:mga08x19_27548_c1 nmdc:mga08x19_27548_c1_2447_3409 311
140 iso_pu_bacteria 2585428062 2587754599 311
141 3300038443 Ga0395901_0161394 Ga0395901_0161394_999_1937 312
142 iso_pu_bacteria 2643221654 2644303911 312
143 iso_pu_bacteria 2643221683 2644464745 312
144 3300003215 JGI25153J46596_10002591 JGI25153J46596_100025912 313
145 3300025273 Ga0209673_1012617 Ga0209673_10126174 313
146 3300025297 Ga0209758_1000204 Ga0209758_1000204119 313
147 3300025298 Ga0209050_1001124 Ga0209050_100112430 313
148 3300049704 Ga0501221_044007 Ga0501221_044007_33_974 313
149 3300053086 Ga0500578_0000058 Ga0500578_0000058_97955_98914 313
150 3300009147 Ga0114129_10534478 Ga0114129_105344782 314
151 3300050493 nmdc:mga0k408_82559_c1 nmdc:mga0k408_82559_c1_690_1634 314
152 3300050496 nmdc:mga07m45_93727_c1 nmdc:mga07m45_93727_c1_344_1288 314
153 3300003162 Ga0006778J45830_1008092 Ga0006778J45830_10080921 315
154 3300003308 Ga0006777J48905_1006622 Ga0006777J48905_10066221 315
155 3300005328 Ga0070676_10001955 Ga0070676_100019555 315
156 3300005331 Ga0070670_100056138 Ga0070670_1000561384 315
157 3300005338 Ga0068868_100234608 Ga0068868_1002346081 315
158 3300005354 Ga0070675_100040843 Ga0070675_1000408434 315
159 3300005354 Ga0070675_100373559 Ga0070675_1003735591 315
160 3300005367 Ga0070667_100039880 Ga0070667_1000398803 315
161 3300005455 Ga0070663_100149220 Ga0070663_1001492201 315
162 3300005457 Ga0070662_100216278 Ga0070662_1002162781 315
163 3300005459 Ga0068867_100003928 Ga0068867_1000039286 315
164 3300006195 Ga0075366_10157533 Ga0075366_101575332 315
165 3300006353 Ga0075370_10185073 Ga0075370_101850731 315
166 3300014968 Ga0157379_10010131 Ga0157379_100101313 315
167 3300025907 Ga0207645_10007443 Ga0207645_100074434 315
168 3300025926 Ga0207659_10003471 Ga0207659_100034715 315
169 3300025933 Ga0207706_10283538 Ga0207706_102835382 315
170 3300025935 Ga0207709_10035853 Ga0207709_100358534 315
171 3300025986 Ga0207658_10120856 Ga0207658_101208562 315
172 3300026023 Ga0207677_10131809 Ga0207677_101318092 315
173 3300026067 Ga0207678_10000966 Ga0207678_1000096625 315
174 3300026089 Ga0207648_10013431 Ga0207648_100134317 315
175 3300026116 Ga0207674_10012238 Ga0207674_100122382 315
176 3300026121 Ga0207683_10194424 Ga0207683_101944244 315
177 3300027614 Ga0209970_1000017 Ga0209970_100001716 315
178 3300028794 Ga0307515_10012188 Ga0307515_100121888 315
179 3300031456 Ga0307513_10138740 Ga0307513_101387402 315
180 3300031507 Ga0307509_10049375 Ga0307509_100493756 315
181 3300031730 Ga0307516_10005212 Ga0307516_1000521212 315
182 3300042007 Ga0439449_0000947 Ga0439449_0000947_2485_3432 315
183 3300044712 Ga0453684_0599544 Ga0453684_0599544_207_1157 315
184 3300046694 Ga0495649_0006020 Ga0495649_0006020_2490_3449 315
185 3300046810 Ga0495660_0000002 Ga0495660_0000002_146028_146978 315
186 3300046810 Ga0495660_0039930 Ga0495660_0039930_1349_2308 315
187 3300047443 Ga0495687_016288 Ga0495687_016288_2758_3717 315
188 3300049579 Ga0501043_0000002 Ga0501043_0000002_103035_103988 315
189 3300049580 Ga0501046_0000008 Ga0501046_0000008_103118_104071 315
190 3300049581 Ga0501047_0000003 Ga0501047_0000003_126300_127253 315
191 3300049582 Ga0501048_0009085 Ga0501048_0009085_4002_4955 315
192 3300050493 nmdc:mga0k408_15212_c1 nmdc:mga0k408_15212_c1_931_1881 315
193 3300050493 nmdc:mga0k408_1969_c1 nmdc:mga0k408_1969_c1_334_1284 315
194 3300054114 Ga0501084_0099090 Ga0501084_0099090_1242_2192 315
195 iso_pu_bacteria 2513020051 2513227669 315
196 iso_pu_bacteria 2585428057 2587728347 315
197 iso_pu_bacteria 2585428058 2587735520 315
198 iso_pu_bacteria 2588253510 2588294089 315
199 iso_pu_bacteria 2599185214 2599625699 315
200 iso_pu_bacteria 2599185226 2599673712 315
201 iso_pu_bacteria 2599185227 2599683382 315
202 iso_pu_bacteria 2599185229 2599695130 315
203 iso_pu_bacteria 2643221628 2644162280 315
204 iso_pu_bacteria 2643221658 2644324430 315
205 iso_pu_bacteria 2643221672 2644396279 315
206 iso_pu_bacteria 2738541277 2738719218 315
207 iso_pu_bacteria 2738541307 2738880237 315
208 iso_pu_bacteria 2738543019 2739281980 315
209 iso_pu_bacteria 2818991446 2819599721 315
210 iso_pu_bacteria 2831265667 2831271682 315
211 iso_pu_bacteria 2838054893 2838055595 315
212 iso_pu_bacteria 2842677519 2842681198 315
213 iso_pu_bacteria 2885198086 2885200871 315
214 iso_pu_bacteria 2885211737 2885214346 315
215 iso_pu_bacteria 2899924645 2899927646 315
216 iso_pu_bacteria 2904449895 2904450650 315
217 iso_pu_bacteria 2904456579 2904459850 315
218 iso_pu_bacteria 2919462493 2919462822 315
219 iso_pu_bacteria 2928037797 2928042077 315
220 iso_pu_bacteria 2928044640 2928049641 315
221 iso_pu_bacteria 2928051484 2928051685 315
222 iso_pu_bacteria 2928064002 2928065624 315
223 iso_pu_bacteria 2928070936 2928073091 315
224 iso_pu_bacteria 2928084124 2928086875 315
225 iso_pu_bacteria 2929520902 2929521367 315
226 iso_pu_bacteria 2945945610 2945949381 315
227 iso_pu_bacteria 2945972063 2945973426 315
228 iso_pu_bacteria 2954767861 2954770967 315
229 3300003781 Ga0055536_1009893 Ga0055536_10098931 316
230 3300003792 Ga0055540_1009514 Ga0055540_10095141 316
231 3300005347 Ga0070668_100184608 Ga0070668_1001846083 316
232 3300005353 Ga0070669_100118760 Ga0070669_1001187602 316
233 3300005354 Ga0070675_100096127 Ga0070675_1000961272 316
234 3300005354 Ga0070675_100205043 Ga0070675_1002050431 316
235 3300005354 Ga0070675_100357887 Ga0070675_1003578872 316
236 3300005356 Ga0070674_100073733 Ga0070674_1000737334 316
237 3300005367 Ga0070667_100221688 Ga0070667_1002216881 316
238 3300005455 Ga0070663_100150644 Ga0070663_1001506442 316
239 3300005456 Ga0070678_100149019 Ga0070678_1001490192 316
240 3300005459 Ga0068867_100051581 Ga0068867_1000515812 316
241 3300005459 Ga0068867_100093997 Ga0068867_1000939973 316
242 3300005536 Ga0070697_100000484 Ga0070697_10000048432 316
243 3300005543 Ga0070672_100060070 Ga0070672_1000600702 316
244 3300005543 Ga0070672_100152473 Ga0070672_1001524732 316
245 3300005543 Ga0070672_100223915 Ga0070672_1002239152 316
246 3300005546 Ga0070696_100024909 Ga0070696_1000249092 316
247 3300005547 Ga0070693_100033981 Ga0070693_1000339813 316
248 3300005548 Ga0070665_100471013 Ga0070665_1004710132 316
249 3300005578 Ga0068854_100186977 Ga0068854_1001869772 316
250 3300005614 Ga0068856_100261142 Ga0068856_1002611422 316
251 3300005615 Ga0070702_100052304 Ga0070702_1000523043 316
252 3300005616 Ga0068852_100065994 Ga0068852_1000659944 316
253 3300005616 Ga0068852_100459095 Ga0068852_1004590951 316
254 3300005617 Ga0068859_100012039 Ga0068859_1000120398 316
255 3300005618 Ga0068864_100202000 Ga0068864_1002020002 316
256 3300005719 Ga0068861_100210225 Ga0068861_1002102251 316
257 3300005834 Ga0068851_10011655 Ga0068851_100116554 316
258 3300005844 Ga0068862_100120064 Ga0068862_1001200642 316
259 3300005844 Ga0068862_100256601 Ga0068862_1002566012 316
260 3300006844 Ga0075428_100285350 Ga0075428_1002853502 316
261 3300006881 Ga0068865_100265147 Ga0068865_1002651472 316
262 3300006931 Ga0097620_100012039 Ga0097620_1000120398 316
263 3300006948 Ga0099826_10172907 Ga0099826_101729072 316
264 3300009098 Ga0105245_10136105 Ga0105245_101361053 316
265 3300009101 Ga0105247_10027085 Ga0105247_100270852 316
266 3300009148 Ga0105243_10006812 Ga0105243_100068127 316
267 3300009148 Ga0105243_10231207 Ga0105243_102312071 316
268 3300009553 Ga0105249_10141075 Ga0105249_101410751 316
269 3300010375 Ga0105239_10105623 Ga0105239_101056232 316
270 3300010375 Ga0105239_10115930 Ga0105239_101159302 316
271 3300013296 Ga0157374_10508558 Ga0157374_105085581 316
272 3300013308 Ga0157375_10628751 Ga0157375_106287511 316
273 3300014968 Ga0157379_10046800 Ga0157379_100468003 316
274 3300017792 Ga0163161_10127069 Ga0163161_101270692 316
275 3300025292 Ga0209676_1000098 Ga0209676_1000098173 316
276 3300025303 Ga0209051_1003104 Ga0209051_10031042 316
277 3300025304 Ga0209257_1012245 Ga0209257_10122453 316
278 3300025893 Ga0207682_10008598 Ga0207682_100085982 316
279 3300025926 Ga0207659_10151698 Ga0207659_101516982 316
280 3300025927 Ga0207687_10154543 Ga0207687_101545432 316
281 3300025935 Ga0207709_10001694 Ga0207709_100016949 316
282 3300025935 Ga0207709_10181440 Ga0207709_101814401 316
283 3300025938 Ga0207704_10196170 Ga0207704_101961702 316
284 3300025940 Ga0207691_10135769 Ga0207691_101357692 316
285 3300025940 Ga0207691_10181075 Ga0207691_101810752 316
286 3300025940 Ga0207691_10216981 Ga0207691_102169812 316
287 3300025941 Ga0207711_10034128 Ga0207711_100341284 316
288 3300025942 Ga0207689_10036877 Ga0207689_100368773 316
289 3300025972 Ga0207668_10177763 Ga0207668_101777632 316
290 3300025981 Ga0207640_10107962 Ga0207640_101079622 316
291 3300026035 Ga0207703_10082857 Ga0207703_100828572 316
292 3300026078 Ga0207702_10199014 Ga0207702_101990142 316
293 3300026089 Ga0207648_10308790 Ga0207648_103087902 316
294 3300026095 Ga0207676_10063803 Ga0207676_100638032 316
295 3300026118 Ga0207675_100038504 Ga0207675_1000385041 316
296 3300026121 Ga0207683_10217258 Ga0207683_102172582 316
297 3300026142 Ga0207698_10265856 Ga0207698_102658562 316
298 3300027671 Ga0209588_1021228 Ga0209588_10212281 316
299 3300028380 Ga0268265_10030448 Ga0268265_100304482 316
300 3300028794 Ga0307515_10000213 Ga0307515_100002134 316
301 3300030745 Ga0316182_1079883 Ga0316182_10798832 316
302 3300031456 Ga0307513_10002965 Ga0307513_100029659 316
303 3300031548 Ga0307408_100067059 Ga0307408_1000670594 316
304 3300031649 Ga0307514_10007800 Ga0307514_100078004 316
305 3300031649 Ga0307514_10120357 Ga0307514_101203572 316
306 3300032002 Ga0307416_100078067 Ga0307416_1000780673 316
307 3300032005 Ga0307411_10052538 Ga0307411_100525381 316
308 3300035172 Ga0373955_0006177 Ga0373955_0006177_2783_3736 316
309 3300035410 Ga0373924_0004289 Ga0373924_0004289_527_1480 316
310 3300035691 Ga0373931_0105765 Ga0373931_0105765_414_1370 316
311 3300035724 Ga0373933_0003218 Ga0373933_0003218_5184_6137 316
312 3300036401 Ga0373937_0036959 Ga0373937_0036959_1404_2357 316
313 3300037312 Ga0395899_0125367 Ga0395899_0125367_803_1753 316
314 3300037471 Ga0395905_0175098 Ga0395905_0175098_835_1785 316
315 3300041486 Ga0451807_0287218 Ga0451807_0287218_2586_3539 316
316 3300044712 Ga0453684_0000419 Ga0453684_0000419_58513_59466 316
317 3300044842 Ga0466957_0124376 Ga0466957_0124376_129_1079 316
318 3300045051 Ga0451576_0230948 Ga0451576_0230948_298_1248 316
319 3300046454 Ga0495592_0000330 Ga0495592_0000330_30653_31606 316
320 3300046471 Ga0495650_0020417 Ga0495650_0020417_335_1297 316
321 3300046475 Ga0495639_0032220 Ga0495639_0032220_916_1869 316
322 3300046476 Ga0495662_0007567 Ga0495662_0007567_1440_2393 316
323 3300046511 Ga0495608_0000582 Ga0495608_0000582_5775_6728 316
324 3300046516 Ga0495628_0023314 Ga0495628_0023314_386_1339 316
325 3300046517 Ga0495630_0003958 Ga0495630_0003958_1273_2226 316
326 3300046526 Ga0495666_0029460 Ga0495666_0029460_215_1168 316
327 3300046529 Ga0495652_0085622 Ga0495652_0085622_1434_2387 316
328 3300046533 Ga0495640_0000361 Ga0495640_0000361_12019_12972 316
329 3300046535 Ga0495586_0001795 Ga0495586_0001795_8357_9310 316
330 3300046536 Ga0495587_0013730 Ga0495587_0013730_1968_2921 316
331 3300046537 Ga0495598_0029235 Ga0495598_0029235_37_990 316
332 3300046537 Ga0495598_0057519 Ga0495598_0057519_96_1052 316
333 3300046559 Ga0495667_0001990 Ga0495667_0001990_6634_7587 316
334 3300046559 Ga0495667_0022413 Ga0495667_0022413_3109_4062 316
335 3300046642 Ga0495634_0002172 Ga0495634_0002172_8418_9371 316
336 3300046663 Ga0495635_0027700 Ga0495635_0027700_46_999 316
337 3300046683 Ga0495658_0012080 Ga0495658_0012080_706_1659 316
338 3300046689 Ga0495613_0003055 Ga0495613_0003055_8765_9718 316
339 3300046690 Ga0495624_0092319 Ga0495624_0092319_167_1120 316
340 3300046809 Ga0495600_0001984 Ga0495600_0001984_4631_5584 316
341 3300047319 Ga0495674_0091211 Ga0495674_0091211_22_975 316
342 3300047322 Ga0495680_0017719 Ga0495680_0017719_2221_3174 316
343 3300048917 Ga0496114_0205600 Ga0496114_0205600_634_1590 316
344 3300048928 Ga0496125_0031422 Ga0496125_0031422_2621_3571 316
345 3300048929 Ga0496126_0153355 Ga0496126_0153355_782_1732 316
346 3300050493 nmdc:mga0k408_769_c1 nmdc:mga0k408_769_c1_5918_6877 316
347 3300053077 Ga0495601_0016509 Ga0495601_0016509_927_1880 316
348 iso_pu_bacteria 2885192300 2885194756 316
349 3300005327 Ga0070658_10113308 Ga0070658_101133082 317
350 3300005336 Ga0070680_100196269 Ga0070680_1001962693 317
351 3300005444 Ga0070694_100044052 Ga0070694_1000440522 317
352 3300005467 Ga0070706_100232321 Ga0070706_1002323212 317
353 3300005530 Ga0070679_100328715 Ga0070679_1003287151 317
354 3300005536 Ga0070697_100042206 Ga0070697_1000422062 317
355 3300005545 Ga0070695_100002049 Ga0070695_10000204915 317
356 3300005546 Ga0070696_100005276 Ga0070696_1000052766 317
357 3300005563 Ga0068855_100055122 Ga0068855_1000551223 317
358 3300005985 Ga0081539_10000276 Ga0081539_1000027612 317
359 3300006914 Ga0075436_100072456 Ga0075436_1000724563 317
360 3300009093 Ga0105240_10005483 Ga0105240_1000548312 317
361 3300009147 Ga0114129_10085181 Ga0114129_100851813 317
362 3300009551 Ga0105238_10017534 Ga0105238_100175343 317
363 3300025909 Ga0207705_10242982 Ga0207705_102429822 317
364 3300025910 Ga0207684_10285567 Ga0207684_102855672 317
365 3300025913 Ga0207695_10029800 Ga0207695_100298003 317
366 3300025921 Ga0207652_10276992 Ga0207652_102769921 317
367 3300025924 Ga0207694_10019947 Ga0207694_100199475 317
368 3300025939 Ga0207665_10024609 Ga0207665_100246092 317
369 3300025949 Ga0207667_10060956 Ga0207667_100609563 317
370 3300025949 Ga0207667_10511418 Ga0207667_105114181 317
371 3300026121 Ga0207683_10462981 Ga0207683_104629811 317
372 3300032002 Ga0307416_100398009 Ga0307416_1003980091 317
373 3300037418 Ga0395900_0177644 Ga0395900_0177644_685_1638 317
374 3300037471 Ga0395905_0014616 Ga0395905_0014616_5039_5992 317
375 3300037471 Ga0395905_0066409 Ga0395905_0066409_302_1255 317
376 3300037471 Ga0395905_0102869 Ga0395905_0102869_1500_2453 317
377 3300038443 Ga0395901_0173613 Ga0395901_0173613_1101_2054 317
378 3300042156 Ga0439446_0013740 Ga0439446_0013740_450_1406 317
379 3300044656 Ga0466969_0006732 Ga0466969_0006732_4591_5544 317
380 3300044693 Ga0466961_0032923 Ga0466961_0032923_345_1298 317
381 3300044901 Ga0466960_0037302 Ga0466960_0037302_1308_2261 317
382 3300048927 Ga0496124_0000138 Ga0496124_0000138_106585_107538 317
383 3300050514 nmdc:mga08x19_18296_c1 nmdc:mga08x19_18296_c1_656_1618 317
384 3300050514 nmdc:mga08x19_26554_c1 nmdc:mga08x19_26554_c1_835_1797 317
385 3300050515 nmdc:mga0a205_32392_c1 nmdc:mga0a205_32392_c1_227_1189 317
386 3300053156 Ga0500622_0007719 Ga0500622_0007719_2399_3358 317
387 3300005338 Ga0068868_100496209 Ga0068868_1004962091 318
388 3300006048 Ga0075363_100010719 Ga0075363_1000107195 318
389 3300006051 Ga0075364_10014953 Ga0075364_100149533 318
390 3300006186 Ga0075369_10024516 Ga0075369_100245162 318
391 3300006353 Ga0075370_10050324 Ga0075370_100503243 318
392 3300009174 Ga0105241_10169035 Ga0105241_101690352 318
393 3300025911 Ga0207654_10105147 Ga0207654_101051471 318
394 3300026023 Ga0207677_10002517 Ga0207677_100025176 318
395 3300031730 Ga0307516_10123683 Ga0307516_101236832 318
396 3300042007 Ga0439449_0080520 Ga0439449_0080520_177_1133 318
397 3300046530 Ga0495654_0004569 Ga0495654_0004569_5846_6802 318
398 3300050493 nmdc:mga0k408_35418_c1 nmdc:mga0k408_35418_c1_873_1832 318
399 3300050496 nmdc:mga07m45_969_c1 nmdc:mga07m45_969_c1_8566_9525 318
400 3300053130 Ga0500642_0000990 Ga0500642_0000990_6682_7722 318
401 3300053131 Ga0500652_000300 Ga0500652_000300_2214_3254 318
402 3300053156 Ga0500622_0000094 Ga0500622_0000094_50016_51056 318
403 3300001979 JGI24740J21852_10019146 JGI24740J21852_100191463 319
404 3300001989 JGI24739J22299_10016858 JGI24739J22299_100168582 319
405 3300002773 JGI25152J39213_1018360 JGI25152J39213_10183601 319
406 3300002773 JGI25152J39213_1018389 JGI25152J39213_10183891 319
407 3300002774 JGI25150J39212_1003566 JGI25150J39212_10035661 319
408 3300002774 JGI25150J39212_1005288 JGI25150J39212_10052884 319
409 3300002987 JGI25159J45721_1020142 JGI25159J45721_10201421 319
410 3300002987 JGI25159J45721_1020978 JGI25159J45721_10209781 319
411 3300003187 JGI25151J46595_10047534 JGI25151J46595_100475341 319
412 3300003187 JGI25151J46595_10056120 JGI25151J46595_100561201 319
413 3300003215 JGI25153J46596_10023596 JGI25153J46596_100235964 319
414 3300003215 JGI25153J46596_10046124 JGI25153J46596_100461241 319
415 3300003354 JGI25160J50197_1033412 JGI25160J50197_10334121 319
416 3300003374 JGI25161J50226_1009694 JGI25161J50226_10096942 319
417 3300003374 JGI25161J50226_1010172 JGI25161J50226_10101721 319
418 3300003760 Ga0055527_1004752 Ga0055527_10047522 319
419 3300003761 Ga0055535_1000142 Ga0055535_100014245 319
420 3300003762 Ga0055542_1000022 Ga0055542_1000022186 319
421 3300003771 Ga0055526_1036732 Ga0055526_10367321 319
422 3300003771 Ga0055526_1036769 Ga0055526_10367691 319
423 3300003773 Ga0055537_1004361 Ga0055537_10043615 319
424 3300003773 Ga0055537_1015934 Ga0055537_10159341 319
425 3300003775 Ga0055524_1037208 Ga0055524_10372081 319
426 3300003775 Ga0055524_1037260 Ga0055524_10372601 319
427 3300003781 Ga0055536_1010815 Ga0055536_10108151 319
428 3300003781 Ga0055536_1033967 Ga0055536_10339671 319
429 3300003784 Ga0055534_1016999 Ga0055534_10169991 319
430 3300003790 Ga0055528_1027956 Ga0055528_10279562 319
431 3300003790 Ga0055528_1033313 Ga0055528_10333131 319
432 3300003791 Ga0055530_10000962 Ga0055530_1000096221 319
433 3300003791 Ga0055530_10008102 Ga0055530_100081023 319
434 3300003792 Ga0055540_1006373 Ga0055540_10063734 319
435 3300003792 Ga0055540_1008199 Ga0055540_10081991 319
436 3300003792 Ga0055540_1029134 Ga0055540_10291341 319
437 3300003792 Ga0055540_1029152 Ga0055540_10291521 319
438 3300003794 Ga0055531_10003806 Ga0055531_100038069 319
439 3300003794 Ga0055531_10042577 Ga0055531_100425771 319
440 3300003794 Ga0055531_10042605 Ga0055531_100426051 319
441 3300004625 Ga0055543_1004383 Ga0055543_10043831 319
442 3300004625 Ga0055543_1017930 Ga0055543_10179301 319
443 3300005262 Ga0065165_1042862 Ga0065165_10428621 319
444 3300005289 Ga0065704_10008104 Ga0065704_100081042 319
445 3300005344 Ga0070661_100073493 Ga0070661_1000734932 319
446 3300005539 Ga0068853_100170070 Ga0068853_1001700702 319
447 3300005563 Ga0068855_100292992 Ga0068855_1002929922 319
448 3300005834 Ga0068851_10027065 Ga0068851_100270653 319
449 3300006048 Ga0075363_100080599 Ga0075363_1000805992 319
450 3300006051 Ga0075364_10023105 Ga0075364_100231053 319
451 3300006177 Ga0075362_10019512 Ga0075362_100195123 319
452 3300006195 Ga0075366_10007213 Ga0075366_100072132 319
453 3300006353 Ga0075370_10019036 Ga0075370_100190361 319
454 3300006946 Ga0079104_1033298 Ga0079104_10332981 319
455 3300009036 Ga0105244_10004004 Ga0105244_100040044 319
456 3300009093 Ga0105240_10117301 Ga0105240_101173013 319
457 3300009148 Ga0105243_10208970 Ga0105243_102089702 319
458 3300009545 Ga0105237_10034309 Ga0105237_100343094 319
459 3300009545 Ga0105237_10352706 Ga0105237_103527062 319
460 3300010375 Ga0105239_10285640 Ga0105239_102856402 319
461 3300011119 Ga0105246_10020815 Ga0105246_100208153 319
462 3300011119 Ga0105246_10036655 Ga0105246_100366552 319
463 3300013100 Ga0157373_10044073 Ga0157373_100440732 319
464 3300013104 Ga0157370_10043977 Ga0157370_100439773 319
465 3300013105 Ga0157369_10011577 Ga0157369_1001157710 319
466 3300013297 Ga0157378_10304683 Ga0157378_103046832 319
467 3300013308 Ga0157375_10673053 Ga0157375_106730531 319
468 3300014497 Ga0182008_10016794 Ga0182008_100167943 319
469 3300014497 Ga0182008_10060321 Ga0182008_100603212 319
470 3300015261 Ga0182006_1012034 Ga0182006_10120343 319
471 3300015262 Ga0182007_10002886 Ga0182007_100028868 319
472 3300017792 Ga0163161_10008638 Ga0163161_100086382 319
473 3300025228 Ga0209672_100689 Ga0209672_1006895 319
474 3300025229 Ga0209147_100794 Ga0209147_1007946 319
475 3300025242 Ga0209258_100009 Ga0209258_100009849 319
476 3300025245 Ga0207425_1002257 Ga0207425_10022572 319
477 3300025254 Ga0209148_1000007 Ga0209148_1000007849 319
478 3300025258 Ga0209129_1000024 Ga0209129_1000024222 319
479 3300025258 Ga0209129_1000085 Ga0209129_10000852 319
480 3300025263 Ga0209565_1001386 Ga0209565_10013865 319
481 3300025273 Ga0209673_1000615 Ga0209673_100061550 319
482 3300025273 Ga0209673_1002626 Ga0209673_100262610 319
483 3300025273 Ga0209673_1006510 Ga0209673_10065105 319
484 3300025284 Ga0209130_1001597 Ga0209130_10015975 319
485 3300025284 Ga0209130_1002030 Ga0209130_10020303 319
486 3300025291 Ga0209675_1002464 Ga0209675_10024642 319
487 3300025292 Ga0209676_1000028 Ga0209676_1000028117 319
488 3300025292 Ga0209676_1000194 Ga0209676_100019416 319
489 3300025292 Ga0209676_1003187 Ga0209676_100318710 319
490 3300025294 Ga0209025_1017372 Ga0209025_10173723 319
491 3300025294 Ga0209025_1033643 Ga0209025_10336433 319
492 3300025294 Ga0209025_1052688 Ga0209025_10526882 319
493 3300025295 Ga0209564_1000183 Ga0209564_1000183116 319
494 3300025295 Ga0209564_1000198 Ga0209564_1000198106 319
495 3300025297 Ga0209758_1000049 Ga0209758_1000049141 319
496 3300025297 Ga0209758_1005124 Ga0209758_10051244 319
497 3300025298 Ga0209050_1000002 Ga0209050_1000002126 319
498 3300025298 Ga0209050_1000122 Ga0209050_1000122114 319
499 3300025298 Ga0209050_1003795 Ga0209050_10037953 319
500 3300025299 Ga0209256_1000098 Ga0209256_1000098181 319
501 3300025299 Ga0209256_1000140 Ga0209256_1000140116 319
502 3300025302 Ga0207426_1000038 Ga0207426_1000038181 319
503 3300025302 Ga0207426_1000053 Ga0207426_1000053177 319
504 3300025303 Ga0209051_1000015 Ga0209051_100001546 319
505 3300025303 Ga0209051_1000159 Ga0209051_10001592 319
506 3300025303 Ga0209051_1000168 Ga0209051_1000168119 319
507 3300025303 Ga0209051_1000179 Ga0209051_10001791 319
508 3300025303 Ga0209051_1003161 Ga0209051_100316111 319
509 3300025304 Ga0209257_1000002 Ga0209257_100000235 319
510 3300025304 Ga0209257_1004330 Ga0209257_100433011 319
511 3300025321 Ga0207656_10008267 Ga0207656_100082673 319
512 3300025728 Ga0207655_1003001 Ga0207655_100300112 319
513 3300025914 Ga0207671_10040139 Ga0207671_100401393 319
514 3300025914 Ga0207671_10144983 Ga0207671_101449832 319
515 3300025924 Ga0207694_10054411 Ga0207694_100544113 319
516 3300025933 Ga0207706_10013193 Ga0207706_100131937 319
517 3300025935 Ga0207709_10002682 Ga0207709_100026821 319
518 3300025940 Ga0207691_10033715 Ga0207691_100337155 319
519 3300025945 Ga0207679_10004143 Ga0207679_100041434 319
520 3300025945 Ga0207679_10041704 Ga0207679_100417044 319
521 3300025949 Ga0207667_10226574 Ga0207667_102265743 319
522 3300026121 Ga0207683_10063312 Ga0207683_100633122 319
523 3300026142 Ga0207698_10371672 Ga0207698_103716721 319
524 3300027907 Ga0207428_10102069 Ga0207428_101020692 319
525 3300028794 Ga0307515_10000188 Ga0307515_1000018851 319
526 3300030731 Ga0316177_1169476 Ga0316177_11694763 319
527 3300030732 Ga0316176_1023454 Ga0316176_10234544 319
528 3300030733 Ga0314311_1040207 Ga0314311_10402075 319
529 3300030734 Ga0316179_1015655 Ga0316179_10156554 319
530 3300030736 Ga0316180_1121156 Ga0316180_11211562 319
531 3300030742 Ga0316183_1091139 Ga0316183_10911396 319
532 3300030744 Ga0316181_1025223 Ga0316181_10252231 319
533 3300031456 Ga0307513_10255435 Ga0307513_102554352 319
534 3300031548 Ga0307408_100078955 Ga0307408_1000789553 319
535 3300031548 Ga0307408_100117457 Ga0307408_1001174572 319
536 3300031649 Ga0307514_10063252 Ga0307514_100632522 319
537 3300031824 Ga0307413_10104799 Ga0307413_101047992 319
538 3300031901 Ga0307406_10022724 Ga0307406_100227243 319
539 3300031911 Ga0307412_10103455 Ga0307412_101034551 319
540 3300032002 Ga0307416_100040223 Ga0307416_1000402233 319
541 3300032002 Ga0307416_100078731 Ga0307416_1000787313 319
542 3300041404 Ga0439436_0000635 Ga0439436_0000635_2440_3402 319
543 3300041404 Ga0439436_0008849 Ga0439436_0008849_1861_2820 319
544 3300041406 Ga0439439_0000329 Ga0439439_0000329_77_1039 319
545 3300041411 Ga0439466_0004216 Ga0439466_0004216_2557_3519 319
546 3300041411 Ga0439466_0034072 Ga0439466_0034072_401_1363 319
547 3300041413 Ga0439465_0000176 Ga0439465_0000176_14137_15099 319
548 3300041997 Ga0439431_0002901 Ga0439431_0002901_2666_3628 319
549 3300042002 Ga0439442_023339 Ga0439442_023339_283_1242 319
550 3300042006 Ga0439432_011896 Ga0439432_011896_290_1252 319
551 3300042007 Ga0439449_0000632 Ga0439449_0000632_8876_9838 319
552 3300042007 Ga0439449_0001266 Ga0439449_0001266_875_1837 319
553 3300042007 Ga0439449_0012954 Ga0439449_0012954_259_1221 319
554 3300042010 Ga0439452_007456 Ga0439452_007456_1299_2261 319
555 3300042015 Ga0439462_0002245 Ga0439462_0002245_3024_3986 319
556 3300042125 Ga0450923_010055 Ga0450923_010055_564_1523 319
557 3300042131 Ga0450894_005010 Ga0450894_005010_201_1163 319
558 3300042133 Ga0450896_003216 Ga0450896_003216_582_1541 319
559 3300042145 Ga0450906_006009 Ga0450906_006009_1366_2328 319
560 3300042147 Ga0450910_005952 Ga0450910_005952_665_1624 319
561 3300042147 Ga0450910_006634 Ga0450910_006634_416_1378 319
562 3300042156 Ga0439446_0007798 Ga0439446_0007798_1582_2544 319
563 3300042184 Ga0450908_001714 Ga0450908_001714_2241_3200 319
564 3300042184 Ga0450908_013820 Ga0450908_013820_155_1117 319
565 3300042435 Ga0439434_0003310 Ga0439434_0003310_3366_4325 319
566 3300042435 Ga0439434_0034341 Ga0439434_0034341_278_1240 319
567 3300042531 Ga0450918_002415 Ga0450918_002415_1831_2790 319
568 3300046453 Ga0495627_006476 Ga0495627_006476_1520_2479 319
569 3300046515 Ga0495620_0015787 Ga0495620_0015787_2320_3279 319
570 3300046520 Ga0495637_0003930 Ga0495637_0003930_4163_5122 319
571 3300046525 Ga0495663_0026887 Ga0495663_0026887_378_1337 319
572 3300046539 Ga0495621_0086755 Ga0495621_0086755_139_1098 319
573 3300046615 Ga0495656_0000087 Ga0495656_0000087_18365_19324 319
574 3300046660 Ga0495625_0033336 Ga0495625_0033336_2584_3543 319
575 3300046660 Ga0495625_0137941 Ga0495625_0137941_301_1260 319
576 3300046683 Ga0495658_0002569 Ga0495658_0002569_2585_3544 319
577 3300046691 Ga0495670_0075575 Ga0495670_0075575_253_1212 319
578 3300047673 Ga0495593_0010510 Ga0495593_0010510_617_1576 319
579 3300048089 Ga0495614_0003596 Ga0495614_0003596_4488_5447 319
580 3300048904 Ga0496101_0005305 Ga0496101_0005305_4900_5859 319
581 3300048919 Ga0496116_0026980 Ga0496116_0026980_1323_2282 319
582 3300048919 Ga0496116_0075080 Ga0496116_0075080_787_1746 319
583 3300048920 Ga0496117_0009871 Ga0496117_0009871_7456_8415 319
584 3300048920 Ga0496117_0024214 Ga0496117_0024214_1534_2493 319
585 3300048921 Ga0496118_0029354 Ga0496118_0029354_2034_2993 319
586 3300048924 Ga0496121_0179289 Ga0496121_0179289_270_1229 319
587 3300048925 Ga0496122_0179834 Ga0496122_0179834_229_1188 319
588 3300048927 Ga0496124_0062120 Ga0496124_0062120_1721_2680 319
589 3300048927 Ga0496124_0200832 Ga0496124_0200832_538_1497 319
590 3300048928 Ga0496125_0050031 Ga0496125_0050031_2273_3232 319
591 3300049705 Ga0501225_0001352 Ga0501225_0001352_1543_2502 319
592 3300050490 nmdc:mga03n38_45006_c1 nmdc:mga03n38_45006_c1_727_1686 319
593 3300050491 nmdc:mga00v17_15488_c1 nmdc:mga00v17_15488_c1_1169_2128 319
594 3300050494 nmdc:mga06z11_22994_c1 nmdc:mga06z11_22994_c1_903_1862 319
595 3300050496 nmdc:mga07m45_104352_c1 nmdc:mga07m45_104352_c1_136_1095 319
596 3300053079 Ga0500610_0014027 Ga0500610_0014027_2174_3133 319
597 3300053087 Ga0500643_009686 Ga0500643_009686_345_1304 319
598 3300053093 Ga0500651_0000125 Ga0500651_0000125_22684_23643 319
599 3300053110 Ga0500571_006911 Ga0500571_006911_2813_3772 319
600 3300053121 Ga0500607_015269 Ga0500607_015269_2179_3138 319
601 3300053133 Ga0500655_002364 Ga0500655_002364_878_1837 319
602 3300053134 Ga0500658_0002237 Ga0500658_0002237_2096_3055 319
603 3300053141 Ga0500574_000720 Ga0500574_000720_701_1660 319
604 3300053158 Ga0500627_0054268 Ga0500627_0054268_611_1570 319
605 3300053177 Ga0500636_0041368 Ga0500636_0041368_693_1652 319
606 iso_pu_bacteria 2945909444 2945913817 319
607 iso_pu_bacteria 2945984333 2945990784 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

210

291

0.94

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

69

364

0.92

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

104

347

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.8988 5 314
5utx-assembly1.cif.gz_B crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form 0.893 5 314
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.8807 5 314
5utx-assembly1.cif.gz_B crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form 0.8781 5 314
4mo2-assembly1.cif.gz_B-2 crystal structure of udp-n-acetylgalactopyranose mutase from campylobacter jejuni 0.8683 7 35
ID Description Score Start End Superfamily
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9871 118 244 3.50.50.60
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9795 118 244 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9662 118 244 3.50.50.60
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.96 118 244 3.50.50.60
2q0kA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9584 118 244 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4Q6GBR0-F1-model_v4 Thioredoxin-disulfide reductase 0.9384 1 135 GO:0016491
AF-A0A353D0T2-F1-model_v4 Thioredoxin-disulfide reductase 0.936 1 114 GO:0016491
AF-A0A4Q6GBR0-F1-model_v4 Thioredoxin-disulfide reductase 0.9318 1 135 GO:0016491
AF-A0A520GV49-F1-model_v4 Thioredoxin-disulfide reductase 0.931 1 108 GO:0016491
AF-A0A353D0T2-F1-model_v4 Thioredoxin-disulfide reductase 0.9282 1 114 GO:0016491

Feature Viewer

pLDDT pTM Quality
84.92 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map