F468719

General Info

Members Datasets Scaffolds Average Seq Length
607 334 589 183

Family's Representative Sequence

Representative Sequence 3300041408|Ga0439453_0053395|Ga0439453_0053395_72_752
Length 226
Sequence MDQSAWQGDALVFYELDIVFIAPPTSQQFDMDMARKTESTMDVHEAIIGRRSVREYLSQEVDEQAIRRLIEAAVHAPNAVNQQPWTFTVVRGKDVLDRLSRAAKSHMLSTMPASVHSAHFRSLLSDENFHIFYHAPVLVLISAAAPGPWIVEDCALAAENLMLAAYAAGLGTCWIGFAQGFLNTSEGKTLLGLPAAWVPVAPIIVGHPKSMPVEVPRKAPDVRWVG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
4 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
5 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
6 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
7 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
8 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
9 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
10 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
11 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
12 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
13 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
14 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
15 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
16 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
17 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
18 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
22 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
187 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
325 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
328 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
329 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
330 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
334 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 0
Isolates 2.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0.33
Rhizoplane 8.4
Rhizosphere 85.01
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6575 2124908027 Bacteria 4020
2 JGI24751J29686_10026929 3300002459 Unclassified 1193
3 JGI25162J39368_1000078 3300002737 Bacteria 118049
4 JGI25163J39215_1000029 3300002771 Bacteria 66589
5 JGI25164J39214_1000096 3300002772 Bacteria 87444
6 JGI25165J46597_1000143 3300003214 Bacteria 118216
7 rootL2_10369569 3300003322 Unclassified 1455
8 rootH1_10340779 3300003323 Bacteria 2045
9 Ga0055542_1000115 3300003762 Bacteria 106506
10 Ga0055529_1000052 3300003763 Bacteria 203029
11 Ga0065714_10064625 3300005288 Bacteria 27824
12 Ga0065704_10226886 3300005289 Bacteria 1056
13 Ga0070658_10091916 3300005327 Bacteria 2501
14 Ga0070683_100160618 3300005329 Bacteria 2132
15 Ga0070670_100073247 3300005331 Bacteria 2942
16 Ga0070680_100552870 3300005336 Unclassified 987
17 Ga0070660_100075444 3300005339 Unclassified 2640
18 Ga0070689_100018682 3300005340 Bacteria 5112
19 Ga0070691_10257571 3300005341 Unclassified 938
20 Ga0070687_100124154 3300005343 Bacteria 1481
21 Ga0070661_100000062 3300005344 Bacteria 85485
22 Ga0070671_100157136 3300005355 Bacteria 1921
23 Ga0070674_100137225 3300005356 Bacteria 1831
24 Ga0070673_100235622 3300005364 Bacteria 1589
25 Ga0070688_100091397 3300005365 Bacteria 1989
26 Ga0070688_100157443 3300005365 Bacteria 1558
27 Ga0070659_100526369 3300005366 Bacteria 1010
28 Ga0070667_100101487 3300005367 Bacteria 2486
29 Ga0070709_10045336 3300005434 Bacteria 2728
30 Ga0070709_10536874 3300005434 Unclassified 893
31 Ga0070713_100507964 3300005436 Unclassified 1138
32 Ga0070701_10142287 3300005438 Bacteria 1373
33 Ga0070711_100142083 3300005439 Bacteria 1801
34 Ga0070700_100363390 3300005441 Bacteria 1077
35 Ga0070678_100558940 3300005456 Bacteria 1017
36 Ga0070681_10052286 3300005458 Bacteria 4073
37 Ga0068867_100128868 3300005459 Bacteria 1964
38 Ga0070685_10041721 3300005466 Bacteria 2616
39 Ga0070684_100036883 3300005535 Bacteria 4191
40 Ga0070693_100153188 3300005547 Bacteria 1462
41 Ga0070665_100013279 3300005548 Bacteria 8292
42 Ga0070665_100046791 3300005548 Bacteria 4343
43 Ga0070704_100868870 3300005549 Bacteria 809
44 Ga0070664_100000035 3300005564 Bacteria 81750
45 Ga0070664_100083995 3300005564 Bacteria 2748
46 Ga0068856_100010943 3300005614 Bacteria 8803
47 Ga0068856_100460178 3300005614 Bacteria 1293
48 Ga0068856_101386997 3300005614 Unclassified 717
49 Ga0068859_100191916 3300005617 Bacteria 2127
50 Ga0068863_100095000 3300005841 Bacteria 2830
51 Ga0068863_100526232 3300005841 Unclassified 1166
52 Ga0068858_100218238 3300005842 Bacteria 1806
53 Ga0068858_100458017 3300005842 Unclassified 1230
54 Ga0070712_100133706 3300006175 Bacteria 1883
55 Ga0070712_100284842 3300006175 Unclassified 1332
56 Ga0097621_100000035 3300006237 Bacteria 68179
57 Ga0068871_100000384 3300006358 Bacteria 31033
58 Ga0075431_100075386 3300006847 Bacteria 3481
59 Ga0075433_10282507 3300006852 Unclassified 1470
60 Ga0075434_100005391 3300006871 Bacteria 11635
61 Ga0068865_100054968 3300006881 Bacteria 2769
62 Ga0097620_100191908 3300006931 Bacteria 2127
63 Ga0105251_10003826 3300009011 Bacteria 10722
64 Ga0105251_10014136 3300009011 Bacteria 4430
65 Ga0105244_10000614 3300009036 Bacteria 31637
66 Ga0105244_10000616 3300009036 Bacteria 31571
67 Ga0105244_10100058 3300009036 Bacteria 1419
68 Ga0105240_10007067 3300009093 Bacteria 16368
69 Ga0111539_10291521 3300009094 Unclassified 1899
70 Ga0105245_10314625 3300009098 Bacteria 1540
71 Ga0105247_10046816 3300009101 Bacteria 2655
72 Ga0105247_10056610 3300009101 Unclassified 2422
73 Ga0114129_10023918 3300009147 Bacteria 8658
74 Ga0105243_10000026 3300009148 Bacteria 191522
75 Ga0105241_10017871 3300009174 Bacteria 5215
76 Ga0105242_10000647 3300009176 Bacteria 27252
77 Ga0105248_10889058 3300009177 Unclassified 1006
78 Ga0105237_10000042 3300009545 Bacteria 181280
79 Ga0105237_10594786 3300009545 Unclassified 1113
80 Ga0105238_10119210 3300009551 Bacteria 2619
81 Ga0105249_10322986 3300009553 Bacteria 1555
82 Ga0105239_10239757 3300010375 Bacteria 2035
83 Ga0105239_10337814 3300010375 Unclassified 1699
84 Ga0105239_11446016 3300010375 Bacteria 794
85 Ga0105246_10000110 3300011119 Bacteria 36633
86 Ga0105246_10020064 3300011119 Bacteria 4284
87 Ga0105246_10105910 3300011119 Bacteria 2056
88 Ga0157373_10017195 3300013100 Bacteria 5266
89 Ga0157371_10004131 3300013102 Bacteria 12804
90 Ga0157370_10008032 3300013104 Bacteria 11429
91 Ga0157370_10697422 3300013104 Bacteria 927
92 Ga0157369_10000191 3300013105 Bacteria 84979
93 Ga0157369_10000251 3300013105 Bacteria 73814
94 Ga0157378_10130732 3300013297 Bacteria 2324
95 Ga0163162_10051590 3300013306 Bacteria 4128
96 Ga0157375_10001383 3300013308 Bacteria 20936
97 Ga0157375_10001815 3300013308 Bacteria 18305
98 Ga0157375_10503258 3300013308 Bacteria 1375
99 Ga0163163_10001080 3300014325 Bacteria 23130
100 Ga0163163_10148886 3300014325 Bacteria 2385
101 Ga0157380_10593624 3300014326 Unclassified 1094
102 Ga0182008_10015393 3300014497 Bacteria 3991
103 Ga0182008_10122449 3300014497 Bacteria 1293
104 Ga0157379_10049322 3300014968 Bacteria 3759
105 Ga0157376_10012349 3300014969 Bacteria 6336
106 Ga0182006_1000083 3300015261 Bacteria 118727
107 Ga0182007_10000086 3300015262 Bacteria 69920
108 Ga0182007_10008020 3300015262 Bacteria 4367
109 Ga0182005_1001544 3300015265 Bacteria 9131
110 Ga0182005_1043938 3300015265 Bacteria 1215
111 Ga0182005_1073372 3300015265 Bacteria 941
112 Ga0213872_10000876 3300021361 Bacteria 21757
113 Ga0209760_100049 3300025207 Bacteria 107275
114 Ga0207427_100048 3300025231 Bacteria 238464
115 Ga0209437_100094 3300025233 Bacteria 238465
116 Ga0209148_1000011 3300025254 Bacteria 1196503
117 Ga0209233_1000106 3300025261 Bacteria 268795
118 Ga0209455_1000006 3300025272 Bacteria 1196503
119 Ga0207655_1000070 3300025728 Bacteria 239196
120 Ga0207655_1000076 3300025728 Bacteria 226359
121 Ga0207655_1006677 3300025728 Bacteria 7604
122 Ga0207713_1026120 3300025735 Bacteria 2683
123 Ga0207680_10348020 3300025903 Bacteria 1040
124 Ga0207699_10054812 3300025906 Bacteria 2370
125 Ga0207654_10059217 3300025911 Bacteria 2233
126 Ga0207707_10158905 3300025912 Bacteria 1976
127 Ga0207695_10026021 3300025913 Bacteria 6536
128 Ga0207695_10305816 3300025913 Bacteria 1481
129 Ga0207671_10002005 3300025914 Bacteria 22403
130 Ga0207671_10009256 3300025914 Bacteria 8250
131 Ga0207671_10383044 3300025914 Unclassified 1117
132 Ga0207693_10083921 3300025915 Unclassified 2496
133 Ga0207693_10115942 3300025915 Bacteria 2103
134 Ga0207663_10093522 3300025916 Unclassified 2001
135 Ga0207663_10312466 3300025916 Unclassified 1178
136 Ga0207663_10362537 3300025916 Unclassified 1100
137 Ga0207660_10280729 3300025917 Bacteria 1321
138 Ga0207662_10208690 3300025918 Unclassified 1267
139 Ga0207657_10007517 3300025919 Bacteria 11168
140 Ga0207649_10000010 3300025920 Bacteria 284354
141 Ga0207652_10106114 3300025921 Unclassified 2486
142 Ga0207694_10004306 3300025924 Bacteria 11133
143 Ga0207650_10058174 3300025925 Bacteria 2877
144 Ga0207700_10062989 3300025928 Bacteria 2819
145 Ga0207700_10356204 3300025928 Bacteria 1275
146 Ga0207664_10319872 3300025929 Bacteria 1369
147 Ga0207686_10051753 3300025934 Bacteria 2560
148 Ga0207709_10000004 3300025935 Bacteria 825156
149 Ga0207704_10173124 3300025938 Bacteria 1551
150 Ga0207711_10253593 3300025941 Bacteria 1616
151 Ga0207679_10000022 3300025945 Bacteria 219036
152 Ga0207679_10182000 3300025945 Unclassified 1739
153 Ga0207651_10205079 3300025960 Bacteria 1583
154 Ga0207712_10373475 3300025961 Bacteria 1191
155 Ga0207668_11300539 3300025972 Unclassified 655
156 Ga0207703_10082107 3300026035 Unclassified 2689
157 Ga0207703_10125286 3300026035 Bacteria 2211
158 Ga0207708_10402384 3300026075 Bacteria 1132
159 Ga0207702_10006705 3300026078 Bacteria 9893
160 Ga0207702_10264305 3300026078 Bacteria 1621
161 Ga0207702_10799943 3300026078 Bacteria 932
162 Ga0207641_10357194 3300026088 Unclassified 1394
163 Ga0207648_10251628 3300026089 Unclassified 1575
164 Ga0207428_10127289 3300027907 Bacteria 1950
165 Ga0268266_10052714 3300028379 Bacteria 3494
166 Ga0268266_10190424 3300028379 Unclassified 1872
167 Ga0265326_10008473 3300028558 Bacteria 3101
168 Ga0265326_10041509 3300028558 Bacteria 1306
169 Ga0265326_10083180 3300028558 Bacteria 905
170 Ga0265326_10091838 3300028558 Bacteria 860
171 Ga0265334_10031909 3300028573 Bacteria 2103
172 Ga0265318_10015864 3300028577 Bacteria 3121
173 Ga0265318_10107486 3300028577 Bacteria 1026
174 Ga0265323_10013915 3300028653 Bacteria 3198
175 Ga0265322_10002230 3300028654 Bacteria 6023
176 Ga0265322_10002561 3300028654 Bacteria 5589
177 Ga0265336_10000834 3300028666 Bacteria 16059
178 Ga0265338_10007808 3300028800 Bacteria 13154
179 Ga0265338_10008670 3300028800 Bacteria 12302
180 Ga0265338_10323991 3300028800 Bacteria 1115
181 Ga0265338_10468685 3300028800 Unclassified 890
182 Ga0265324_10007248 3300029957 Bacteria 4519
183 Ga0265330_10000120 3300031235 Archaea 63594
184 Ga0265330_10108894 3300031235 Bacteria 1184
185 Ga0265330_10374052 3300031235 Bacteria 602
186 Ga0265332_10088531 3300031238 Bacteria 1310
187 Ga0265328_10000070 3300031239 Bacteria 54736
188 Ga0265320_10096247 3300031240 Bacteria 1367
189 Ga0265320_10158751 3300031240 Bacteria 1019
190 Ga0265320_10329145 3300031240 Bacteria 675
191 Ga0265325_10002245 3300031241 Bacteria 13094
192 Ga0265325_10016363 3300031241 Bacteria 4148
193 Ga0265325_10035841 3300031241 Bacteria 2632
194 Ga0265325_10182382 3300031241 Bacteria 977
195 Ga0265340_10106911 3300031247 Bacteria 1296
196 Ga0265340_10123955 3300031247 Bacteria 1187
197 Ga0265339_10004588 3300031249 Bacteria 9404
198 Ga0265339_10007688 3300031249 Bacteria 6936
199 Ga0265339_10030792 3300031249 Bacteria 3036
200 Ga0265339_10220328 3300031249 Bacteria 928
201 Ga0265331_10002466 3300031250 Bacteria 12510
202 Ga0265331_10047206 3300031250 Bacteria 2073
203 Ga0265331_10059809 3300031250 Bacteria 1801
204 Ga0265327_10008070 3300031251 Bacteria 7932
205 Ga0265327_10026102 3300031251 Bacteria 3390
206 Ga0265316_10005418 3300031344 Bacteria 12397
207 Ga0265316_10010540 3300031344 Bacteria 8416
208 Ga0265316_10028640 3300031344 Bacteria 4592
209 Ga0265316_10267416 3300031344 Bacteria 1252
210 Ga0265316_10268758 3300031344 Unclassified 1248
211 Ga0265316_10424097 3300031344 Bacteria 956
212 Ga0265313_10002174 3300031595 Bacteria 17387
213 Ga0265313_10004390 3300031595 Bacteria 10875
214 Ga0265314_10036142 3300031711 Bacteria 3593
215 Ga0265314_10096809 3300031711 Unclassified 1908
216 Ga0265342_10000077 3300031712 Archaea 105309
217 Ga0265342_10007817 3300031712 Bacteria 7770
218 Ga0265342_10013742 3300031712 Bacteria 5409
219 Ga0265342_10083656 3300031712 Bacteria 1839
220 Ga0265342_10141210 3300031712 Bacteria 1343
221 Ga0373926_0046897 3300035083 Bacteria 1551
222 Ga0373926_0204140 3300035083 Bacteria 761
223 Ga0373944_0014604 3300035089 Bacteria 2194
224 Ga0373923_0005760 3300035111 Bacteria 4228
225 Ga0373923_0095535 3300035111 Unclassified 1305
226 Ga0373923_0289405 3300035111 Unclassified 773
227 Ga0373923_0463388 3300035111 Unclassified 615
228 Ga0373923_0464083 3300035111 Unclassified 615
229 Ga0373936_0060000 3300035113 Bacteria 1551
230 Ga0373945_0009648 3300035116 Unclassified 3165
231 Ga0373945_0009912 3300035116 Unclassified 3127
232 Ga0373945_0225638 3300035116 Unclassified 785
233 Ga0373954_0077539 3300035118 Bacteria 1585
234 Ga0373954_0078330 3300035118 Bacteria 1577
235 Ga0373954_0134388 3300035118 Unclassified 1205
236 Ga0373956_0003454 3300035119 Bacteria 6361
237 Ga0373956_0031374 3300035119 Unclassified 2329
238 Ga0373956_0032297 3300035119 Bacteria 2297
239 Ga0373943_0012682 3300035170 Bacteria 3799
240 Ga0373946_0096092 3300035171 Bacteria 1321
241 Ga0373946_0107116 3300035171 Bacteria 1260
242 Ga0373955_0204501 3300035172 Bacteria 1176
243 Ga0373955_0418250 3300035172 Bacteria 815
244 Ga0373955_0544514 3300035172 Unclassified 710
245 Ga0373924_0061685 3300035410 Unclassified 1569
246 Ga0373924_0327067 3300035410 Unclassified 682
247 Ga0373931_0215343 3300035691 Unclassified 1154
248 Ga0373935_0037333 3300035692 Bacteria 3040
249 Ga0373935_0046948 3300035692 Bacteria 2729
250 Ga0373935_0081917 3300035692 Bacteria 2099
251 Ga0373935_0157308 3300035692 Bacteria 1546
252 Ga0373927_0000531 3300035695 Bacteria 28946
253 Ga0373927_0031121 3300035695 Bacteria 3480
254 Ga0373927_0061357 3300035695 Bacteria 2432
255 Ga0373927_0272979 3300035695 Bacteria 1112
256 Ga0373927_0343454 3300035695 Unclassified 983
257 Ga0373933_0048833 3300035724 Bacteria 2521
258 Ga0373933_0064709 3300035724 Bacteria 2213
259 Ga0373933_0197248 3300035724 Unclassified 1287
260 Ga0373933_0710039 3300035724 Unclassified 661
261 Ga0373947_0006667 3300035725 Bacteria 6699
262 Ga0373947_0078047 3300035725 Bacteria 2043
263 Ga0373947_0190049 3300035725 Bacteria 1339
264 Ga0373937_0000803 3300036401 Bacteria 26850
265 Ga0373937_0017555 3300036401 Bacteria 6378
266 Ga0373937_0029798 3300036401 Bacteria 4943
267 Ga0373937_0078354 3300036401 Bacteria 3054
268 Ga0373937_0202371 3300036401 Bacteria 1867
269 Ga0373937_0275408 3300036401 Unclassified 1589
270 Ga0373937_0408706 3300036401 Unclassified 1288
271 Ga0373925_0010890 3300037068 Bacteria 6597
272 Ga0373925_0071820 3300037068 Bacteria 2618
273 Ga0373925_0079430 3300037068 Bacteria 2493
274 Ga0373925_0196040 3300037068 Unclassified 1604
275 Ga0316581_0102560 3300037588 Bacteria 881
276 Ga0436361_0034567 3300039447 Bacteria 27864
277 Ga0439447_000008 3300041407 Bacteria 91339
278 Ga0439453_0053395 3300041408 Unclassified 822
279 Ga0439466_0012249 3300041411 Bacteria 3164
280 Ga0450902_023709 3300042137 Bacteria 1020
281 Ga0453683_0002374 3300044673 Bacteria 14721
282 Ga0453684_0028695 3300044712 Archaea 7928
283 Ga0453684_0058493 3300044712 Archaea 4979
284 Ga0495617_011469 3300046452 Bacteria 3023
285 Ga0495592_0026791 3300046454 Bacteria 4370
286 Ga0495592_0307156 3300046454 Unclassified 1029
287 Ga0495603_0000079 3300046455 Bacteria 43171
288 Ga0495603_0009670 3300046455 Bacteria 5832
289 Ga0495603_0152359 3300046455 Unclassified 1342
290 Ga0495603_0440544 3300046455 Bacteria 746
291 Ga0495590_0001309 3300046457 Bacteria 10817
292 Ga0495591_006244 3300046458 Bacteria 5312
293 Ga0495629_0001160 3300046459 Bacteria 20789
294 Ga0495629_0046341 3300046459 Bacteria 3049
295 Ga0495629_0057351 3300046459 Bacteria 2723
296 Ga0495638_0000088 3300046460 Bacteria 152517
297 Ga0495641_0010464 3300046461 Bacteria 5371
298 Ga0495641_0013908 3300046461 Bacteria 4387
299 Ga0495641_0260296 3300046461 Bacteria 780
300 Ga0495651_0007423 3300046462 Bacteria 8383
301 Ga0495651_0009486 3300046462 Bacteria 7473
302 Ga0495651_0015833 3300046462 Bacteria 5837
303 Ga0495653_0154294 3300046463 Bacteria 1601
304 Ga0495653_0221134 3300046463 Unclassified 1273
305 Ga0495580_0013487 3300046472 Bacteria 6234
306 Ga0495580_0056173 3300046472 Bacteria 2773
307 Ga0495580_0383220 3300046472 Unclassified 949
308 Ga0495582_0004208 3300046473 Bacteria 8093
309 Ga0495582_0086756 3300046473 Unclassified 1742
310 Ga0495582_0130561 3300046473 Bacteria 1419
311 Ga0495582_0409330 3300046473 Bacteria 782
312 Ga0495605_0000313 3300046474 Bacteria 50847
313 Ga0495605_0043295 3300046474 Bacteria 2232
314 Ga0495639_0000001 3300046475 Bacteria 204442
315 Ga0495639_0007964 3300046475 Bacteria 4552
316 Ga0495639_0168221 3300046475 Unclassified 1063
317 Ga0495662_0019513 3300046476 Bacteria 3279
318 Ga0495662_0156298 3300046476 Unclassified 1123
319 Ga0495664_0013914 3300046477 Bacteria 4560
320 Ga0495664_0208562 3300046477 Bacteria 1183
321 Ga0495584_0019640 3300046491 Bacteria 3432
322 Ga0495594_0000150 3300046499 Bacteria 33190
323 Ga0495594_0000174 3300046499 Bacteria 30955
324 Ga0495594_0010204 3300046499 Bacteria 4868
325 Ga0495594_0059043 3300046499 Unclassified 2120
326 Ga0495594_0269411 3300046499 Bacteria 970
327 Ga0495607_0001623 3300046501 Bacteria 19510
328 Ga0495583_0000323 3300046506 Bacteria 75419
329 Ga0495583_0010532 3300046506 Bacteria 5383
330 Ga0495608_0094976 3300046511 Bacteria 1926
331 Ga0495616_0002937 3300046513 Bacteria 11083
332 Ga0495618_0014757 3300046514 Bacteria 4764
333 Ga0495618_0109570 3300046514 Unclassified 1768
334 Ga0495628_0114368 3300046516 Bacteria 2073
335 Ga0495630_0000617 3300046517 Bacteria 25804
336 Ga0495630_0046260 3300046517 Bacteria 3253
337 Ga0495630_0069497 3300046517 Bacteria 2649
338 Ga0495630_0393671 3300046517 Unclassified 1061
339 Ga0495630_1086073 3300046517 Unclassified 607
340 Ga0495632_0006296 3300046519 Bacteria 7663
341 Ga0495643_0048453 3300046522 Bacteria 2296
342 Ga0495644_0000005 3300046523 Bacteria 135313
343 Ga0495666_0000015 3300046526 Bacteria 76311
344 Ga0495666_0016705 3300046526 Bacteria 3653
345 Ga0495666_0022879 3300046526 Bacteria 3093
346 Ga0495666_0084073 3300046526 Unclassified 1504
347 Ga0495652_0029539 3300046529 Plasmid 4815
348 Ga0495652_0168278 3300046529 Bacteria 1694
349 Ga0495654_0000088 3300046530 Bacteria 104763
350 Ga0495654_0042167 3300046530 Bacteria 2266
351 Ga0495665_0115652 3300046531 Bacteria 1405
352 Ga0495665_0176238 3300046531 Bacteria 1112
353 Ga0495640_0024203 3300046533 Bacteria 4418
354 Ga0495640_0040613 3300046533 Bacteria 3257
355 Ga0495640_0157023 3300046533 Unclassified 1460
356 Ga0495640_0197425 3300046533 Bacteria 1276
357 Ga0495586_0059336 3300046535 Bacteria 2079
358 Ga0495587_0015330 3300046536 Bacteria 4788
359 Ga0495587_0015955 3300046536 Bacteria 4677
360 Ga0495587_0262146 3300046536 Unclassified 970
361 Ga0495598_0331314 3300046537 Unclassified 582
362 Ga0495597_0032090 3300046542 Bacteria 2385
363 Ga0495645_0007180 3300046543 Bacteria 7751
364 Ga0495645_0016325 3300046543 Bacteria 5300
365 Ga0495645_0423307 3300046543 Unclassified 845
366 Ga0495622_0000181 3300046557 Bacteria 51031
367 Ga0495622_0001062 3300046557 Bacteria 14570
368 Ga0495622_0168512 3300046557 Bacteria 985
369 Ga0495667_0011175 3300046559 Bacteria 6076
370 Ga0495667_0015396 3300046559 Bacteria 5166
371 Ga0495667_0028473 3300046559 Bacteria 3762
372 Ga0495667_0152101 3300046559 Bacteria 1490
373 Ga0495667_0415472 3300046559 Unclassified 847
374 Ga0495634_0003953 3300046642 Bacteria 11764
375 Ga0495634_0181757 3300046642 Bacteria 1316
376 Ga0495634_0334502 3300046642 Unclassified 909
377 Ga0495611_0001442 3300046648 Bacteria 11820
378 Ga0495635_0001253 3300046663 Bacteria 16996
379 Ga0495635_0029315 3300046663 Bacteria 3826
380 Ga0495635_0116502 3300046663 Bacteria 1823
381 Ga0495659_0000002 3300046664 Bacteria 176698
382 Ga0495661_0369938 3300046665 Bacteria 702
383 Ga0495588_0000930 3300046674 Bacteria 12734
384 Ga0495588_0022417 3300046674 Unclassified 3122
385 Ga0495588_0023662 3300046674 Bacteria 3043
386 Ga0495657_0036967 3300046675 Bacteria 3369
387 Ga0495657_0048335 3300046675 Bacteria 2871
388 Ga0495657_0311966 3300046675 Unclassified 936
389 Ga0495599_0005304 3300046678 Bacteria 7690
390 Ga0495623_0064722 3300046679 Bacteria 2288
391 Ga0495623_0164422 3300046679 Bacteria 1301
392 Ga0495646_0054495 3300046680 Bacteria 2405
393 Ga0495646_0192883 3300046680 Unclassified 1113
394 Ga0495646_0330081 3300046680 Unclassified 802
395 Ga0495647_0010085 3300046681 Bacteria 3214
396 Ga0495658_0004670 3300046683 Bacteria 6737
397 Ga0495658_0012392 3300046683 Bacteria 4316
398 Ga0495658_0198548 3300046683 Bacteria 1249
399 Ga0495658_0695809 3300046683 Unclassified 651
400 Ga0495613_0000263 3300046689 Bacteria 49324
401 Ga0495613_0028330 3300046689 Bacteria 4165
402 Ga0495613_0033972 3300046689 Bacteria 3788
403 Ga0495624_0007255 3300046690 Bacteria 7794
404 Ga0495624_0033107 3300046690 Bacteria 3348
405 Ga0495624_0058641 3300046690 Bacteria 2417
406 Ga0495670_0052837 3300046691 Bacteria 2035
407 Ga0495671_0021457 3300046692 Bacteria 3392
408 Ga0495649_0000060 3300046694 Bacteria 97624
409 Ga0495649_0000330 3300046694 Bacteria 41062
410 Ga0495589_0008956 3300046794 Bacteria 5206
411 Ga0495600_0025345 3300046809 Bacteria 3822
412 Ga0495600_0059015 3300046809 Bacteria 2506
413 Ga0495600_0238432 3300046809 Bacteria 1159
414 Ga0495660_0004514 3300046810 Bacteria 8415
415 Ga0495581_0002397 3300047315 Bacteria 10588
416 Ga0495581_0004725 3300047315 Bacteria 7862
417 Ga0495581_0030632 3300047315 Bacteria 3116
418 Ga0495581_0039866 3300047315 Bacteria 2719
419 Ga0495581_0077905 3300047315 Bacteria 1918
420 Ga0495581_0120998 3300047315 Bacteria 1523
421 Ga0495604_0003775 3300047317 Bacteria 12060
422 Ga0495604_0005654 3300047317 Bacteria 9915
423 Ga0495604_0014044 3300047317 Bacteria 6385
424 Ga0495604_0084819 3300047317 Bacteria 2365
425 Ga0495674_0003342 3300047319 Bacteria 15574
426 Ga0495674_0080357 3300047319 Bacteria 2798
427 Ga0495674_0211736 3300047319 Unclassified 1605
428 Ga0495672_0000639 3300047320 Bacteria 38948
429 Ga0495672_0000812 3300047320 Bacteria 33655
430 Ga0495672_0027421 3300047320 Bacteria 3620
431 Ga0495676_0004991 3300047321 Bacteria 12170
432 Ga0495676_0008113 3300047321 Bacteria 9635
433 Ga0495676_0046308 3300047321 Bacteria 3530
434 Ga0495680_0031012 3300047322 Bacteria 4356
435 Ga0495680_0061202 3300047322 Bacteria 2897
436 Ga0495680_0100885 3300047322 Bacteria 2150
437 Ga0495680_0179584 3300047322 Bacteria 1528
438 Ga0495683_0001032 3300047323 Bacteria 19350
439 Ga0495687_012893 3300047443 Bacteria 4392
440 Ga0495687_040302 3300047443 Bacteria 2059
441 Ga0495675_0011807 3300047444 Bacteria 5487
442 Ga0495675_0156968 3300047444 Bacteria 1403
443 Ga0495677_0105630 3300047445 Bacteria 1068
444 Ga0495684_0011608 3300047471 Bacteria 6801
445 Ga0495684_0062447 3300047471 Bacteria 2834
446 Ga0495684_0134742 3300047471 Unclassified 1854
447 Ga0495684_0276279 3300047471 Unclassified 1214
448 Ga0495593_0000027 3300047673 Bacteria 61044
449 Ga0495593_0004260 3300047673 Bacteria 8510
450 Ga0495593_0034446 3300047673 Bacteria 2754
451 Ga0495593_0062375 3300047673 Bacteria 1948
452 Ga0495593_0263648 3300047673 Unclassified 862
453 Ga0495602_0001002 3300048088 Bacteria 27473
454 Ga0495602_0001754 3300048088 Bacteria 21653
455 Ga0495602_0098309 3300048088 Bacteria 2409
456 Ga0495614_0003495 3300048089 Bacteria 7032
457 Ga0495614_0013887 3300048089 Bacteria 3530
458 Ga0495626_0000031 3300048091 Bacteria 197930
459 Ga0496100_0008393 3300048903 Bacteria 5760
460 Ga0496100_0068248 3300048903 Bacteria 2364
461 Ga0496100_0213528 3300048903 Bacteria 1413
462 Ga0496101_0051221 3300048904 Bacteria 2974
463 Ga0496101_0184560 3300048904 Unclassified 1607
464 Ga0496101_0601091 3300048904 Bacteria 870
465 Ga0496102_0211671 3300048905 Bacteria 1827
466 Ga0496102_0223391 3300048905 Bacteria 1776
467 Ga0496102_0383496 3300048905 Unclassified 1322
468 Ga0496102_0643073 3300048905 Bacteria 984
469 Ga0496103_0019803 3300048906 Bacteria 4039
470 Ga0496104_0001007 3300048907 Bacteria 24144
471 Ga0496104_0006712 3300048907 Bacteria 10131
472 Ga0496104_0007532 3300048907 Bacteria 9625
473 Ga0496104_0095288 3300048907 Bacteria 2847
474 Ga0496104_0263178 3300048907 Unclassified 1637
475 Ga0496105_0004762 3300048908 Bacteria 10245
476 Ga0496105_0028641 3300048908 Bacteria 4555
477 Ga0496105_0048875 3300048908 Bacteria 3492
478 Ga0496105_0086078 3300048908 Bacteria 2597
479 Ga0496105_0104999 3300048908 Bacteria 2332
480 Ga0496105_0600029 3300048908 Unclassified 854
481 Ga0496106_0000863 3300048909 Bacteria 22031
482 Ga0496106_0022280 3300048909 Bacteria 4706
483 Ga0496106_0024081 3300048909 Bacteria 4525
484 Ga0496106_0673752 3300048909 Bacteria 825
485 Ga0496107_0000335 3300048910 Bacteria 25483
486 Ga0496107_0168941 3300048910 Unclassified 1622
487 Ga0496108_0221625 3300048911 Unclassified 1643
488 Ga0496108_0287883 3300048911 Bacteria 1430
489 Ga0496109_0001209 3300048912 Bacteria 21496
490 Ga0496109_0087462 3300048912 Bacteria 2878
491 Ga0496109_0306336 3300048912 Unclassified 1498
492 Ga0496109_0333321 3300048912 Bacteria 1433
493 Ga0496110_0017292 3300048913 Bacteria 6032
494 Ga0496110_0030722 3300048913 Bacteria 4632
495 Ga0496111_0004625 3300048914 Bacteria 8708
496 Ga0496111_0572811 3300048914 Bacteria 828
497 Ga0496112_0004925 3300048915 Bacteria 11427
498 Ga0496112_0009884 3300048915 Bacteria 8625
499 Ga0496112_0103191 3300048915 Bacteria 2821
500 Ga0496112_0151828 3300048915 Bacteria 2283
501 Ga0496113_0009192 3300048916 Bacteria 6481
502 Ga0496113_0012627 3300048916 Bacteria 5684
503 Ga0496113_0169198 3300048916 Bacteria 1730
504 Ga0496114_0001714 3300048917 Bacteria 16643
505 Ga0496114_0164119 3300048917 Bacteria 1933
506 Ga0496114_0302278 3300048917 Bacteria 1413
507 Ga0496115_0028050 3300048918 Bacteria 4409
508 Ga0496115_0230446 3300048918 Unclassified 1527
509 Ga0496116_0000475 3300048919 Bacteria 55484
510 Ga0496117_0067204 3300048920 Bacteria 2427
511 Ga0496118_0049421 3300048921 Bacteria 3239
512 Ga0496119_0050936 3300048922 Bacteria 2548
513 Ga0496119_0140469 3300048922 Bacteria 1305
514 Ga0496120_0072409 3300048923 Bacteria 1888
515 Ga0496121_0065408 3300048924 Bacteria 2958
516 Ga0496121_0135308 3300048924 Bacteria 1837
517 Ga0496122_0064776 3300048925 Bacteria 2656
518 Ga0496124_0000276 3300048927 Bacteria 98406
519 Ga0496125_0000410 3300048928 Bacteria 80395
520 Ga0496125_0084190 3300048928 Bacteria 2416
521 Ga0496126_0000692 3300048929 Bacteria 61735
522 Ga0496126_0007448 3300048929 Bacteria 12000
523 Ga0495678_016249 3300049459 Bacteria 3407
524 Ga0501032_0012180 3300049569 Bacteria 6157
525 Ga0501032_0296831 3300049569 Bacteria 1045
526 Ga0501033_0010195 3300049570 Bacteria 7215
527 Ga0501033_0118071 3300049570 Bacteria 1927
528 Ga0501036_0017682 3300049572 Bacteria 5966
529 Ga0501036_0264466 3300049572 Bacteria 1441
530 Ga0501036_0304055 3300049572 Bacteria 1334
531 Ga0501038_0637537 3300049574 Bacteria 803
532 Ga0501039_0016498 3300049575 Bacteria 5658
533 Ga0501040_0003790 3300049576 Bacteria 9808
534 Ga0501040_0620474 3300049576 Bacteria 781
535 Ga0501040_1025323 3300049576 Unclassified 598
536 Ga0501042_0108705 3300049578 Bacteria 1996
537 Ga0501046_0224960 3300049580 Bacteria 1388
538 Ga0501047_0017651 3300049581 Bacteria 6838
539 Ga0501047_0194507 3300049581 Bacteria 1891
540 Ga0501047_0228860 3300049581 Bacteria 1713
541 Ga0501047_0319747 3300049581 Bacteria 1392
542 Ga0501047_0350695 3300049581 Bacteria 1313
543 Ga0501047_0486066 3300049581 Bacteria 1062
544 Ga0501048_0225958 3300049582 Bacteria 1328
545 Ga0501067_0427701 3300049583 Bacteria 739
546 Ga0501068_0055248 3300049584 Bacteria 2406
547 Ga0501069_0776631 3300049585 Bacteria 580
548 Ga0501071_0404233 3300049587 Bacteria 1043
549 Ga0501071_0707830 3300049587 Bacteria 775
550 Ga0501072_0016230 3300049588 Bacteria 5712
551 Ga0501073_0300131 3300049589 Bacteria 1108
552 Ga0501074_0194631 3300049590 Bacteria 1445
553 Ga0501075_0191370 3300049591 Bacteria 1560
554 Ga0501076_0023267 3300049592 Bacteria 4774
555 Ga0501077_0306069 3300049593 Unclassified 1013
556 Ga0501079_0084490 3300049741 Bacteria 2455
557 Ga0501080_0039237 3300049742 Bacteria 4420
558 Ga0501080_0159783 3300049742 Bacteria 2081
559 Ga0501080_0429600 3300049742 Bacteria 1186
560 Ga0501081_0021144 3300049743 Bacteria 4342
561 Ga0501083_0004796 3300049744 Bacteria 9554
562 Ga0501083_0566618 3300049744 Bacteria 739
563 Ga0501035_0055996 3300049822 Bacteria 3520
564 Ga0501044_0017674 3300049823 Bacteria 7649
565 Ga0501044_0056519 3300049823 Bacteria 4030
566 Ga0501045_0044084 3300049824 Bacteria 3248
567 nmdc:mga06r32_353361_c1 3300050510 Unclassified 1454
568 nmdc:mga08y16_84366_c1 3300050511 Bacteria 3311
569 nmdc:mga0n895_175627_c1 3300050512 Bacteria 2173
570 nmdc:mga0a205_756561_c1 3300050515 Unclassified 820
571 Ga0495601_0000609 3300053077 Bacteria 19047
572 Ga0495601_0016010 3300053077 Bacteria 4537
573 Ga0495612_0006154 3300053078 Bacteria 4937
574 Ga0495612_0027440 3300053078 Bacteria 2289
575 Ga0495595_0010669 3300053084 Bacteria 3825
576 Ga0495595_0058724 3300053084 Bacteria 1797
577 Ga0495595_0161586 3300053084 Bacteria 1105
578 Ga0495619_0001480 3300053085 Bacteria 15482
579 Ga0495619_0018742 3300053085 Bacteria 4393
580 Ga0495619_0037144 3300053085 Bacteria 3173
581 Ga0495619_0284675 3300053085 Bacteria 1145
582 Ga0495619_0416708 3300053085 Unclassified 927
583 Ga0500642_0033395 3300053130 Bacteria 2167
584 Ga0500590_015365 3300053148 Bacteria 3949
585 Ga0500619_001257 3300053154 Unclassified 4432
586 Ga0500552_003183 3300053733 Bacteria 1649
587 Ga0501084_0741928 3300054114 Unclassified 827
588 Ga0501082_0035477 3300060353 Bacteria 4299
589 Ga0530510_0029111 3300061734 Bacteria 3963

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_11300539 Ga0207668_113005392 138
2 3300049574 Ga0501038_0637537 Ga0501038_0637537_230_757 147
3 3300049822 Ga0501035_0055996 Ga0501035_0055996_43_570 147
4 3300028800 Ga0265338_10008670 Ga0265338_100086702 148
5 3300031241 Ga0265325_10002245 Ga0265325_100022454 148
6 3300031595 Ga0265313_10002174 Ga0265313_100021748 148
7 3300049742 Ga0501080_0429600 Ga0501080_0429600_23_613 150
8 3300005340 Ga0070689_100018682 Ga0070689_1000186825 155
9 3300005356 Ga0070674_100137225 Ga0070674_1001372252 155
10 3300005364 Ga0070673_100235622 Ga0070673_1002356222 155
11 3300005365 Ga0070688_100091397 Ga0070688_1000913972 155
12 3300005366 Ga0070659_100526369 Ga0070659_1005263691 155
13 3300005367 Ga0070667_100101487 Ga0070667_1001014872 155
14 3300005438 Ga0070701_10142287 Ga0070701_101422872 155
15 3300005441 Ga0070700_100363390 Ga0070700_1003633902 155
16 3300005456 Ga0070678_100558940 Ga0070678_1005589402 155
17 3300005459 Ga0068867_100128868 Ga0068867_1001288682 155
18 3300005466 Ga0070685_10041721 Ga0070685_100417212 155
19 3300005547 Ga0070693_100153188 Ga0070693_1001531881 155
20 3300005548 Ga0070665_100046791 Ga0070665_1000467912 155
21 3300005549 Ga0070704_100868870 Ga0070704_1008688701 155
22 3300005614 Ga0068856_100460178 Ga0068856_1004601782 155
23 3300005617 Ga0068859_100191916 Ga0068859_1001919162 155
24 3300005841 Ga0068863_100095000 Ga0068863_1000950003 155
25 3300005842 Ga0068858_100458017 Ga0068858_1004580172 155
26 3300006881 Ga0068865_100054968 Ga0068865_1000549682 155
27 3300006931 Ga0097620_100191908 Ga0097620_1001919082 155
28 3300009098 Ga0105245_10314625 Ga0105245_103146252 155
29 3300009101 Ga0105247_10046816 Ga0105247_100468162 155
30 3300009177 Ga0105248_10889058 Ga0105248_108890582 155
31 3300010375 Ga0105239_11446016 Ga0105239_114460161 155
32 3300013297 Ga0157378_10130732 Ga0157378_101307323 155
33 3300013308 Ga0157375_10001815 Ga0157375_100018153 155
34 3300014325 Ga0163163_10148886 Ga0163163_101488863 155
35 3300014326 Ga0157380_10593624 Ga0157380_105936242 155
36 3300014968 Ga0157379_10049322 Ga0157379_100493222 155
37 3300014969 Ga0157376_10012349 Ga0157376_100123492 155
38 3300025903 Ga0207680_10348020 Ga0207680_103480201 155
39 3300025916 Ga0207663_10312466 Ga0207663_103124662 155
40 3300025938 Ga0207704_10173124 Ga0207704_101731242 155
41 3300025941 Ga0207711_10253593 Ga0207711_102535932 155
42 3300025960 Ga0207651_10205079 Ga0207651_102050792 155
43 3300026035 Ga0207703_10125286 Ga0207703_101252862 155
44 3300026075 Ga0207708_10402384 Ga0207708_104023841 155
45 3300026078 Ga0207702_10264305 Ga0207702_102643052 155
46 3300026089 Ga0207648_10251628 Ga0207648_102516282 155
47 3300028379 Ga0268266_10052714 Ga0268266_100527142 155
48 3300046459 Ga0495629_0001160 Ga0495629_0001160_4645_5220 155
49 3300046462 Ga0495651_0009486 Ga0495651_0009486_5525_6100 155
50 3300046473 Ga0495582_0409330 Ga0495582_0409330_63_638 155
51 3300046499 Ga0495594_0269411 Ga0495594_0269411_226_801 155
52 3300046531 Ga0495665_0176238 Ga0495665_0176238_340_915 155
53 3300046533 Ga0495640_0024203 Ga0495640_0024203_751_1326 155
54 3300046559 Ga0495667_0152101 Ga0495667_0152101_90_665 155
55 3300046642 Ga0495634_0181757 Ga0495634_0181757_527_1102 155
56 3300046663 Ga0495635_0001253 Ga0495635_0001253_13951_14526 155
57 3300046675 Ga0495657_0036967 Ga0495657_0036967_232_807 155
58 3300046680 Ga0495646_0054495 Ga0495646_0054495_1642_2217 155
59 3300046689 Ga0495613_0028330 Ga0495613_0028330_2874_3449 155
60 3300046690 Ga0495624_0007255 Ga0495624_0007255_1649_2224 155
61 3300046809 Ga0495600_0238432 Ga0495600_0238432_489_1064 155
62 3300047315 Ga0495581_0077905 Ga0495581_0077905_879_1454 155
63 3300047317 Ga0495604_0005654 Ga0495604_0005654_1072_1647 155
64 3300047321 Ga0495676_0008113 Ga0495676_0008113_3212_3787 155
65 3300047673 Ga0495593_0062375 Ga0495593_0062375_1104_1679 155
66 3300048903 Ga0496100_0008393 Ga0496100_0008393_4830_5408 155
67 3300048904 Ga0496101_0051221 Ga0496101_0051221_1124_1702 155
68 3300048904 Ga0496101_0601091 Ga0496101_0601091_169_744 155
69 3300048905 Ga0496102_0211671 Ga0496102_0211671_425_1003 155
70 3300048905 Ga0496102_0643073 Ga0496102_0643073_173_748 155
71 3300048907 Ga0496104_0001007 Ga0496104_0001007_9651_10226 155
72 3300048907 Ga0496104_0006712 Ga0496104_0006712_8635_9213 155
73 3300048908 Ga0496105_0028641 Ga0496105_0028641_3883_4458 155
74 3300048908 Ga0496105_0104999 Ga0496105_0104999_836_1414 155
75 3300048909 Ga0496106_0000863 Ga0496106_0000863_2529_3107 155
76 3300048909 Ga0496106_0673752 Ga0496106_0673752_222_800 155
77 3300048910 Ga0496107_0000335 Ga0496107_0000335_20691_21269 155
78 3300048911 Ga0496108_0287883 Ga0496108_0287883_322_900 155
79 3300048912 Ga0496109_0087462 Ga0496109_0087462_1198_1776 155
80 3300048912 Ga0496109_0333321 Ga0496109_0333321_538_1116 155
81 3300048915 Ga0496112_0151828 Ga0496112_0151828_643_1221 155
82 3300048916 Ga0496113_0012627 Ga0496113_0012627_2109_2687 155
83 3300048916 Ga0496113_0169198 Ga0496113_0169198_963_1538 155
84 3300048917 Ga0496114_0001714 Ga0496114_0001714_8379_8957 155
85 3300048917 Ga0496114_0302278 Ga0496114_0302278_708_1283 155
86 3300048918 Ga0496115_0028050 Ga0496115_0028050_2061_2639 155
87 3300048921 Ga0496118_0049421 Ga0496118_0049421_2621_3196 155
88 3300048922 Ga0496119_0050936 Ga0496119_0050936_601_1176 155
89 3300048923 Ga0496120_0072409 Ga0496120_0072409_1110_1685 155
90 3300048924 Ga0496121_0135308 Ga0496121_0135308_847_1422 155
91 3300048928 Ga0496125_0084190 Ga0496125_0084190_1100_1675 155
92 3300048929 Ga0496126_0007448 Ga0496126_0007448_5195_5770 155
93 3300053085 Ga0495619_0037144 Ga0495619_0037144_1836_2411 155
94 3300053733 Ga0500552_003183 Ga0500552_003183_691_1266 155
95 3300049569 Ga0501032_0012180 Ga0501032_0012180_1378_2058 156
96 3300046461 Ga0495641_0260296 Ga0495641_0260296_38_535 165
97 3300035111 Ga0373923_0464083 Ga0373923_0464083_13_546 173
98 3300049585 Ga0501069_0776631 Ga0501069_0776631_17_538 173
99 3300049587 Ga0501071_0707830 Ga0501071_0707830_14_553 173
100 3300049744 Ga0501083_0566618 Ga0501083_0566618_14_553 173
101 3300028577 Ga0265318_10015864 Ga0265318_100158642 174
102 3300028666 Ga0265336_10000834 Ga0265336_1000083416 174
103 3300048088 Ga0495602_0098309 Ga0495602_0098309_1304_1846 175
104 3300009011 Ga0105251_10003826 Ga0105251_1000382610 178
105 iso_pu_bacteria 2929297113 2929298066 178
106 iso_pu_bacteria 2599185354 2600202735 181
107 iso_pu_bacteria 2849076700 2849081355 181
108 3300031240 Ga0265320_10329145 Ga0265320_103291451 182
109 3300031344 Ga0265316_10028640 Ga0265316_100286405 182
110 3300044673 Ga0453683_0002374 Ga0453683_0002374_12923_13486 182
111 iso_pu_bacteria 2619619299 2621299688 182
112 iso_pu_bacteria 2623620446 2624491291 182
113 iso_pu_bacteria 2738541265 2738669688 182
114 iso_pu_bacteria 2738541282 2738748081 182
115 iso_pu_bacteria 2738541303 2738857123 182
116 iso_pu_bacteria 2808606377 2808929668 182
117 iso_pu_bacteria 2808606381 2808951753 182
118 iso_pu_bacteria 2808606382 2808958560 182
119 iso_pu_bacteria 2816332298 2817491040 182
120 iso_pu_bacteria 2883354860 2883357989 182
121 iso_pu_bacteria 2919456309 2919460743 182
122 iso_pu_bacteria 2919697872 2919701203 182
123 iso_pu_bacteria 8019775933 8019778189 182
124 3300009545 Ga0105237_10594786 Ga0105237_105947861 183
125 3300025914 Ga0207671_10383044 Ga0207671_103830442 183
126 3300031240 Ga0265320_10158751 Ga0265320_101587512 183
127 3300031251 Ga0265327_10008070 Ga0265327_100080703 183
128 3300003762 Ga0055542_1000115 Ga0055542_100011515 184
129 3300003763 Ga0055529_1000052 Ga0055529_1000052168 184
130 3300009093 Ga0105240_10007067 Ga0105240_100070677 184
131 3300025254 Ga0209148_1000011 Ga0209148_1000011379 184
132 3300025272 Ga0209455_1000006 Ga0209455_1000006815 184
133 3300025913 Ga0207695_10026021 Ga0207695_100260217 184
134 3300031247 Ga0265340_10123955 Ga0265340_101239552 184
135 3300031249 Ga0265339_10004588 Ga0265339_1000458812 184
136 3300049581 Ga0501047_0194507 Ga0501047_0194507_248_802 184
137 3300053154 Ga0500619_001257 Ga0500619_001257_3624_4178 184
138 3300003323 rootH1_10340779 rootH1_103407792 185
139 3300005327 Ga0070658_10091916 Ga0070658_100919165 185
140 3300005344 Ga0070661_100000062 Ga0070661_10000006242 185
141 3300005434 Ga0070709_10045336 Ga0070709_100453362 185
142 3300005439 Ga0070711_100142083 Ga0070711_1001420832 185
143 3300005564 Ga0070664_100000035 Ga0070664_10000003543 185
144 3300006175 Ga0070712_100284842 Ga0070712_1002848421 185
145 3300009036 Ga0105244_10000616 Ga0105244_1000061610 185
146 3300009176 Ga0105242_10000647 Ga0105242_1000064719 185
147 3300009545 Ga0105237_10000042 Ga0105237_1000004235 185
148 3300011119 Ga0105246_10020064 Ga0105246_100200641 185
149 3300013100 Ga0157373_10017195 Ga0157373_100171952 185
150 3300013105 Ga0157369_10000251 Ga0157369_1000025147 185
151 3300013308 Ga0157375_10001383 Ga0157375_1000138315 185
152 3300025728 Ga0207655_1000070 Ga0207655_1000070110 185
153 3300025906 Ga0207699_10054812 Ga0207699_100548121 185
154 3300025914 Ga0207671_10002005 Ga0207671_1000200520 185
155 3300025915 Ga0207693_10115942 Ga0207693_101159423 185
156 3300025916 Ga0207663_10093522 Ga0207663_100935222 185
157 3300025916 Ga0207663_10362537 Ga0207663_103625372 185
158 3300025920 Ga0207649_10000010 Ga0207649_10000010129 185
159 3300025928 Ga0207700_10356204 Ga0207700_103562042 185
160 3300025929 Ga0207664_10319872 Ga0207664_103198722 185
161 3300025934 Ga0207686_10051753 Ga0207686_100517532 185
162 3300025945 Ga0207679_10000022 Ga0207679_1000002245 185
163 3300031235 Ga0265330_10000120 Ga0265330_1000012028 185
164 3300031235 Ga0265330_10108894 Ga0265330_101088941 185
165 3300031238 Ga0265332_10088531 Ga0265332_100885312 185
166 3300031249 Ga0265339_10007688 Ga0265339_100076882 185
167 3300031344 Ga0265316_10005418 Ga0265316_1000541814 185
168 3300031344 Ga0265316_10268758 Ga0265316_102687582 185
169 3300031712 Ga0265342_10000077 Ga0265342_1000007724 185
170 3300031712 Ga0265342_10141210 Ga0265342_101412101 185
171 3300035083 Ga0373926_0046897 Ga0373926_0046897_314_871 185
172 3300035083 Ga0373926_0204140 Ga0373926_0204140_121_681 185
173 3300035089 Ga0373944_0014604 Ga0373944_0014604_957_1514 185
174 3300035111 Ga0373923_0005760 Ga0373923_0005760_443_1000 185
175 3300035113 Ga0373936_0060000 Ga0373936_0060000_718_1275 185
176 3300035116 Ga0373945_0009912 Ga0373945_0009912_2318_2875 185
177 3300035118 Ga0373954_0077539 Ga0373954_0077539_882_1439 185
178 3300035118 Ga0373954_0078330 Ga0373954_0078330_752_1309 185
179 3300035119 Ga0373956_0031374 Ga0373956_0031374_1047_1631 185
180 3300035119 Ga0373956_0032297 Ga0373956_0032297_179_736 185
181 3300035171 Ga0373946_0096092 Ga0373946_0096092_644_1201 185
182 3300035171 Ga0373946_0107116 Ga0373946_0107116_334_891 185
183 3300035172 Ga0373955_0204501 Ga0373955_0204501_226_783 185
184 3300035172 Ga0373955_0418250 Ga0373955_0418250_178_738 185
185 3300035172 Ga0373955_0544514 Ga0373955_0544514_96_665 185
186 3300035410 Ga0373924_0061685 Ga0373924_0061685_54_611 185
187 3300035410 Ga0373924_0327067 Ga0373924_0327067_31_600 185
188 3300035692 Ga0373935_0081917 Ga0373935_0081917_64_624 185
189 3300035692 Ga0373935_0157308 Ga0373935_0157308_344_901 185
190 3300035695 Ga0373927_0000531 Ga0373927_0000531_18545_19102 185
191 3300035695 Ga0373927_0031121 Ga0373927_0031121_1845_2405 185
192 3300035695 Ga0373927_0343454 Ga0373927_0343454_326_883 185
193 3300035724 Ga0373933_0048833 Ga0373933_0048833_1835_2392 185
194 3300035724 Ga0373933_0064709 Ga0373933_0064709_602_1162 185
195 3300035725 Ga0373947_0006667 Ga0373947_0006667_3642_4202 185
196 3300035725 Ga0373947_0190049 Ga0373947_0190049_40_597 185
197 3300036401 Ga0373937_0017555 Ga0373937_0017555_4082_4639 185
198 3300036401 Ga0373937_0029798 Ga0373937_0029798_1051_1635 185
199 3300036401 Ga0373937_0078354 Ga0373937_0078354_2078_2635 185
200 3300036401 Ga0373937_0275408 Ga0373937_0275408_498_1067 185
201 3300037068 Ga0373925_0010890 Ga0373925_0010890_4332_4892 185
202 3300037068 Ga0373925_0079430 Ga0373925_0079430_154_717 185
203 3300037588 Ga0316581_0102560 Ga0316581_0102560_207_782 185
204 3300044712 Ga0453684_0028695 Ga0453684_0028695_6562_7167 185
205 3300044712 Ga0453684_0058493 Ga0453684_0058493_1299_1904 185
206 3300046454 Ga0495592_0026791 Ga0495592_0026791_3738_4295 185
207 3300046455 Ga0495603_0000079 Ga0495603_0000079_9950_10510 185
208 3300046455 Ga0495603_0152359 Ga0495603_0152359_199_756 185
209 3300046459 Ga0495629_0046341 Ga0495629_0046341_65_625 185
210 3300046459 Ga0495629_0057351 Ga0495629_0057351_1120_1677 185
211 3300046461 Ga0495641_0010464 Ga0495641_0010464_3387_3947 185
212 3300046462 Ga0495651_0015833 Ga0495651_0015833_2297_2854 185
213 3300046463 Ga0495653_0154294 Ga0495653_0154294_364_921 185
214 3300046472 Ga0495580_0013487 Ga0495580_0013487_5531_6091 185
215 3300046472 Ga0495580_0383220 Ga0495580_0383220_370_927 185
216 3300046473 Ga0495582_0004208 Ga0495582_0004208_3900_4460 185
217 3300046473 Ga0495582_0130561 Ga0495582_0130561_785_1342 185
218 3300046475 Ga0495639_0007964 Ga0495639_0007964_3802_4362 185
219 3300046475 Ga0495639_0168221 Ga0495639_0168221_116_673 185
220 3300046476 Ga0495662_0019513 Ga0495662_0019513_350_907 185
221 3300046477 Ga0495664_0013914 Ga0495664_0013914_1435_2019 185
222 3300046477 Ga0495664_0208562 Ga0495664_0208562_508_1065 185
223 3300046499 Ga0495594_0000174 Ga0495594_0000174_8087_8647 185
224 3300046499 Ga0495594_0059043 Ga0495594_0059043_416_973 185
225 3300046511 Ga0495608_0094976 Ga0495608_0094976_297_881 185
226 3300046514 Ga0495618_0014757 Ga0495618_0014757_1481_2038 185
227 3300046514 Ga0495618_0109570 Ga0495618_0109570_1104_1673 185
228 3300046516 Ga0495628_0114368 Ga0495628_0114368_73_630 185
229 3300046517 Ga0495630_0046260 Ga0495630_0046260_1756_2313 185
230 3300046517 Ga0495630_0069497 Ga0495630_0069497_1184_1741 185
231 3300046526 Ga0495666_0016705 Ga0495666_0016705_1887_2444 185
232 3300046526 Ga0495666_0022879 Ga0495666_0022879_196_756 185
233 3300046529 Ga0495652_0029539 Ga0495652_0029539_1157_1714 185
234 3300046531 Ga0495665_0115652 Ga0495665_0115652_32_589 185
235 3300046533 Ga0495640_0040613 Ga0495640_0040613_1922_2479 185
236 3300046533 Ga0495640_0157023 Ga0495640_0157023_169_753 185
237 3300046533 Ga0495640_0197425 Ga0495640_0197425_371_928 185
238 3300046535 Ga0495586_0059336 Ga0495586_0059336_1047_1604 185
239 3300046536 Ga0495587_0015330 Ga0495587_0015330_2851_3435 185
240 3300046536 Ga0495587_0262146 Ga0495587_0262146_156_713 185
241 3300046537 Ga0495598_0331314 Ga0495598_0331314_11_568 185
242 3300046543 Ga0495645_0007180 Ga0495645_0007180_543_1127 185
243 3300046543 Ga0495645_0423307 Ga0495645_0423307_226_783 185
244 3300046557 Ga0495622_0001062 Ga0495622_0001062_5231_5791 185
245 3300046557 Ga0495622_0168512 Ga0495622_0168512_226_783 185
246 3300046559 Ga0495667_0011175 Ga0495667_0011175_3587_4144 185
247 3300046559 Ga0495667_0015396 Ga0495667_0015396_1539_2123 185
248 3300046559 Ga0495667_0415472 Ga0495667_0415472_34_600 185
249 3300046642 Ga0495634_0003953 Ga0495634_0003953_10911_11471 185
250 3300046642 Ga0495634_0334502 Ga0495634_0334502_313_870 185
251 3300046663 Ga0495635_0029315 Ga0495635_0029315_1072_1656 185
252 3300046663 Ga0495635_0116502 Ga0495635_0116502_516_1073 185
253 3300046674 Ga0495588_0000930 Ga0495588_0000930_11836_12396 185
254 3300046674 Ga0495588_0023662 Ga0495588_0023662_299_856 185
255 3300046675 Ga0495657_0048335 Ga0495657_0048335_1275_1859 185
256 3300046675 Ga0495657_0311966 Ga0495657_0311966_153_710 185
257 3300046680 Ga0495646_0330081 Ga0495646_0330081_35_592 185
258 3300046683 Ga0495658_0004670 Ga0495658_0004670_4017_4577 185
259 3300046683 Ga0495658_0198548 Ga0495658_0198548_12_569 185
260 3300046683 Ga0495658_0695809 Ga0495658_0695809_31_588 185
261 3300046689 Ga0495613_0000263 Ga0495613_0000263_9133_9693 185
262 3300046689 Ga0495613_0033972 Ga0495613_0033972_17_574 185
263 3300046690 Ga0495624_0058641 Ga0495624_0058641_81_641 185
264 3300046691 Ga0495670_0052837 Ga0495670_0052837_1332_1889 185
265 3300046809 Ga0495600_0059015 Ga0495600_0059015_109_666 185
266 3300047315 Ga0495581_0004725 Ga0495581_0004725_3923_4483 185
267 3300047315 Ga0495581_0030632 Ga0495581_0030632_891_1448 185
268 3300047317 Ga0495604_0014044 Ga0495604_0014044_3374_3958 185
269 3300047319 Ga0495674_0003342 Ga0495674_0003342_1137_1694 185
270 3300047321 Ga0495676_0004991 Ga0495676_0004991_1760_2320 185
271 3300047322 Ga0495680_0031012 Ga0495680_0031012_259_819 185
272 3300047322 Ga0495680_0061202 Ga0495680_0061202_2110_2694 185
273 3300047322 Ga0495680_0100885 Ga0495680_0100885_772_1329 185
274 3300047444 Ga0495675_0156968 Ga0495675_0156968_793_1350 185
275 3300047471 Ga0495684_0134742 Ga0495684_0134742_884_1468 185
276 3300047673 Ga0495593_0004260 Ga0495593_0004260_2371_2931 185
277 3300048088 Ga0495602_0001754 Ga0495602_0001754_19791_20375 185
278 3300048089 Ga0495614_0003495 Ga0495614_0003495_3848_4408 185
279 3300048089 Ga0495614_0013887 Ga0495614_0013887_268_825 185
280 3300048903 Ga0496100_0213528 Ga0496100_0213528_463_1032 185
281 3300048905 Ga0496102_0223391 Ga0496102_0223391_1174_1761 185
282 3300048907 Ga0496104_0095288 Ga0496104_0095288_48_617 185
283 3300048907 Ga0496104_0263178 Ga0496104_0263178_930_1517 185
284 3300048908 Ga0496105_0086078 Ga0496105_0086078_80_649 185
285 3300048908 Ga0496105_0600029 Ga0496105_0600029_189_776 185
286 3300048912 Ga0496109_0306336 Ga0496109_0306336_573_1160 185
287 3300048915 Ga0496112_0009884 Ga0496112_0009884_3463_4050 185
288 3300048915 Ga0496112_0103191 Ga0496112_0103191_813_1382 185
289 3300048928 Ga0496125_0000410 Ga0496125_0000410_47841_48398 185
290 3300049569 Ga0501032_0296831 Ga0501032_0296831_166_723 185
291 3300049570 Ga0501033_0118071 Ga0501033_0118071_1221_1796 185
292 3300049572 Ga0501036_0017682 Ga0501036_0017682_4203_4778 185
293 3300049572 Ga0501036_0264466 Ga0501036_0264466_42_617 185
294 3300049575 Ga0501039_0016498 Ga0501039_0016498_2535_3110 185
295 3300049576 Ga0501040_0003790 Ga0501040_0003790_2091_2666 185
296 3300049576 Ga0501040_0620474 Ga0501040_0620474_111_686 185
297 3300049576 Ga0501040_1025323 Ga0501040_1025323_11_586 185
298 3300049578 Ga0501042_0108705 Ga0501042_0108705_394_969 185
299 3300049580 Ga0501046_0224960 Ga0501046_0224960_429_1004 185
300 3300049581 Ga0501047_0228860 Ga0501047_0228860_931_1488 185
301 3300049582 Ga0501048_0225958 Ga0501048_0225958_390_965 185
302 3300049584 Ga0501068_0055248 Ga0501068_0055248_393_968 185
303 3300049587 Ga0501071_0404233 Ga0501071_0404233_447_1022 185
304 3300049588 Ga0501072_0016230 Ga0501072_0016230_788_1363 185
305 3300049590 Ga0501074_0194631 Ga0501074_0194631_18_593 185
306 3300049591 Ga0501075_0191370 Ga0501075_0191370_94_669 185
307 3300049592 Ga0501076_0023267 Ga0501076_0023267_2150_2725 185
308 3300049593 Ga0501077_0306069 Ga0501077_0306069_24_677 185
309 3300049741 Ga0501079_0084490 Ga0501079_0084490_273_848 185
310 3300049743 Ga0501081_0021144 Ga0501081_0021144_3171_3746 185
311 3300049823 Ga0501044_0056519 Ga0501044_0056519_537_1094 185
312 3300049824 Ga0501045_0044084 Ga0501045_0044084_538_1113 185
313 3300053077 Ga0495601_0000609 Ga0495601_0000609_17499_18083 185
314 3300053078 Ga0495612_0006154 Ga0495612_0006154_1875_2432 185
315 3300053084 Ga0495595_0010669 Ga0495595_0010669_822_1406 185
316 3300053084 Ga0495595_0161586 Ga0495595_0161586_267_827 185
317 3300053085 Ga0495619_0001480 Ga0495619_0001480_11304_11864 185
318 3300053085 Ga0495619_0018742 Ga0495619_0018742_2859_3416 185
319 3300053085 Ga0495619_0416708 Ga0495619_0416708_241_798 185
320 3300053130 Ga0500642_0033395 Ga0500642_0033395_886_1458 185
321 3300054114 Ga0501084_0741928 Ga0501084_0741928_147_722 185
322 3300060353 Ga0501082_0035477 Ga0501082_0035477_2163_2738 185
323 iso_pu_bacteria 2816332527 2818242774 185
324 2124908027 MRS2a_Contig_6575 MRS2a_00447770 186
325 3300002459 JGI24751J29686_10026929 JGI24751J29686_100269292 186
326 3300002737 JGI25162J39368_1000078 JGI25162J39368_100007834 186
327 3300002771 JGI25163J39215_1000029 JGI25163J39215_100002928 186
328 3300002772 JGI25164J39214_1000096 JGI25164J39214_100009634 186
329 3300003214 JGI25165J46597_1000143 JGI25165J46597_100014371 186
330 3300003322 rootL2_10369569 rootL2_103695692 186
331 3300005288 Ga0065714_10064625 Ga0065714_1006462510 186
332 3300005289 Ga0065704_10226886 Ga0065704_102268862 186
333 3300005329 Ga0070683_100160618 Ga0070683_1001606182 186
334 3300005331 Ga0070670_100073247 Ga0070670_1000732473 186
335 3300005336 Ga0070680_100552870 Ga0070680_1005528701 186
336 3300005339 Ga0070660_100075444 Ga0070660_1000754442 186
337 3300005341 Ga0070691_10257571 Ga0070691_102575711 186
338 3300005343 Ga0070687_100124154 Ga0070687_1001241542 186
339 3300005355 Ga0070671_100157136 Ga0070671_1001571361 186
340 3300005365 Ga0070688_100157443 Ga0070688_1001574431 186
341 3300005434 Ga0070709_10536874 Ga0070709_105368742 186
342 3300005436 Ga0070713_100507964 Ga0070713_1005079642 186
343 3300005458 Ga0070681_10052286 Ga0070681_100522862 186
344 3300005535 Ga0070684_100036883 Ga0070684_1000368832 186
345 3300005548 Ga0070665_100013279 Ga0070665_1000132798 186
346 3300005564 Ga0070664_100083995 Ga0070664_1000839952 186
347 3300005614 Ga0068856_100010943 Ga0068856_1000109435 186
348 3300005614 Ga0068856_101386997 Ga0068856_1013869971 186
349 3300005841 Ga0068863_100526232 Ga0068863_1005262322 186
350 3300005842 Ga0068858_100218238 Ga0068858_1002182382 186
351 3300006175 Ga0070712_100133706 Ga0070712_1001337064 186
352 3300006237 Ga0097621_100000035 Ga0097621_10000003536 186
353 3300006358 Ga0068871_100000384 Ga0068871_10000038427 186
354 3300006847 Ga0075431_100075386 Ga0075431_1000753863 186
355 3300006852 Ga0075433_10282507 Ga0075433_102825072 186
356 3300006871 Ga0075434_100005391 Ga0075434_1000053913 186
357 3300009011 Ga0105251_10014136 Ga0105251_100141362 186
358 3300009036 Ga0105244_10000614 Ga0105244_1000061415 186
359 3300009036 Ga0105244_10100058 Ga0105244_101000582 186
360 3300009094 Ga0111539_10291521 Ga0111539_102915212 186
361 3300009101 Ga0105247_10056610 Ga0105247_100566102 186
362 3300009147 Ga0114129_10023918 Ga0114129_100239183 186
363 3300009148 Ga0105243_10000026 Ga0105243_1000002619 186
364 3300009174 Ga0105241_10017871 Ga0105241_100178713 186
365 3300009551 Ga0105238_10119210 Ga0105238_101192102 186
366 3300009553 Ga0105249_10322986 Ga0105249_103229862 186
367 3300010375 Ga0105239_10239757 Ga0105239_102397572 186
368 3300010375 Ga0105239_10337814 Ga0105239_103378143 186
369 3300011119 Ga0105246_10000110 Ga0105246_1000011012 186
370 3300011119 Ga0105246_10105910 Ga0105246_101059103 186
371 3300013102 Ga0157371_10004131 Ga0157371_100041314 186
372 3300013104 Ga0157370_10008032 Ga0157370_100080323 186
373 3300013104 Ga0157370_10697422 Ga0157370_106974222 186
374 3300013105 Ga0157369_10000191 Ga0157369_1000019125 186
375 3300013306 Ga0163162_10051590 Ga0163162_100515904 186
376 3300013308 Ga0157375_10503258 Ga0157375_105032582 186
377 3300014325 Ga0163163_10001080 Ga0163163_1000108020 186
378 3300014497 Ga0182008_10015393 Ga0182008_100153932 186
379 3300014497 Ga0182008_10122449 Ga0182008_101224492 186
380 3300015261 Ga0182006_1000083 Ga0182006_100008397 186
381 3300015262 Ga0182007_10000086 Ga0182007_1000008627 186
382 3300015262 Ga0182007_10008020 Ga0182007_100080202 186
383 3300015265 Ga0182005_1001544 Ga0182005_10015447 186
384 3300015265 Ga0182005_1043938 Ga0182005_10439382 186
385 3300015265 Ga0182005_1073372 Ga0182005_10733722 186
386 3300021361 Ga0213872_10000876 Ga0213872_1000087617 186
387 3300025207 Ga0209760_100049 Ga0209760_10004944 186
388 3300025231 Ga0207427_100048 Ga0207427_100048158 186
389 3300025233 Ga0209437_100094 Ga0209437_100094158 186
390 3300025261 Ga0209233_1000106 Ga0209233_100010699 186
391 3300025728 Ga0207655_1000076 Ga0207655_100007640 186
392 3300025728 Ga0207655_1006677 Ga0207655_10066778 186
393 3300025735 Ga0207713_1026120 Ga0207713_10261202 186
394 3300025911 Ga0207654_10059217 Ga0207654_100592172 186
395 3300025912 Ga0207707_10158905 Ga0207707_101589053 186
396 3300025913 Ga0207695_10305816 Ga0207695_103058162 186
397 3300025914 Ga0207671_10009256 Ga0207671_100092563 186
398 3300025915 Ga0207693_10083921 Ga0207693_100839211 186
399 3300025917 Ga0207660_10280729 Ga0207660_102807292 186
400 3300025918 Ga0207662_10208690 Ga0207662_102086902 186
401 3300025919 Ga0207657_10007517 Ga0207657_1000751713 186
402 3300025921 Ga0207652_10106114 Ga0207652_101061143 186
403 3300025924 Ga0207694_10004306 Ga0207694_100043065 186
404 3300025925 Ga0207650_10058174 Ga0207650_100581743 186
405 3300025928 Ga0207700_10062989 Ga0207700_100629892 186
406 3300025935 Ga0207709_10000004 Ga0207709_10000004155 186
407 3300025945 Ga0207679_10182000 Ga0207679_101820002 186
408 3300025961 Ga0207712_10373475 Ga0207712_103734752 186
409 3300026035 Ga0207703_10082107 Ga0207703_100821072 186
410 3300026078 Ga0207702_10006705 Ga0207702_1000670511 186
411 3300026078 Ga0207702_10799943 Ga0207702_107999432 186
412 3300026088 Ga0207641_10357194 Ga0207641_103571942 186
413 3300027907 Ga0207428_10127289 Ga0207428_101272892 186
414 3300028379 Ga0268266_10190424 Ga0268266_101904243 186
415 3300028558 Ga0265326_10008473 Ga0265326_100084732 186
416 3300028558 Ga0265326_10041509 Ga0265326_100415091 186
417 3300028558 Ga0265326_10083180 Ga0265326_100831802 186
418 3300028558 Ga0265326_10091838 Ga0265326_100918381 186
419 3300028573 Ga0265334_10031909 Ga0265334_100319092 186
420 3300028577 Ga0265318_10107486 Ga0265318_101074861 186
421 3300028653 Ga0265323_10013915 Ga0265323_100139155 186
422 3300028654 Ga0265322_10002230 Ga0265322_100022307 186
423 3300028654 Ga0265322_10002561 Ga0265322_100025613 186
424 3300028800 Ga0265338_10007808 Ga0265338_1000780818 186
425 3300028800 Ga0265338_10323991 Ga0265338_103239912 186
426 3300028800 Ga0265338_10468685 Ga0265338_104686851 186
427 3300029957 Ga0265324_10007248 Ga0265324_100072485 186
428 3300031235 Ga0265330_10374052 Ga0265330_103740521 186
429 3300031239 Ga0265328_10000070 Ga0265328_1000007054 186
430 3300031240 Ga0265320_10096247 Ga0265320_100962472 186
431 3300031241 Ga0265325_10016363 Ga0265325_100163633 186
432 3300031241 Ga0265325_10035841 Ga0265325_100358411 186
433 3300031241 Ga0265325_10182382 Ga0265325_101823821 186
434 3300031247 Ga0265340_10106911 Ga0265340_101069112 186
435 3300031249 Ga0265339_10030792 Ga0265339_100307922 186
436 3300031249 Ga0265339_10220328 Ga0265339_102203281 186
437 3300031250 Ga0265331_10002466 Ga0265331_100024664 186
438 3300031250 Ga0265331_10047206 Ga0265331_100472063 186
439 3300031250 Ga0265331_10059809 Ga0265331_100598091 186
440 3300031251 Ga0265327_10026102 Ga0265327_100261021 186
441 3300031344 Ga0265316_10010540 Ga0265316_100105405 186
442 3300031344 Ga0265316_10267416 Ga0265316_102674162 186
443 3300031344 Ga0265316_10424097 Ga0265316_104240971 186
444 3300031595 Ga0265313_10004390 Ga0265313_100043902 186
445 3300031711 Ga0265314_10036142 Ga0265314_100361424 186
446 3300031711 Ga0265314_10096809 Ga0265314_100968091 186
447 3300031712 Ga0265342_10007817 Ga0265342_100078172 186
448 3300031712 Ga0265342_10013742 Ga0265342_100137422 186
449 3300031712 Ga0265342_10083656 Ga0265342_100836562 186
450 3300035111 Ga0373923_0095535 Ga0373923_0095535_193_753 186
451 3300035111 Ga0373923_0289405 Ga0373923_0289405_95_655 186
452 3300035111 Ga0373923_0463388 Ga0373923_0463388_12_572 186
453 3300035116 Ga0373945_0009648 Ga0373945_0009648_1583_2143 186
454 3300035116 Ga0373945_0225638 Ga0373945_0225638_156_719 186
455 3300035118 Ga0373954_0134388 Ga0373954_0134388_310_897 186
456 3300035119 Ga0373956_0003454 Ga0373956_0003454_5613_6200 186
457 3300035170 Ga0373943_0012682 Ga0373943_0012682_860_1420 186
458 3300035691 Ga0373931_0215343 Ga0373931_0215343_88_648 186
459 3300035692 Ga0373935_0037333 Ga0373935_0037333_581_1141 186
460 3300035692 Ga0373935_0046948 Ga0373935_0046948_1584_2144 186
461 3300035695 Ga0373927_0061357 Ga0373927_0061357_1313_1873 186
462 3300035695 Ga0373927_0272979 Ga0373927_0272979_248_808 186
463 3300035724 Ga0373933_0197248 Ga0373933_0197248_173_760 186
464 3300035724 Ga0373933_0710039 Ga0373933_0710039_26_586 186
465 3300035725 Ga0373947_0078047 Ga0373947_0078047_1196_1756 186
466 3300036401 Ga0373937_0000803 Ga0373937_0000803_444_1031 186
467 3300036401 Ga0373937_0202371 Ga0373937_0202371_288_848 186
468 3300036401 Ga0373937_0408706 Ga0373937_0408706_297_857 186
469 3300037068 Ga0373925_0071820 Ga0373925_0071820_1034_1594 186
470 3300037068 Ga0373925_0196040 Ga0373925_0196040_241_801 186
471 3300039447 Ga0436361_0034567 Ga0436361_0034567_13959_14528 186
472 3300041407 Ga0439447_000008 Ga0439447_000008_73863_74423 186
473 3300041408 Ga0439453_0053395 Ga0439453_0053395_72_752 186
474 3300041411 Ga0439466_0012249 Ga0439466_0012249_269_829 186
475 3300042137 Ga0450902_023709 Ga0450902_023709_176_736 186
476 3300046452 Ga0495617_011469 Ga0495617_011469_304_864 186
477 3300046454 Ga0495592_0307156 Ga0495592_0307156_290_850 186
478 3300046455 Ga0495603_0009670 Ga0495603_0009670_1444_2004 186
479 3300046455 Ga0495603_0440544 Ga0495603_0440544_52_612 186
480 3300046457 Ga0495590_0001309 Ga0495590_0001309_2133_2693 186
481 3300046458 Ga0495591_006244 Ga0495591_006244_1692_2252 186
482 3300046460 Ga0495638_0000088 Ga0495638_0000088_37084_37644 186
483 3300046461 Ga0495641_0013908 Ga0495641_0013908_2648_3208 186
484 3300046462 Ga0495651_0007423 Ga0495651_0007423_3065_3652 186
485 3300046463 Ga0495653_0221134 Ga0495653_0221134_429_989 186
486 3300046472 Ga0495580_0056173 Ga0495580_0056173_603_1163 186
487 3300046473 Ga0495582_0086756 Ga0495582_0086756_151_711 186
488 3300046474 Ga0495605_0000313 Ga0495605_0000313_10165_10725 186
489 3300046474 Ga0495605_0043295 Ga0495605_0043295_1595_2155 186
490 3300046475 Ga0495639_0000001 Ga0495639_0000001_156972_157532 186
491 3300046476 Ga0495662_0156298 Ga0495662_0156298_225_785 186
492 3300046491 Ga0495584_0019640 Ga0495584_0019640_1948_2508 186
493 3300046499 Ga0495594_0000150 Ga0495594_0000150_24936_25496 186
494 3300046499 Ga0495594_0010204 Ga0495594_0010204_3048_3608 186
495 3300046501 Ga0495607_0001623 Ga0495607_0001623_17195_17755 186
496 3300046506 Ga0495583_0000323 Ga0495583_0000323_66651_67211 186
497 3300046506 Ga0495583_0010532 Ga0495583_0010532_3917_4477 186
498 3300046513 Ga0495616_0002937 Ga0495616_0002937_8788_9348 186
499 3300046517 Ga0495630_0000617 Ga0495630_0000617_20541_21101 186
500 3300046517 Ga0495630_0393671 Ga0495630_0393671_435_995 186
501 3300046517 Ga0495630_1086073 Ga0495630_1086073_24_584 186
502 3300046519 Ga0495632_0006296 Ga0495632_0006296_6214_6774 186
503 3300046522 Ga0495643_0048453 Ga0495643_0048453_951_1511 186
504 3300046523 Ga0495644_0000005 Ga0495644_0000005_17420_17980 186
505 3300046526 Ga0495666_0000015 Ga0495666_0000015_41817_42377 186
506 3300046526 Ga0495666_0084073 Ga0495666_0084073_242_802 186
507 3300046529 Ga0495652_0168278 Ga0495652_0168278_1056_1616 186
508 3300046530 Ga0495654_0000088 Ga0495654_0000088_28335_28895 186
509 3300046530 Ga0495654_0042167 Ga0495654_0042167_1552_2112 186
510 3300046536 Ga0495587_0015955 Ga0495587_0015955_1496_2056 186
511 3300046542 Ga0495597_0032090 Ga0495597_0032090_1176_1736 186
512 3300046543 Ga0495645_0016325 Ga0495645_0016325_2642_3202 186
513 3300046557 Ga0495622_0000181 Ga0495622_0000181_3700_4260 186
514 3300046559 Ga0495667_0028473 Ga0495667_0028473_251_811 186
515 3300046648 Ga0495611_0001442 Ga0495611_0001442_2286_2846 186
516 3300046664 Ga0495659_0000002 Ga0495659_0000002_148256_148816 186
517 3300046665 Ga0495661_0369938 Ga0495661_0369938_93_653 186
518 3300046674 Ga0495588_0022417 Ga0495588_0022417_1583_2143 186
519 3300046678 Ga0495599_0005304 Ga0495599_0005304_4788_5348 186
520 3300046679 Ga0495623_0064722 Ga0495623_0064722_943_1503 186
521 3300046679 Ga0495623_0164422 Ga0495623_0164422_717_1277 186
522 3300046680 Ga0495646_0192883 Ga0495646_0192883_257_817 186
523 3300046681 Ga0495647_0010085 Ga0495647_0010085_782_1342 186
524 3300046683 Ga0495658_0012392 Ga0495658_0012392_1049_1609 186
525 3300046690 Ga0495624_0033107 Ga0495624_0033107_2080_2640 186
526 3300046692 Ga0495671_0021457 Ga0495671_0021457_1461_2021 186
527 3300046694 Ga0495649_0000060 Ga0495649_0000060_72636_73196 186
528 3300046694 Ga0495649_0000330 Ga0495649_0000330_27397_27957 186
529 3300046794 Ga0495589_0008956 Ga0495589_0008956_3767_4327 186
530 3300046809 Ga0495600_0025345 Ga0495600_0025345_1477_2037 186
531 3300046810 Ga0495660_0004514 Ga0495660_0004514_4582_5142 186
532 3300047315 Ga0495581_0002397 Ga0495581_0002397_3712_4272 186
533 3300047315 Ga0495581_0039866 Ga0495581_0039866_1680_2240 186
534 3300047315 Ga0495581_0120998 Ga0495581_0120998_89_649 186
535 3300047317 Ga0495604_0003775 Ga0495604_0003775_9052_9612 186
536 3300047317 Ga0495604_0084819 Ga0495604_0084819_1007_1567 186
537 3300047319 Ga0495674_0080357 Ga0495674_0080357_656_1216 186
538 3300047319 Ga0495674_0211736 Ga0495674_0211736_793_1353 186
539 3300047320 Ga0495672_0000639 Ga0495672_0000639_1176_1736 186
540 3300047320 Ga0495672_0000812 Ga0495672_0000812_13303_13863 186
541 3300047320 Ga0495672_0027421 Ga0495672_0027421_1362_1922 186
542 3300047321 Ga0495676_0046308 Ga0495676_0046308_1748_2308 186
543 3300047322 Ga0495680_0179584 Ga0495680_0179584_769_1329 186
544 3300047323 Ga0495683_0001032 Ga0495683_0001032_15998_16558 186
545 3300047443 Ga0495687_012893 Ga0495687_012893_2931_3491 186
546 3300047443 Ga0495687_040302 Ga0495687_040302_896_1456 186
547 3300047444 Ga0495675_0011807 Ga0495675_0011807_1980_2540 186
548 3300047445 Ga0495677_0105630 Ga0495677_0105630_196_756 186
549 3300047471 Ga0495684_0011608 Ga0495684_0011608_5151_5711 186
550 3300047471 Ga0495684_0062447 Ga0495684_0062447_417_977 186
551 3300047471 Ga0495684_0276279 Ga0495684_0276279_558_1118 186
552 3300047673 Ga0495593_0000027 Ga0495593_0000027_34369_34929 186
553 3300047673 Ga0495593_0034446 Ga0495593_0034446_1751_2311 186
554 3300047673 Ga0495593_0263648 Ga0495593_0263648_110_670 186
555 3300048088 Ga0495602_0001002 Ga0495602_0001002_8068_8628 186
556 3300048091 Ga0495626_0000031 Ga0495626_0000031_169440_170000 186
557 3300048903 Ga0496100_0068248 Ga0496100_0068248_858_1418 186
558 3300048904 Ga0496101_0184560 Ga0496101_0184560_769_1329 186
559 3300048905 Ga0496102_0383496 Ga0496102_0383496_294_854 186
560 3300048906 Ga0496103_0019803 Ga0496103_0019803_2049_2609 186
561 3300048907 Ga0496104_0007532 Ga0496104_0007532_7078_7638 186
562 3300048908 Ga0496105_0004762 Ga0496105_0004762_1396_1956 186
563 3300048908 Ga0496105_0048875 Ga0496105_0048875_2530_3090 186
564 3300048909 Ga0496106_0022280 Ga0496106_0022280_1445_2005 186
565 3300048909 Ga0496106_0024081 Ga0496106_0024081_1342_1902 186
566 3300048910 Ga0496107_0168941 Ga0496107_0168941_702_1262 186
567 3300048911 Ga0496108_0221625 Ga0496108_0221625_540_1100 186
568 3300048912 Ga0496109_0001209 Ga0496109_0001209_16969_17529 186
569 3300048913 Ga0496110_0017292 Ga0496110_0017292_2053_2613 186
570 3300048913 Ga0496110_0030722 Ga0496110_0030722_1447_2007 186
571 3300048914 Ga0496111_0004625 Ga0496111_0004625_2303_2863 186
572 3300048914 Ga0496111_0572811 Ga0496111_0572811_182_742 186
573 3300048915 Ga0496112_0004925 Ga0496112_0004925_9920_10480 186
574 3300048916 Ga0496113_0009192 Ga0496113_0009192_2322_2882 186
575 3300048917 Ga0496114_0164119 Ga0496114_0164119_862_1422 186
576 3300048918 Ga0496115_0230446 Ga0496115_0230446_513_1073 186
577 3300048919 Ga0496116_0000475 Ga0496116_0000475_27094_27654 186
578 3300048920 Ga0496117_0067204 Ga0496117_0067204_267_827 186
579 3300048922 Ga0496119_0140469 Ga0496119_0140469_525_1085 186
580 3300048924 Ga0496121_0065408 Ga0496121_0065408_1673_2233 186
581 3300048925 Ga0496122_0064776 Ga0496122_0064776_1609_2169 186
582 3300048927 Ga0496124_0000276 Ga0496124_0000276_50182_50742 186
583 3300048929 Ga0496126_0000692 Ga0496126_0000692_25744_26304 186
584 3300049459 Ga0495678_016249 Ga0495678_016249_873_1433 186
585 3300049570 Ga0501033_0010195 Ga0501033_0010195_6505_7149 186
586 3300049572 Ga0501036_0304055 Ga0501036_0304055_231_875 186
587 3300049581 Ga0501047_0017651 Ga0501047_0017651_294_938 186
588 3300049581 Ga0501047_0319747 Ga0501047_0319747_476_1090 186
589 3300049581 Ga0501047_0350695 Ga0501047_0350695_76_639 186
590 3300049581 Ga0501047_0486066 Ga0501047_0486066_403_963 186
591 3300049583 Ga0501067_0427701 Ga0501067_0427701_133_693 186
592 3300049589 Ga0501073_0300131 Ga0501073_0300131_526_1086 186
593 3300049742 Ga0501080_0039237 Ga0501080_0039237_2766_3362 186
594 3300049742 Ga0501080_0159783 Ga0501080_0159783_182_742 186
595 3300049744 Ga0501083_0004796 Ga0501083_0004796_7855_8415 186
596 3300049823 Ga0501044_0017674 Ga0501044_0017674_3303_3947 186
597 3300050510 nmdc:mga06r32_353361_c1 nmdc:mga06r32_353361_c1_477_1037 186
598 3300050511 nmdc:mga08y16_84366_c1 nmdc:mga08y16_84366_c1_771_1331 186
599 3300050512 nmdc:mga0n895_175627_c1 nmdc:mga0n895_175627_c1_663_1223 186
600 3300050515 nmdc:mga0a205_756561_c1 nmdc:mga0a205_756561_c1_62_622 186
601 3300053077 Ga0495601_0016010 Ga0495601_0016010_1628_2188 186
602 3300053078 Ga0495612_0027440 Ga0495612_0027440_1144_1704 186
603 3300053084 Ga0495595_0058724 Ga0495595_0058724_1094_1654 186
604 3300053085 Ga0495619_0284675 Ga0495619_0284675_547_1107 186
605 3300053148 Ga0500590_015365 Ga0500590_015365_172_735 186
606 3300061734 Ga0530510_0029111 Ga0530510_0029111_316_876 186
607 iso_pu_bacteria 2988728565 2988729025 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

47

207

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ttb-assembly1.cif.gz_B crystal structure of homo sapiens iodotyrosine deiodinase (iyd) bound to fmn 0.8659 3 180
3ek3-assembly1.cif.gz_A-2 crystal structure of nitroreductase with bound fmn (yp_211706.1) from bacteroides fragilis nctc 9343 at 1.70 a resolution 0.8453 1 186
3gb5-assembly1.cif.gz_A-2 crystal structure of mus musculus iodotyrosine deiodinase (iyd) bound to fmn 0.8444 3 186
3ek3-assembly1.cif.gz_A-2 crystal structure of nitroreductase with bound fmn (yp_211706.1) from bacteroides fragilis nctc 9343 at 1.70 a resolution 0.8412 1 186
3kwk-assembly1.cif.gz_A-2 crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (np_809094.1) from bacteroides thetaiotaomicron vpi-5482 at 1.54 a resolution 0.8334 3 179
ID Description Score Start End Superfamily
3ek3A01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.86 1 168 3.40.109.10
3ek3A01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8457 1 168 3.40.109.10
3gb5A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8444 3 186 3.40.109.10
3pxvA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.82 3 186 3.40.109.10
5j6cB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8166 4 176 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A3C0Y410-F1-model_v4 Nitroreductase 0.9829 1 147 GO:0016020
GO:0016491
AF-A0A5J6MZK5-F1-model_v4 Nitroreductase 0.978 1 186 GO:0016491
AF-A0A840VBT1-F1-model_v4 Nitroreductase 0.9768 1 186 GO:0016491
AF-A0A3C0Y410-F1-model_v4 Nitroreductase 0.9763 1 147 GO:0016020
GO:0016491
AF-B0SYI7-F1-model_v4 Nitroreductase 0.976 1 186 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.25 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map