F468719
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 607 | 334 | 589 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300041408|Ga0439453_0053395|Ga0439453_0053395_72_752 |
| Length | 226 |
| Sequence | MDQSAWQGDALVFYELDIVFIAPPTSQQFDMDMARKTESTMDVHEAIIGRRSVREYLSQEVDEQAIRRLIEAAVHAPNAVNQQPWTFTVVRGKDVLDRLSRAAKSHMLSTMPASVHSAHFRSLLSDENFHIFYHAPVLVLISAAAPGPWIVEDCALAAENLMLAAYAAGLGTCWIGFAQGFLNTSEGKTLLGLPAAWVPVAPIIVGHPKSMPVEVPRKAPDVRWVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 3 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 4 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 5 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 6 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 7 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 8 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 9 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 10 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 11 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 12 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 13 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 14 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 15 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 16 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 17 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 18 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 21 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 22 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 103 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 165 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 183 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 184 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 185 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 186 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 187 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 188 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 282 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 283 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 284 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 285 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 289 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 329 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 334 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.03 |
| Metatranscriptomes | 0 |
| Isolates | 2.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.64 |
| Nodule | 0.33 |
| Rhizoplane | 8.4 |
| Rhizosphere | 85.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_6575 | 2124908027 | Bacteria | 4020 |
| 2 | JGI24751J29686_10026929 | 3300002459 | Unclassified | 1193 |
| 3 | JGI25162J39368_1000078 | 3300002737 | Bacteria | 118049 |
| 4 | JGI25163J39215_1000029 | 3300002771 | Bacteria | 66589 |
| 5 | JGI25164J39214_1000096 | 3300002772 | Bacteria | 87444 |
| 6 | JGI25165J46597_1000143 | 3300003214 | Bacteria | 118216 |
| 7 | rootL2_10369569 | 3300003322 | Unclassified | 1455 |
| 8 | rootH1_10340779 | 3300003323 | Bacteria | 2045 |
| 9 | Ga0055542_1000115 | 3300003762 | Bacteria | 106506 |
| 10 | Ga0055529_1000052 | 3300003763 | Bacteria | 203029 |
| 11 | Ga0065714_10064625 | 3300005288 | Bacteria | 27824 |
| 12 | Ga0065704_10226886 | 3300005289 | Bacteria | 1056 |
| 13 | Ga0070658_10091916 | 3300005327 | Bacteria | 2501 |
| 14 | Ga0070683_100160618 | 3300005329 | Bacteria | 2132 |
| 15 | Ga0070670_100073247 | 3300005331 | Bacteria | 2942 |
| 16 | Ga0070680_100552870 | 3300005336 | Unclassified | 987 |
| 17 | Ga0070660_100075444 | 3300005339 | Unclassified | 2640 |
| 18 | Ga0070689_100018682 | 3300005340 | Bacteria | 5112 |
| 19 | Ga0070691_10257571 | 3300005341 | Unclassified | 938 |
| 20 | Ga0070687_100124154 | 3300005343 | Bacteria | 1481 |
| 21 | Ga0070661_100000062 | 3300005344 | Bacteria | 85485 |
| 22 | Ga0070671_100157136 | 3300005355 | Bacteria | 1921 |
| 23 | Ga0070674_100137225 | 3300005356 | Bacteria | 1831 |
| 24 | Ga0070673_100235622 | 3300005364 | Bacteria | 1589 |
| 25 | Ga0070688_100091397 | 3300005365 | Bacteria | 1989 |
| 26 | Ga0070688_100157443 | 3300005365 | Bacteria | 1558 |
| 27 | Ga0070659_100526369 | 3300005366 | Bacteria | 1010 |
| 28 | Ga0070667_100101487 | 3300005367 | Bacteria | 2486 |
| 29 | Ga0070709_10045336 | 3300005434 | Bacteria | 2728 |
| 30 | Ga0070709_10536874 | 3300005434 | Unclassified | 893 |
| 31 | Ga0070713_100507964 | 3300005436 | Unclassified | 1138 |
| 32 | Ga0070701_10142287 | 3300005438 | Bacteria | 1373 |
| 33 | Ga0070711_100142083 | 3300005439 | Bacteria | 1801 |
| 34 | Ga0070700_100363390 | 3300005441 | Bacteria | 1077 |
| 35 | Ga0070678_100558940 | 3300005456 | Bacteria | 1017 |
| 36 | Ga0070681_10052286 | 3300005458 | Bacteria | 4073 |
| 37 | Ga0068867_100128868 | 3300005459 | Bacteria | 1964 |
| 38 | Ga0070685_10041721 | 3300005466 | Bacteria | 2616 |
| 39 | Ga0070684_100036883 | 3300005535 | Bacteria | 4191 |
| 40 | Ga0070693_100153188 | 3300005547 | Bacteria | 1462 |
| 41 | Ga0070665_100013279 | 3300005548 | Bacteria | 8292 |
| 42 | Ga0070665_100046791 | 3300005548 | Bacteria | 4343 |
| 43 | Ga0070704_100868870 | 3300005549 | Bacteria | 809 |
| 44 | Ga0070664_100000035 | 3300005564 | Bacteria | 81750 |
| 45 | Ga0070664_100083995 | 3300005564 | Bacteria | 2748 |
| 46 | Ga0068856_100010943 | 3300005614 | Bacteria | 8803 |
| 47 | Ga0068856_100460178 | 3300005614 | Bacteria | 1293 |
| 48 | Ga0068856_101386997 | 3300005614 | Unclassified | 717 |
| 49 | Ga0068859_100191916 | 3300005617 | Bacteria | 2127 |
| 50 | Ga0068863_100095000 | 3300005841 | Bacteria | 2830 |
| 51 | Ga0068863_100526232 | 3300005841 | Unclassified | 1166 |
| 52 | Ga0068858_100218238 | 3300005842 | Bacteria | 1806 |
| 53 | Ga0068858_100458017 | 3300005842 | Unclassified | 1230 |
| 54 | Ga0070712_100133706 | 3300006175 | Bacteria | 1883 |
| 55 | Ga0070712_100284842 | 3300006175 | Unclassified | 1332 |
| 56 | Ga0097621_100000035 | 3300006237 | Bacteria | 68179 |
| 57 | Ga0068871_100000384 | 3300006358 | Bacteria | 31033 |
| 58 | Ga0075431_100075386 | 3300006847 | Bacteria | 3481 |
| 59 | Ga0075433_10282507 | 3300006852 | Unclassified | 1470 |
| 60 | Ga0075434_100005391 | 3300006871 | Bacteria | 11635 |
| 61 | Ga0068865_100054968 | 3300006881 | Bacteria | 2769 |
| 62 | Ga0097620_100191908 | 3300006931 | Bacteria | 2127 |
| 63 | Ga0105251_10003826 | 3300009011 | Bacteria | 10722 |
| 64 | Ga0105251_10014136 | 3300009011 | Bacteria | 4430 |
| 65 | Ga0105244_10000614 | 3300009036 | Bacteria | 31637 |
| 66 | Ga0105244_10000616 | 3300009036 | Bacteria | 31571 |
| 67 | Ga0105244_10100058 | 3300009036 | Bacteria | 1419 |
| 68 | Ga0105240_10007067 | 3300009093 | Bacteria | 16368 |
| 69 | Ga0111539_10291521 | 3300009094 | Unclassified | 1899 |
| 70 | Ga0105245_10314625 | 3300009098 | Bacteria | 1540 |
| 71 | Ga0105247_10046816 | 3300009101 | Bacteria | 2655 |
| 72 | Ga0105247_10056610 | 3300009101 | Unclassified | 2422 |
| 73 | Ga0114129_10023918 | 3300009147 | Bacteria | 8658 |
| 74 | Ga0105243_10000026 | 3300009148 | Bacteria | 191522 |
| 75 | Ga0105241_10017871 | 3300009174 | Bacteria | 5215 |
| 76 | Ga0105242_10000647 | 3300009176 | Bacteria | 27252 |
| 77 | Ga0105248_10889058 | 3300009177 | Unclassified | 1006 |
| 78 | Ga0105237_10000042 | 3300009545 | Bacteria | 181280 |
| 79 | Ga0105237_10594786 | 3300009545 | Unclassified | 1113 |
| 80 | Ga0105238_10119210 | 3300009551 | Bacteria | 2619 |
| 81 | Ga0105249_10322986 | 3300009553 | Bacteria | 1555 |
| 82 | Ga0105239_10239757 | 3300010375 | Bacteria | 2035 |
| 83 | Ga0105239_10337814 | 3300010375 | Unclassified | 1699 |
| 84 | Ga0105239_11446016 | 3300010375 | Bacteria | 794 |
| 85 | Ga0105246_10000110 | 3300011119 | Bacteria | 36633 |
| 86 | Ga0105246_10020064 | 3300011119 | Bacteria | 4284 |
| 87 | Ga0105246_10105910 | 3300011119 | Bacteria | 2056 |
| 88 | Ga0157373_10017195 | 3300013100 | Bacteria | 5266 |
| 89 | Ga0157371_10004131 | 3300013102 | Bacteria | 12804 |
| 90 | Ga0157370_10008032 | 3300013104 | Bacteria | 11429 |
| 91 | Ga0157370_10697422 | 3300013104 | Bacteria | 927 |
| 92 | Ga0157369_10000191 | 3300013105 | Bacteria | 84979 |
| 93 | Ga0157369_10000251 | 3300013105 | Bacteria | 73814 |
| 94 | Ga0157378_10130732 | 3300013297 | Bacteria | 2324 |
| 95 | Ga0163162_10051590 | 3300013306 | Bacteria | 4128 |
| 96 | Ga0157375_10001383 | 3300013308 | Bacteria | 20936 |
| 97 | Ga0157375_10001815 | 3300013308 | Bacteria | 18305 |
| 98 | Ga0157375_10503258 | 3300013308 | Bacteria | 1375 |
| 99 | Ga0163163_10001080 | 3300014325 | Bacteria | 23130 |
| 100 | Ga0163163_10148886 | 3300014325 | Bacteria | 2385 |
| 101 | Ga0157380_10593624 | 3300014326 | Unclassified | 1094 |
| 102 | Ga0182008_10015393 | 3300014497 | Bacteria | 3991 |
| 103 | Ga0182008_10122449 | 3300014497 | Bacteria | 1293 |
| 104 | Ga0157379_10049322 | 3300014968 | Bacteria | 3759 |
| 105 | Ga0157376_10012349 | 3300014969 | Bacteria | 6336 |
| 106 | Ga0182006_1000083 | 3300015261 | Bacteria | 118727 |
| 107 | Ga0182007_10000086 | 3300015262 | Bacteria | 69920 |
| 108 | Ga0182007_10008020 | 3300015262 | Bacteria | 4367 |
| 109 | Ga0182005_1001544 | 3300015265 | Bacteria | 9131 |
| 110 | Ga0182005_1043938 | 3300015265 | Bacteria | 1215 |
| 111 | Ga0182005_1073372 | 3300015265 | Bacteria | 941 |
| 112 | Ga0213872_10000876 | 3300021361 | Bacteria | 21757 |
| 113 | Ga0209760_100049 | 3300025207 | Bacteria | 107275 |
| 114 | Ga0207427_100048 | 3300025231 | Bacteria | 238464 |
| 115 | Ga0209437_100094 | 3300025233 | Bacteria | 238465 |
| 116 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 117 | Ga0209233_1000106 | 3300025261 | Bacteria | 268795 |
| 118 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 119 | Ga0207655_1000070 | 3300025728 | Bacteria | 239196 |
| 120 | Ga0207655_1000076 | 3300025728 | Bacteria | 226359 |
| 121 | Ga0207655_1006677 | 3300025728 | Bacteria | 7604 |
| 122 | Ga0207713_1026120 | 3300025735 | Bacteria | 2683 |
| 123 | Ga0207680_10348020 | 3300025903 | Bacteria | 1040 |
| 124 | Ga0207699_10054812 | 3300025906 | Bacteria | 2370 |
| 125 | Ga0207654_10059217 | 3300025911 | Bacteria | 2233 |
| 126 | Ga0207707_10158905 | 3300025912 | Bacteria | 1976 |
| 127 | Ga0207695_10026021 | 3300025913 | Bacteria | 6536 |
| 128 | Ga0207695_10305816 | 3300025913 | Bacteria | 1481 |
| 129 | Ga0207671_10002005 | 3300025914 | Bacteria | 22403 |
| 130 | Ga0207671_10009256 | 3300025914 | Bacteria | 8250 |
| 131 | Ga0207671_10383044 | 3300025914 | Unclassified | 1117 |
| 132 | Ga0207693_10083921 | 3300025915 | Unclassified | 2496 |
| 133 | Ga0207693_10115942 | 3300025915 | Bacteria | 2103 |
| 134 | Ga0207663_10093522 | 3300025916 | Unclassified | 2001 |
| 135 | Ga0207663_10312466 | 3300025916 | Unclassified | 1178 |
| 136 | Ga0207663_10362537 | 3300025916 | Unclassified | 1100 |
| 137 | Ga0207660_10280729 | 3300025917 | Bacteria | 1321 |
| 138 | Ga0207662_10208690 | 3300025918 | Unclassified | 1267 |
| 139 | Ga0207657_10007517 | 3300025919 | Bacteria | 11168 |
| 140 | Ga0207649_10000010 | 3300025920 | Bacteria | 284354 |
| 141 | Ga0207652_10106114 | 3300025921 | Unclassified | 2486 |
| 142 | Ga0207694_10004306 | 3300025924 | Bacteria | 11133 |
| 143 | Ga0207650_10058174 | 3300025925 | Bacteria | 2877 |
| 144 | Ga0207700_10062989 | 3300025928 | Bacteria | 2819 |
| 145 | Ga0207700_10356204 | 3300025928 | Bacteria | 1275 |
| 146 | Ga0207664_10319872 | 3300025929 | Bacteria | 1369 |
| 147 | Ga0207686_10051753 | 3300025934 | Bacteria | 2560 |
| 148 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 149 | Ga0207704_10173124 | 3300025938 | Bacteria | 1551 |
| 150 | Ga0207711_10253593 | 3300025941 | Bacteria | 1616 |
| 151 | Ga0207679_10000022 | 3300025945 | Bacteria | 219036 |
| 152 | Ga0207679_10182000 | 3300025945 | Unclassified | 1739 |
| 153 | Ga0207651_10205079 | 3300025960 | Bacteria | 1583 |
| 154 | Ga0207712_10373475 | 3300025961 | Bacteria | 1191 |
| 155 | Ga0207668_11300539 | 3300025972 | Unclassified | 655 |
| 156 | Ga0207703_10082107 | 3300026035 | Unclassified | 2689 |
| 157 | Ga0207703_10125286 | 3300026035 | Bacteria | 2211 |
| 158 | Ga0207708_10402384 | 3300026075 | Bacteria | 1132 |
| 159 | Ga0207702_10006705 | 3300026078 | Bacteria | 9893 |
| 160 | Ga0207702_10264305 | 3300026078 | Bacteria | 1621 |
| 161 | Ga0207702_10799943 | 3300026078 | Bacteria | 932 |
| 162 | Ga0207641_10357194 | 3300026088 | Unclassified | 1394 |
| 163 | Ga0207648_10251628 | 3300026089 | Unclassified | 1575 |
| 164 | Ga0207428_10127289 | 3300027907 | Bacteria | 1950 |
| 165 | Ga0268266_10052714 | 3300028379 | Bacteria | 3494 |
| 166 | Ga0268266_10190424 | 3300028379 | Unclassified | 1872 |
| 167 | Ga0265326_10008473 | 3300028558 | Bacteria | 3101 |
| 168 | Ga0265326_10041509 | 3300028558 | Bacteria | 1306 |
| 169 | Ga0265326_10083180 | 3300028558 | Bacteria | 905 |
| 170 | Ga0265326_10091838 | 3300028558 | Bacteria | 860 |
| 171 | Ga0265334_10031909 | 3300028573 | Bacteria | 2103 |
| 172 | Ga0265318_10015864 | 3300028577 | Bacteria | 3121 |
| 173 | Ga0265318_10107486 | 3300028577 | Bacteria | 1026 |
| 174 | Ga0265323_10013915 | 3300028653 | Bacteria | 3198 |
| 175 | Ga0265322_10002230 | 3300028654 | Bacteria | 6023 |
| 176 | Ga0265322_10002561 | 3300028654 | Bacteria | 5589 |
| 177 | Ga0265336_10000834 | 3300028666 | Bacteria | 16059 |
| 178 | Ga0265338_10007808 | 3300028800 | Bacteria | 13154 |
| 179 | Ga0265338_10008670 | 3300028800 | Bacteria | 12302 |
| 180 | Ga0265338_10323991 | 3300028800 | Bacteria | 1115 |
| 181 | Ga0265338_10468685 | 3300028800 | Unclassified | 890 |
| 182 | Ga0265324_10007248 | 3300029957 | Bacteria | 4519 |
| 183 | Ga0265330_10000120 | 3300031235 | Archaea | 63594 |
| 184 | Ga0265330_10108894 | 3300031235 | Bacteria | 1184 |
| 185 | Ga0265330_10374052 | 3300031235 | Bacteria | 602 |
| 186 | Ga0265332_10088531 | 3300031238 | Bacteria | 1310 |
| 187 | Ga0265328_10000070 | 3300031239 | Bacteria | 54736 |
| 188 | Ga0265320_10096247 | 3300031240 | Bacteria | 1367 |
| 189 | Ga0265320_10158751 | 3300031240 | Bacteria | 1019 |
| 190 | Ga0265320_10329145 | 3300031240 | Bacteria | 675 |
| 191 | Ga0265325_10002245 | 3300031241 | Bacteria | 13094 |
| 192 | Ga0265325_10016363 | 3300031241 | Bacteria | 4148 |
| 193 | Ga0265325_10035841 | 3300031241 | Bacteria | 2632 |
| 194 | Ga0265325_10182382 | 3300031241 | Bacteria | 977 |
| 195 | Ga0265340_10106911 | 3300031247 | Bacteria | 1296 |
| 196 | Ga0265340_10123955 | 3300031247 | Bacteria | 1187 |
| 197 | Ga0265339_10004588 | 3300031249 | Bacteria | 9404 |
| 198 | Ga0265339_10007688 | 3300031249 | Bacteria | 6936 |
| 199 | Ga0265339_10030792 | 3300031249 | Bacteria | 3036 |
| 200 | Ga0265339_10220328 | 3300031249 | Bacteria | 928 |
| 201 | Ga0265331_10002466 | 3300031250 | Bacteria | 12510 |
| 202 | Ga0265331_10047206 | 3300031250 | Bacteria | 2073 |
| 203 | Ga0265331_10059809 | 3300031250 | Bacteria | 1801 |
| 204 | Ga0265327_10008070 | 3300031251 | Bacteria | 7932 |
| 205 | Ga0265327_10026102 | 3300031251 | Bacteria | 3390 |
| 206 | Ga0265316_10005418 | 3300031344 | Bacteria | 12397 |
| 207 | Ga0265316_10010540 | 3300031344 | Bacteria | 8416 |
| 208 | Ga0265316_10028640 | 3300031344 | Bacteria | 4592 |
| 209 | Ga0265316_10267416 | 3300031344 | Bacteria | 1252 |
| 210 | Ga0265316_10268758 | 3300031344 | Unclassified | 1248 |
| 211 | Ga0265316_10424097 | 3300031344 | Bacteria | 956 |
| 212 | Ga0265313_10002174 | 3300031595 | Bacteria | 17387 |
| 213 | Ga0265313_10004390 | 3300031595 | Bacteria | 10875 |
| 214 | Ga0265314_10036142 | 3300031711 | Bacteria | 3593 |
| 215 | Ga0265314_10096809 | 3300031711 | Unclassified | 1908 |
| 216 | Ga0265342_10000077 | 3300031712 | Archaea | 105309 |
| 217 | Ga0265342_10007817 | 3300031712 | Bacteria | 7770 |
| 218 | Ga0265342_10013742 | 3300031712 | Bacteria | 5409 |
| 219 | Ga0265342_10083656 | 3300031712 | Bacteria | 1839 |
| 220 | Ga0265342_10141210 | 3300031712 | Bacteria | 1343 |
| 221 | Ga0373926_0046897 | 3300035083 | Bacteria | 1551 |
| 222 | Ga0373926_0204140 | 3300035083 | Bacteria | 761 |
| 223 | Ga0373944_0014604 | 3300035089 | Bacteria | 2194 |
| 224 | Ga0373923_0005760 | 3300035111 | Bacteria | 4228 |
| 225 | Ga0373923_0095535 | 3300035111 | Unclassified | 1305 |
| 226 | Ga0373923_0289405 | 3300035111 | Unclassified | 773 |
| 227 | Ga0373923_0463388 | 3300035111 | Unclassified | 615 |
| 228 | Ga0373923_0464083 | 3300035111 | Unclassified | 615 |
| 229 | Ga0373936_0060000 | 3300035113 | Bacteria | 1551 |
| 230 | Ga0373945_0009648 | 3300035116 | Unclassified | 3165 |
| 231 | Ga0373945_0009912 | 3300035116 | Unclassified | 3127 |
| 232 | Ga0373945_0225638 | 3300035116 | Unclassified | 785 |
| 233 | Ga0373954_0077539 | 3300035118 | Bacteria | 1585 |
| 234 | Ga0373954_0078330 | 3300035118 | Bacteria | 1577 |
| 235 | Ga0373954_0134388 | 3300035118 | Unclassified | 1205 |
| 236 | Ga0373956_0003454 | 3300035119 | Bacteria | 6361 |
| 237 | Ga0373956_0031374 | 3300035119 | Unclassified | 2329 |
| 238 | Ga0373956_0032297 | 3300035119 | Bacteria | 2297 |
| 239 | Ga0373943_0012682 | 3300035170 | Bacteria | 3799 |
| 240 | Ga0373946_0096092 | 3300035171 | Bacteria | 1321 |
| 241 | Ga0373946_0107116 | 3300035171 | Bacteria | 1260 |
| 242 | Ga0373955_0204501 | 3300035172 | Bacteria | 1176 |
| 243 | Ga0373955_0418250 | 3300035172 | Bacteria | 815 |
| 244 | Ga0373955_0544514 | 3300035172 | Unclassified | 710 |
| 245 | Ga0373924_0061685 | 3300035410 | Unclassified | 1569 |
| 246 | Ga0373924_0327067 | 3300035410 | Unclassified | 682 |
| 247 | Ga0373931_0215343 | 3300035691 | Unclassified | 1154 |
| 248 | Ga0373935_0037333 | 3300035692 | Bacteria | 3040 |
| 249 | Ga0373935_0046948 | 3300035692 | Bacteria | 2729 |
| 250 | Ga0373935_0081917 | 3300035692 | Bacteria | 2099 |
| 251 | Ga0373935_0157308 | 3300035692 | Bacteria | 1546 |
| 252 | Ga0373927_0000531 | 3300035695 | Bacteria | 28946 |
| 253 | Ga0373927_0031121 | 3300035695 | Bacteria | 3480 |
| 254 | Ga0373927_0061357 | 3300035695 | Bacteria | 2432 |
| 255 | Ga0373927_0272979 | 3300035695 | Bacteria | 1112 |
| 256 | Ga0373927_0343454 | 3300035695 | Unclassified | 983 |
| 257 | Ga0373933_0048833 | 3300035724 | Bacteria | 2521 |
| 258 | Ga0373933_0064709 | 3300035724 | Bacteria | 2213 |
| 259 | Ga0373933_0197248 | 3300035724 | Unclassified | 1287 |
| 260 | Ga0373933_0710039 | 3300035724 | Unclassified | 661 |
| 261 | Ga0373947_0006667 | 3300035725 | Bacteria | 6699 |
| 262 | Ga0373947_0078047 | 3300035725 | Bacteria | 2043 |
| 263 | Ga0373947_0190049 | 3300035725 | Bacteria | 1339 |
| 264 | Ga0373937_0000803 | 3300036401 | Bacteria | 26850 |
| 265 | Ga0373937_0017555 | 3300036401 | Bacteria | 6378 |
| 266 | Ga0373937_0029798 | 3300036401 | Bacteria | 4943 |
| 267 | Ga0373937_0078354 | 3300036401 | Bacteria | 3054 |
| 268 | Ga0373937_0202371 | 3300036401 | Bacteria | 1867 |
| 269 | Ga0373937_0275408 | 3300036401 | Unclassified | 1589 |
| 270 | Ga0373937_0408706 | 3300036401 | Unclassified | 1288 |
| 271 | Ga0373925_0010890 | 3300037068 | Bacteria | 6597 |
| 272 | Ga0373925_0071820 | 3300037068 | Bacteria | 2618 |
| 273 | Ga0373925_0079430 | 3300037068 | Bacteria | 2493 |
| 274 | Ga0373925_0196040 | 3300037068 | Unclassified | 1604 |
| 275 | Ga0316581_0102560 | 3300037588 | Bacteria | 881 |
| 276 | Ga0436361_0034567 | 3300039447 | Bacteria | 27864 |
| 277 | Ga0439447_000008 | 3300041407 | Bacteria | 91339 |
| 278 | Ga0439453_0053395 | 3300041408 | Unclassified | 822 |
| 279 | Ga0439466_0012249 | 3300041411 | Bacteria | 3164 |
| 280 | Ga0450902_023709 | 3300042137 | Bacteria | 1020 |
| 281 | Ga0453683_0002374 | 3300044673 | Bacteria | 14721 |
| 282 | Ga0453684_0028695 | 3300044712 | Archaea | 7928 |
| 283 | Ga0453684_0058493 | 3300044712 | Archaea | 4979 |
| 284 | Ga0495617_011469 | 3300046452 | Bacteria | 3023 |
| 285 | Ga0495592_0026791 | 3300046454 | Bacteria | 4370 |
| 286 | Ga0495592_0307156 | 3300046454 | Unclassified | 1029 |
| 287 | Ga0495603_0000079 | 3300046455 | Bacteria | 43171 |
| 288 | Ga0495603_0009670 | 3300046455 | Bacteria | 5832 |
| 289 | Ga0495603_0152359 | 3300046455 | Unclassified | 1342 |
| 290 | Ga0495603_0440544 | 3300046455 | Bacteria | 746 |
| 291 | Ga0495590_0001309 | 3300046457 | Bacteria | 10817 |
| 292 | Ga0495591_006244 | 3300046458 | Bacteria | 5312 |
| 293 | Ga0495629_0001160 | 3300046459 | Bacteria | 20789 |
| 294 | Ga0495629_0046341 | 3300046459 | Bacteria | 3049 |
| 295 | Ga0495629_0057351 | 3300046459 | Bacteria | 2723 |
| 296 | Ga0495638_0000088 | 3300046460 | Bacteria | 152517 |
| 297 | Ga0495641_0010464 | 3300046461 | Bacteria | 5371 |
| 298 | Ga0495641_0013908 | 3300046461 | Bacteria | 4387 |
| 299 | Ga0495641_0260296 | 3300046461 | Bacteria | 780 |
| 300 | Ga0495651_0007423 | 3300046462 | Bacteria | 8383 |
| 301 | Ga0495651_0009486 | 3300046462 | Bacteria | 7473 |
| 302 | Ga0495651_0015833 | 3300046462 | Bacteria | 5837 |
| 303 | Ga0495653_0154294 | 3300046463 | Bacteria | 1601 |
| 304 | Ga0495653_0221134 | 3300046463 | Unclassified | 1273 |
| 305 | Ga0495580_0013487 | 3300046472 | Bacteria | 6234 |
| 306 | Ga0495580_0056173 | 3300046472 | Bacteria | 2773 |
| 307 | Ga0495580_0383220 | 3300046472 | Unclassified | 949 |
| 308 | Ga0495582_0004208 | 3300046473 | Bacteria | 8093 |
| 309 | Ga0495582_0086756 | 3300046473 | Unclassified | 1742 |
| 310 | Ga0495582_0130561 | 3300046473 | Bacteria | 1419 |
| 311 | Ga0495582_0409330 | 3300046473 | Bacteria | 782 |
| 312 | Ga0495605_0000313 | 3300046474 | Bacteria | 50847 |
| 313 | Ga0495605_0043295 | 3300046474 | Bacteria | 2232 |
| 314 | Ga0495639_0000001 | 3300046475 | Bacteria | 204442 |
| 315 | Ga0495639_0007964 | 3300046475 | Bacteria | 4552 |
| 316 | Ga0495639_0168221 | 3300046475 | Unclassified | 1063 |
| 317 | Ga0495662_0019513 | 3300046476 | Bacteria | 3279 |
| 318 | Ga0495662_0156298 | 3300046476 | Unclassified | 1123 |
| 319 | Ga0495664_0013914 | 3300046477 | Bacteria | 4560 |
| 320 | Ga0495664_0208562 | 3300046477 | Bacteria | 1183 |
| 321 | Ga0495584_0019640 | 3300046491 | Bacteria | 3432 |
| 322 | Ga0495594_0000150 | 3300046499 | Bacteria | 33190 |
| 323 | Ga0495594_0000174 | 3300046499 | Bacteria | 30955 |
| 324 | Ga0495594_0010204 | 3300046499 | Bacteria | 4868 |
| 325 | Ga0495594_0059043 | 3300046499 | Unclassified | 2120 |
| 326 | Ga0495594_0269411 | 3300046499 | Bacteria | 970 |
| 327 | Ga0495607_0001623 | 3300046501 | Bacteria | 19510 |
| 328 | Ga0495583_0000323 | 3300046506 | Bacteria | 75419 |
| 329 | Ga0495583_0010532 | 3300046506 | Bacteria | 5383 |
| 330 | Ga0495608_0094976 | 3300046511 | Bacteria | 1926 |
| 331 | Ga0495616_0002937 | 3300046513 | Bacteria | 11083 |
| 332 | Ga0495618_0014757 | 3300046514 | Bacteria | 4764 |
| 333 | Ga0495618_0109570 | 3300046514 | Unclassified | 1768 |
| 334 | Ga0495628_0114368 | 3300046516 | Bacteria | 2073 |
| 335 | Ga0495630_0000617 | 3300046517 | Bacteria | 25804 |
| 336 | Ga0495630_0046260 | 3300046517 | Bacteria | 3253 |
| 337 | Ga0495630_0069497 | 3300046517 | Bacteria | 2649 |
| 338 | Ga0495630_0393671 | 3300046517 | Unclassified | 1061 |
| 339 | Ga0495630_1086073 | 3300046517 | Unclassified | 607 |
| 340 | Ga0495632_0006296 | 3300046519 | Bacteria | 7663 |
| 341 | Ga0495643_0048453 | 3300046522 | Bacteria | 2296 |
| 342 | Ga0495644_0000005 | 3300046523 | Bacteria | 135313 |
| 343 | Ga0495666_0000015 | 3300046526 | Bacteria | 76311 |
| 344 | Ga0495666_0016705 | 3300046526 | Bacteria | 3653 |
| 345 | Ga0495666_0022879 | 3300046526 | Bacteria | 3093 |
| 346 | Ga0495666_0084073 | 3300046526 | Unclassified | 1504 |
| 347 | Ga0495652_0029539 | 3300046529 | Plasmid | 4815 |
| 348 | Ga0495652_0168278 | 3300046529 | Bacteria | 1694 |
| 349 | Ga0495654_0000088 | 3300046530 | Bacteria | 104763 |
| 350 | Ga0495654_0042167 | 3300046530 | Bacteria | 2266 |
| 351 | Ga0495665_0115652 | 3300046531 | Bacteria | 1405 |
| 352 | Ga0495665_0176238 | 3300046531 | Bacteria | 1112 |
| 353 | Ga0495640_0024203 | 3300046533 | Bacteria | 4418 |
| 354 | Ga0495640_0040613 | 3300046533 | Bacteria | 3257 |
| 355 | Ga0495640_0157023 | 3300046533 | Unclassified | 1460 |
| 356 | Ga0495640_0197425 | 3300046533 | Bacteria | 1276 |
| 357 | Ga0495586_0059336 | 3300046535 | Bacteria | 2079 |
| 358 | Ga0495587_0015330 | 3300046536 | Bacteria | 4788 |
| 359 | Ga0495587_0015955 | 3300046536 | Bacteria | 4677 |
| 360 | Ga0495587_0262146 | 3300046536 | Unclassified | 970 |
| 361 | Ga0495598_0331314 | 3300046537 | Unclassified | 582 |
| 362 | Ga0495597_0032090 | 3300046542 | Bacteria | 2385 |
| 363 | Ga0495645_0007180 | 3300046543 | Bacteria | 7751 |
| 364 | Ga0495645_0016325 | 3300046543 | Bacteria | 5300 |
| 365 | Ga0495645_0423307 | 3300046543 | Unclassified | 845 |
| 366 | Ga0495622_0000181 | 3300046557 | Bacteria | 51031 |
| 367 | Ga0495622_0001062 | 3300046557 | Bacteria | 14570 |
| 368 | Ga0495622_0168512 | 3300046557 | Bacteria | 985 |
| 369 | Ga0495667_0011175 | 3300046559 | Bacteria | 6076 |
| 370 | Ga0495667_0015396 | 3300046559 | Bacteria | 5166 |
| 371 | Ga0495667_0028473 | 3300046559 | Bacteria | 3762 |
| 372 | Ga0495667_0152101 | 3300046559 | Bacteria | 1490 |
| 373 | Ga0495667_0415472 | 3300046559 | Unclassified | 847 |
| 374 | Ga0495634_0003953 | 3300046642 | Bacteria | 11764 |
| 375 | Ga0495634_0181757 | 3300046642 | Bacteria | 1316 |
| 376 | Ga0495634_0334502 | 3300046642 | Unclassified | 909 |
| 377 | Ga0495611_0001442 | 3300046648 | Bacteria | 11820 |
| 378 | Ga0495635_0001253 | 3300046663 | Bacteria | 16996 |
| 379 | Ga0495635_0029315 | 3300046663 | Bacteria | 3826 |
| 380 | Ga0495635_0116502 | 3300046663 | Bacteria | 1823 |
| 381 | Ga0495659_0000002 | 3300046664 | Bacteria | 176698 |
| 382 | Ga0495661_0369938 | 3300046665 | Bacteria | 702 |
| 383 | Ga0495588_0000930 | 3300046674 | Bacteria | 12734 |
| 384 | Ga0495588_0022417 | 3300046674 | Unclassified | 3122 |
| 385 | Ga0495588_0023662 | 3300046674 | Bacteria | 3043 |
| 386 | Ga0495657_0036967 | 3300046675 | Bacteria | 3369 |
| 387 | Ga0495657_0048335 | 3300046675 | Bacteria | 2871 |
| 388 | Ga0495657_0311966 | 3300046675 | Unclassified | 936 |
| 389 | Ga0495599_0005304 | 3300046678 | Bacteria | 7690 |
| 390 | Ga0495623_0064722 | 3300046679 | Bacteria | 2288 |
| 391 | Ga0495623_0164422 | 3300046679 | Bacteria | 1301 |
| 392 | Ga0495646_0054495 | 3300046680 | Bacteria | 2405 |
| 393 | Ga0495646_0192883 | 3300046680 | Unclassified | 1113 |
| 394 | Ga0495646_0330081 | 3300046680 | Unclassified | 802 |
| 395 | Ga0495647_0010085 | 3300046681 | Bacteria | 3214 |
| 396 | Ga0495658_0004670 | 3300046683 | Bacteria | 6737 |
| 397 | Ga0495658_0012392 | 3300046683 | Bacteria | 4316 |
| 398 | Ga0495658_0198548 | 3300046683 | Bacteria | 1249 |
| 399 | Ga0495658_0695809 | 3300046683 | Unclassified | 651 |
| 400 | Ga0495613_0000263 | 3300046689 | Bacteria | 49324 |
| 401 | Ga0495613_0028330 | 3300046689 | Bacteria | 4165 |
| 402 | Ga0495613_0033972 | 3300046689 | Bacteria | 3788 |
| 403 | Ga0495624_0007255 | 3300046690 | Bacteria | 7794 |
| 404 | Ga0495624_0033107 | 3300046690 | Bacteria | 3348 |
| 405 | Ga0495624_0058641 | 3300046690 | Bacteria | 2417 |
| 406 | Ga0495670_0052837 | 3300046691 | Bacteria | 2035 |
| 407 | Ga0495671_0021457 | 3300046692 | Bacteria | 3392 |
| 408 | Ga0495649_0000060 | 3300046694 | Bacteria | 97624 |
| 409 | Ga0495649_0000330 | 3300046694 | Bacteria | 41062 |
| 410 | Ga0495589_0008956 | 3300046794 | Bacteria | 5206 |
| 411 | Ga0495600_0025345 | 3300046809 | Bacteria | 3822 |
| 412 | Ga0495600_0059015 | 3300046809 | Bacteria | 2506 |
| 413 | Ga0495600_0238432 | 3300046809 | Bacteria | 1159 |
| 414 | Ga0495660_0004514 | 3300046810 | Bacteria | 8415 |
| 415 | Ga0495581_0002397 | 3300047315 | Bacteria | 10588 |
| 416 | Ga0495581_0004725 | 3300047315 | Bacteria | 7862 |
| 417 | Ga0495581_0030632 | 3300047315 | Bacteria | 3116 |
| 418 | Ga0495581_0039866 | 3300047315 | Bacteria | 2719 |
| 419 | Ga0495581_0077905 | 3300047315 | Bacteria | 1918 |
| 420 | Ga0495581_0120998 | 3300047315 | Bacteria | 1523 |
| 421 | Ga0495604_0003775 | 3300047317 | Bacteria | 12060 |
| 422 | Ga0495604_0005654 | 3300047317 | Bacteria | 9915 |
| 423 | Ga0495604_0014044 | 3300047317 | Bacteria | 6385 |
| 424 | Ga0495604_0084819 | 3300047317 | Bacteria | 2365 |
| 425 | Ga0495674_0003342 | 3300047319 | Bacteria | 15574 |
| 426 | Ga0495674_0080357 | 3300047319 | Bacteria | 2798 |
| 427 | Ga0495674_0211736 | 3300047319 | Unclassified | 1605 |
| 428 | Ga0495672_0000639 | 3300047320 | Bacteria | 38948 |
| 429 | Ga0495672_0000812 | 3300047320 | Bacteria | 33655 |
| 430 | Ga0495672_0027421 | 3300047320 | Bacteria | 3620 |
| 431 | Ga0495676_0004991 | 3300047321 | Bacteria | 12170 |
| 432 | Ga0495676_0008113 | 3300047321 | Bacteria | 9635 |
| 433 | Ga0495676_0046308 | 3300047321 | Bacteria | 3530 |
| 434 | Ga0495680_0031012 | 3300047322 | Bacteria | 4356 |
| 435 | Ga0495680_0061202 | 3300047322 | Bacteria | 2897 |
| 436 | Ga0495680_0100885 | 3300047322 | Bacteria | 2150 |
| 437 | Ga0495680_0179584 | 3300047322 | Bacteria | 1528 |
| 438 | Ga0495683_0001032 | 3300047323 | Bacteria | 19350 |
| 439 | Ga0495687_012893 | 3300047443 | Bacteria | 4392 |
| 440 | Ga0495687_040302 | 3300047443 | Bacteria | 2059 |
| 441 | Ga0495675_0011807 | 3300047444 | Bacteria | 5487 |
| 442 | Ga0495675_0156968 | 3300047444 | Bacteria | 1403 |
| 443 | Ga0495677_0105630 | 3300047445 | Bacteria | 1068 |
| 444 | Ga0495684_0011608 | 3300047471 | Bacteria | 6801 |
| 445 | Ga0495684_0062447 | 3300047471 | Bacteria | 2834 |
| 446 | Ga0495684_0134742 | 3300047471 | Unclassified | 1854 |
| 447 | Ga0495684_0276279 | 3300047471 | Unclassified | 1214 |
| 448 | Ga0495593_0000027 | 3300047673 | Bacteria | 61044 |
| 449 | Ga0495593_0004260 | 3300047673 | Bacteria | 8510 |
| 450 | Ga0495593_0034446 | 3300047673 | Bacteria | 2754 |
| 451 | Ga0495593_0062375 | 3300047673 | Bacteria | 1948 |
| 452 | Ga0495593_0263648 | 3300047673 | Unclassified | 862 |
| 453 | Ga0495602_0001002 | 3300048088 | Bacteria | 27473 |
| 454 | Ga0495602_0001754 | 3300048088 | Bacteria | 21653 |
| 455 | Ga0495602_0098309 | 3300048088 | Bacteria | 2409 |
| 456 | Ga0495614_0003495 | 3300048089 | Bacteria | 7032 |
| 457 | Ga0495614_0013887 | 3300048089 | Bacteria | 3530 |
| 458 | Ga0495626_0000031 | 3300048091 | Bacteria | 197930 |
| 459 | Ga0496100_0008393 | 3300048903 | Bacteria | 5760 |
| 460 | Ga0496100_0068248 | 3300048903 | Bacteria | 2364 |
| 461 | Ga0496100_0213528 | 3300048903 | Bacteria | 1413 |
| 462 | Ga0496101_0051221 | 3300048904 | Bacteria | 2974 |
| 463 | Ga0496101_0184560 | 3300048904 | Unclassified | 1607 |
| 464 | Ga0496101_0601091 | 3300048904 | Bacteria | 870 |
| 465 | Ga0496102_0211671 | 3300048905 | Bacteria | 1827 |
| 466 | Ga0496102_0223391 | 3300048905 | Bacteria | 1776 |
| 467 | Ga0496102_0383496 | 3300048905 | Unclassified | 1322 |
| 468 | Ga0496102_0643073 | 3300048905 | Bacteria | 984 |
| 469 | Ga0496103_0019803 | 3300048906 | Bacteria | 4039 |
| 470 | Ga0496104_0001007 | 3300048907 | Bacteria | 24144 |
| 471 | Ga0496104_0006712 | 3300048907 | Bacteria | 10131 |
| 472 | Ga0496104_0007532 | 3300048907 | Bacteria | 9625 |
| 473 | Ga0496104_0095288 | 3300048907 | Bacteria | 2847 |
| 474 | Ga0496104_0263178 | 3300048907 | Unclassified | 1637 |
| 475 | Ga0496105_0004762 | 3300048908 | Bacteria | 10245 |
| 476 | Ga0496105_0028641 | 3300048908 | Bacteria | 4555 |
| 477 | Ga0496105_0048875 | 3300048908 | Bacteria | 3492 |
| 478 | Ga0496105_0086078 | 3300048908 | Bacteria | 2597 |
| 479 | Ga0496105_0104999 | 3300048908 | Bacteria | 2332 |
| 480 | Ga0496105_0600029 | 3300048908 | Unclassified | 854 |
| 481 | Ga0496106_0000863 | 3300048909 | Bacteria | 22031 |
| 482 | Ga0496106_0022280 | 3300048909 | Bacteria | 4706 |
| 483 | Ga0496106_0024081 | 3300048909 | Bacteria | 4525 |
| 484 | Ga0496106_0673752 | 3300048909 | Bacteria | 825 |
| 485 | Ga0496107_0000335 | 3300048910 | Bacteria | 25483 |
| 486 | Ga0496107_0168941 | 3300048910 | Unclassified | 1622 |
| 487 | Ga0496108_0221625 | 3300048911 | Unclassified | 1643 |
| 488 | Ga0496108_0287883 | 3300048911 | Bacteria | 1430 |
| 489 | Ga0496109_0001209 | 3300048912 | Bacteria | 21496 |
| 490 | Ga0496109_0087462 | 3300048912 | Bacteria | 2878 |
| 491 | Ga0496109_0306336 | 3300048912 | Unclassified | 1498 |
| 492 | Ga0496109_0333321 | 3300048912 | Bacteria | 1433 |
| 493 | Ga0496110_0017292 | 3300048913 | Bacteria | 6032 |
| 494 | Ga0496110_0030722 | 3300048913 | Bacteria | 4632 |
| 495 | Ga0496111_0004625 | 3300048914 | Bacteria | 8708 |
| 496 | Ga0496111_0572811 | 3300048914 | Bacteria | 828 |
| 497 | Ga0496112_0004925 | 3300048915 | Bacteria | 11427 |
| 498 | Ga0496112_0009884 | 3300048915 | Bacteria | 8625 |
| 499 | Ga0496112_0103191 | 3300048915 | Bacteria | 2821 |
| 500 | Ga0496112_0151828 | 3300048915 | Bacteria | 2283 |
| 501 | Ga0496113_0009192 | 3300048916 | Bacteria | 6481 |
| 502 | Ga0496113_0012627 | 3300048916 | Bacteria | 5684 |
| 503 | Ga0496113_0169198 | 3300048916 | Bacteria | 1730 |
| 504 | Ga0496114_0001714 | 3300048917 | Bacteria | 16643 |
| 505 | Ga0496114_0164119 | 3300048917 | Bacteria | 1933 |
| 506 | Ga0496114_0302278 | 3300048917 | Bacteria | 1413 |
| 507 | Ga0496115_0028050 | 3300048918 | Bacteria | 4409 |
| 508 | Ga0496115_0230446 | 3300048918 | Unclassified | 1527 |
| 509 | Ga0496116_0000475 | 3300048919 | Bacteria | 55484 |
| 510 | Ga0496117_0067204 | 3300048920 | Bacteria | 2427 |
| 511 | Ga0496118_0049421 | 3300048921 | Bacteria | 3239 |
| 512 | Ga0496119_0050936 | 3300048922 | Bacteria | 2548 |
| 513 | Ga0496119_0140469 | 3300048922 | Bacteria | 1305 |
| 514 | Ga0496120_0072409 | 3300048923 | Bacteria | 1888 |
| 515 | Ga0496121_0065408 | 3300048924 | Bacteria | 2958 |
| 516 | Ga0496121_0135308 | 3300048924 | Bacteria | 1837 |
| 517 | Ga0496122_0064776 | 3300048925 | Bacteria | 2656 |
| 518 | Ga0496124_0000276 | 3300048927 | Bacteria | 98406 |
| 519 | Ga0496125_0000410 | 3300048928 | Bacteria | 80395 |
| 520 | Ga0496125_0084190 | 3300048928 | Bacteria | 2416 |
| 521 | Ga0496126_0000692 | 3300048929 | Bacteria | 61735 |
| 522 | Ga0496126_0007448 | 3300048929 | Bacteria | 12000 |
| 523 | Ga0495678_016249 | 3300049459 | Bacteria | 3407 |
| 524 | Ga0501032_0012180 | 3300049569 | Bacteria | 6157 |
| 525 | Ga0501032_0296831 | 3300049569 | Bacteria | 1045 |
| 526 | Ga0501033_0010195 | 3300049570 | Bacteria | 7215 |
| 527 | Ga0501033_0118071 | 3300049570 | Bacteria | 1927 |
| 528 | Ga0501036_0017682 | 3300049572 | Bacteria | 5966 |
| 529 | Ga0501036_0264466 | 3300049572 | Bacteria | 1441 |
| 530 | Ga0501036_0304055 | 3300049572 | Bacteria | 1334 |
| 531 | Ga0501038_0637537 | 3300049574 | Bacteria | 803 |
| 532 | Ga0501039_0016498 | 3300049575 | Bacteria | 5658 |
| 533 | Ga0501040_0003790 | 3300049576 | Bacteria | 9808 |
| 534 | Ga0501040_0620474 | 3300049576 | Bacteria | 781 |
| 535 | Ga0501040_1025323 | 3300049576 | Unclassified | 598 |
| 536 | Ga0501042_0108705 | 3300049578 | Bacteria | 1996 |
| 537 | Ga0501046_0224960 | 3300049580 | Bacteria | 1388 |
| 538 | Ga0501047_0017651 | 3300049581 | Bacteria | 6838 |
| 539 | Ga0501047_0194507 | 3300049581 | Bacteria | 1891 |
| 540 | Ga0501047_0228860 | 3300049581 | Bacteria | 1713 |
| 541 | Ga0501047_0319747 | 3300049581 | Bacteria | 1392 |
| 542 | Ga0501047_0350695 | 3300049581 | Bacteria | 1313 |
| 543 | Ga0501047_0486066 | 3300049581 | Bacteria | 1062 |
| 544 | Ga0501048_0225958 | 3300049582 | Bacteria | 1328 |
| 545 | Ga0501067_0427701 | 3300049583 | Bacteria | 739 |
| 546 | Ga0501068_0055248 | 3300049584 | Bacteria | 2406 |
| 547 | Ga0501069_0776631 | 3300049585 | Bacteria | 580 |
| 548 | Ga0501071_0404233 | 3300049587 | Bacteria | 1043 |
| 549 | Ga0501071_0707830 | 3300049587 | Bacteria | 775 |
| 550 | Ga0501072_0016230 | 3300049588 | Bacteria | 5712 |
| 551 | Ga0501073_0300131 | 3300049589 | Bacteria | 1108 |
| 552 | Ga0501074_0194631 | 3300049590 | Bacteria | 1445 |
| 553 | Ga0501075_0191370 | 3300049591 | Bacteria | 1560 |
| 554 | Ga0501076_0023267 | 3300049592 | Bacteria | 4774 |
| 555 | Ga0501077_0306069 | 3300049593 | Unclassified | 1013 |
| 556 | Ga0501079_0084490 | 3300049741 | Bacteria | 2455 |
| 557 | Ga0501080_0039237 | 3300049742 | Bacteria | 4420 |
| 558 | Ga0501080_0159783 | 3300049742 | Bacteria | 2081 |
| 559 | Ga0501080_0429600 | 3300049742 | Bacteria | 1186 |
| 560 | Ga0501081_0021144 | 3300049743 | Bacteria | 4342 |
| 561 | Ga0501083_0004796 | 3300049744 | Bacteria | 9554 |
| 562 | Ga0501083_0566618 | 3300049744 | Bacteria | 739 |
| 563 | Ga0501035_0055996 | 3300049822 | Bacteria | 3520 |
| 564 | Ga0501044_0017674 | 3300049823 | Bacteria | 7649 |
| 565 | Ga0501044_0056519 | 3300049823 | Bacteria | 4030 |
| 566 | Ga0501045_0044084 | 3300049824 | Bacteria | 3248 |
| 567 | nmdc:mga06r32_353361_c1 | 3300050510 | Unclassified | 1454 |
| 568 | nmdc:mga08y16_84366_c1 | 3300050511 | Bacteria | 3311 |
| 569 | nmdc:mga0n895_175627_c1 | 3300050512 | Bacteria | 2173 |
| 570 | nmdc:mga0a205_756561_c1 | 3300050515 | Unclassified | 820 |
| 571 | Ga0495601_0000609 | 3300053077 | Bacteria | 19047 |
| 572 | Ga0495601_0016010 | 3300053077 | Bacteria | 4537 |
| 573 | Ga0495612_0006154 | 3300053078 | Bacteria | 4937 |
| 574 | Ga0495612_0027440 | 3300053078 | Bacteria | 2289 |
| 575 | Ga0495595_0010669 | 3300053084 | Bacteria | 3825 |
| 576 | Ga0495595_0058724 | 3300053084 | Bacteria | 1797 |
| 577 | Ga0495595_0161586 | 3300053084 | Bacteria | 1105 |
| 578 | Ga0495619_0001480 | 3300053085 | Bacteria | 15482 |
| 579 | Ga0495619_0018742 | 3300053085 | Bacteria | 4393 |
| 580 | Ga0495619_0037144 | 3300053085 | Bacteria | 3173 |
| 581 | Ga0495619_0284675 | 3300053085 | Bacteria | 1145 |
| 582 | Ga0495619_0416708 | 3300053085 | Unclassified | 927 |
| 583 | Ga0500642_0033395 | 3300053130 | Bacteria | 2167 |
| 584 | Ga0500590_015365 | 3300053148 | Bacteria | 3949 |
| 585 | Ga0500619_001257 | 3300053154 | Unclassified | 4432 |
| 586 | Ga0500552_003183 | 3300053733 | Bacteria | 1649 |
| 587 | Ga0501084_0741928 | 3300054114 | Unclassified | 827 |
| 588 | Ga0501082_0035477 | 3300060353 | Bacteria | 4299 |
| 589 | Ga0530510_0029111 | 3300061734 | Bacteria | 3963 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025972 | Ga0207668_11300539 | Ga0207668_113005392 | 138 |
| 2 | 3300049574 | Ga0501038_0637537 | Ga0501038_0637537_230_757 | 147 |
| 3 | 3300049822 | Ga0501035_0055996 | Ga0501035_0055996_43_570 | 147 |
| 4 | 3300028800 | Ga0265338_10008670 | Ga0265338_100086702 | 148 |
| 5 | 3300031241 | Ga0265325_10002245 | Ga0265325_100022454 | 148 |
| 6 | 3300031595 | Ga0265313_10002174 | Ga0265313_100021748 | 148 |
| 7 | 3300049742 | Ga0501080_0429600 | Ga0501080_0429600_23_613 | 150 |
| 8 | 3300005340 | Ga0070689_100018682 | Ga0070689_1000186825 | 155 |
| 9 | 3300005356 | Ga0070674_100137225 | Ga0070674_1001372252 | 155 |
| 10 | 3300005364 | Ga0070673_100235622 | Ga0070673_1002356222 | 155 |
| 11 | 3300005365 | Ga0070688_100091397 | Ga0070688_1000913972 | 155 |
| 12 | 3300005366 | Ga0070659_100526369 | Ga0070659_1005263691 | 155 |
| 13 | 3300005367 | Ga0070667_100101487 | Ga0070667_1001014872 | 155 |
| 14 | 3300005438 | Ga0070701_10142287 | Ga0070701_101422872 | 155 |
| 15 | 3300005441 | Ga0070700_100363390 | Ga0070700_1003633902 | 155 |
| 16 | 3300005456 | Ga0070678_100558940 | Ga0070678_1005589402 | 155 |
| 17 | 3300005459 | Ga0068867_100128868 | Ga0068867_1001288682 | 155 |
| 18 | 3300005466 | Ga0070685_10041721 | Ga0070685_100417212 | 155 |
| 19 | 3300005547 | Ga0070693_100153188 | Ga0070693_1001531881 | 155 |
| 20 | 3300005548 | Ga0070665_100046791 | Ga0070665_1000467912 | 155 |
| 21 | 3300005549 | Ga0070704_100868870 | Ga0070704_1008688701 | 155 |
| 22 | 3300005614 | Ga0068856_100460178 | Ga0068856_1004601782 | 155 |
| 23 | 3300005617 | Ga0068859_100191916 | Ga0068859_1001919162 | 155 |
| 24 | 3300005841 | Ga0068863_100095000 | Ga0068863_1000950003 | 155 |
| 25 | 3300005842 | Ga0068858_100458017 | Ga0068858_1004580172 | 155 |
| 26 | 3300006881 | Ga0068865_100054968 | Ga0068865_1000549682 | 155 |
| 27 | 3300006931 | Ga0097620_100191908 | Ga0097620_1001919082 | 155 |
| 28 | 3300009098 | Ga0105245_10314625 | Ga0105245_103146252 | 155 |
| 29 | 3300009101 | Ga0105247_10046816 | Ga0105247_100468162 | 155 |
| 30 | 3300009177 | Ga0105248_10889058 | Ga0105248_108890582 | 155 |
| 31 | 3300010375 | Ga0105239_11446016 | Ga0105239_114460161 | 155 |
| 32 | 3300013297 | Ga0157378_10130732 | Ga0157378_101307323 | 155 |
| 33 | 3300013308 | Ga0157375_10001815 | Ga0157375_100018153 | 155 |
| 34 | 3300014325 | Ga0163163_10148886 | Ga0163163_101488863 | 155 |
| 35 | 3300014326 | Ga0157380_10593624 | Ga0157380_105936242 | 155 |
| 36 | 3300014968 | Ga0157379_10049322 | Ga0157379_100493222 | 155 |
| 37 | 3300014969 | Ga0157376_10012349 | Ga0157376_100123492 | 155 |
| 38 | 3300025903 | Ga0207680_10348020 | Ga0207680_103480201 | 155 |
| 39 | 3300025916 | Ga0207663_10312466 | Ga0207663_103124662 | 155 |
| 40 | 3300025938 | Ga0207704_10173124 | Ga0207704_101731242 | 155 |
| 41 | 3300025941 | Ga0207711_10253593 | Ga0207711_102535932 | 155 |
| 42 | 3300025960 | Ga0207651_10205079 | Ga0207651_102050792 | 155 |
| 43 | 3300026035 | Ga0207703_10125286 | Ga0207703_101252862 | 155 |
| 44 | 3300026075 | Ga0207708_10402384 | Ga0207708_104023841 | 155 |
| 45 | 3300026078 | Ga0207702_10264305 | Ga0207702_102643052 | 155 |
| 46 | 3300026089 | Ga0207648_10251628 | Ga0207648_102516282 | 155 |
| 47 | 3300028379 | Ga0268266_10052714 | Ga0268266_100527142 | 155 |
| 48 | 3300046459 | Ga0495629_0001160 | Ga0495629_0001160_4645_5220 | 155 |
| 49 | 3300046462 | Ga0495651_0009486 | Ga0495651_0009486_5525_6100 | 155 |
| 50 | 3300046473 | Ga0495582_0409330 | Ga0495582_0409330_63_638 | 155 |
| 51 | 3300046499 | Ga0495594_0269411 | Ga0495594_0269411_226_801 | 155 |
| 52 | 3300046531 | Ga0495665_0176238 | Ga0495665_0176238_340_915 | 155 |
| 53 | 3300046533 | Ga0495640_0024203 | Ga0495640_0024203_751_1326 | 155 |
| 54 | 3300046559 | Ga0495667_0152101 | Ga0495667_0152101_90_665 | 155 |
| 55 | 3300046642 | Ga0495634_0181757 | Ga0495634_0181757_527_1102 | 155 |
| 56 | 3300046663 | Ga0495635_0001253 | Ga0495635_0001253_13951_14526 | 155 |
| 57 | 3300046675 | Ga0495657_0036967 | Ga0495657_0036967_232_807 | 155 |
| 58 | 3300046680 | Ga0495646_0054495 | Ga0495646_0054495_1642_2217 | 155 |
| 59 | 3300046689 | Ga0495613_0028330 | Ga0495613_0028330_2874_3449 | 155 |
| 60 | 3300046690 | Ga0495624_0007255 | Ga0495624_0007255_1649_2224 | 155 |
| 61 | 3300046809 | Ga0495600_0238432 | Ga0495600_0238432_489_1064 | 155 |
| 62 | 3300047315 | Ga0495581_0077905 | Ga0495581_0077905_879_1454 | 155 |
| 63 | 3300047317 | Ga0495604_0005654 | Ga0495604_0005654_1072_1647 | 155 |
| 64 | 3300047321 | Ga0495676_0008113 | Ga0495676_0008113_3212_3787 | 155 |
| 65 | 3300047673 | Ga0495593_0062375 | Ga0495593_0062375_1104_1679 | 155 |
| 66 | 3300048903 | Ga0496100_0008393 | Ga0496100_0008393_4830_5408 | 155 |
| 67 | 3300048904 | Ga0496101_0051221 | Ga0496101_0051221_1124_1702 | 155 |
| 68 | 3300048904 | Ga0496101_0601091 | Ga0496101_0601091_169_744 | 155 |
| 69 | 3300048905 | Ga0496102_0211671 | Ga0496102_0211671_425_1003 | 155 |
| 70 | 3300048905 | Ga0496102_0643073 | Ga0496102_0643073_173_748 | 155 |
| 71 | 3300048907 | Ga0496104_0001007 | Ga0496104_0001007_9651_10226 | 155 |
| 72 | 3300048907 | Ga0496104_0006712 | Ga0496104_0006712_8635_9213 | 155 |
| 73 | 3300048908 | Ga0496105_0028641 | Ga0496105_0028641_3883_4458 | 155 |
| 74 | 3300048908 | Ga0496105_0104999 | Ga0496105_0104999_836_1414 | 155 |
| 75 | 3300048909 | Ga0496106_0000863 | Ga0496106_0000863_2529_3107 | 155 |
| 76 | 3300048909 | Ga0496106_0673752 | Ga0496106_0673752_222_800 | 155 |
| 77 | 3300048910 | Ga0496107_0000335 | Ga0496107_0000335_20691_21269 | 155 |
| 78 | 3300048911 | Ga0496108_0287883 | Ga0496108_0287883_322_900 | 155 |
| 79 | 3300048912 | Ga0496109_0087462 | Ga0496109_0087462_1198_1776 | 155 |
| 80 | 3300048912 | Ga0496109_0333321 | Ga0496109_0333321_538_1116 | 155 |
| 81 | 3300048915 | Ga0496112_0151828 | Ga0496112_0151828_643_1221 | 155 |
| 82 | 3300048916 | Ga0496113_0012627 | Ga0496113_0012627_2109_2687 | 155 |
| 83 | 3300048916 | Ga0496113_0169198 | Ga0496113_0169198_963_1538 | 155 |
| 84 | 3300048917 | Ga0496114_0001714 | Ga0496114_0001714_8379_8957 | 155 |
| 85 | 3300048917 | Ga0496114_0302278 | Ga0496114_0302278_708_1283 | 155 |
| 86 | 3300048918 | Ga0496115_0028050 | Ga0496115_0028050_2061_2639 | 155 |
| 87 | 3300048921 | Ga0496118_0049421 | Ga0496118_0049421_2621_3196 | 155 |
| 88 | 3300048922 | Ga0496119_0050936 | Ga0496119_0050936_601_1176 | 155 |
| 89 | 3300048923 | Ga0496120_0072409 | Ga0496120_0072409_1110_1685 | 155 |
| 90 | 3300048924 | Ga0496121_0135308 | Ga0496121_0135308_847_1422 | 155 |
| 91 | 3300048928 | Ga0496125_0084190 | Ga0496125_0084190_1100_1675 | 155 |
| 92 | 3300048929 | Ga0496126_0007448 | Ga0496126_0007448_5195_5770 | 155 |
| 93 | 3300053085 | Ga0495619_0037144 | Ga0495619_0037144_1836_2411 | 155 |
| 94 | 3300053733 | Ga0500552_003183 | Ga0500552_003183_691_1266 | 155 |
| 95 | 3300049569 | Ga0501032_0012180 | Ga0501032_0012180_1378_2058 | 156 |
| 96 | 3300046461 | Ga0495641_0260296 | Ga0495641_0260296_38_535 | 165 |
| 97 | 3300035111 | Ga0373923_0464083 | Ga0373923_0464083_13_546 | 173 |
| 98 | 3300049585 | Ga0501069_0776631 | Ga0501069_0776631_17_538 | 173 |
| 99 | 3300049587 | Ga0501071_0707830 | Ga0501071_0707830_14_553 | 173 |
| 100 | 3300049744 | Ga0501083_0566618 | Ga0501083_0566618_14_553 | 173 |
| 101 | 3300028577 | Ga0265318_10015864 | Ga0265318_100158642 | 174 |
| 102 | 3300028666 | Ga0265336_10000834 | Ga0265336_1000083416 | 174 |
| 103 | 3300048088 | Ga0495602_0098309 | Ga0495602_0098309_1304_1846 | 175 |
| 104 | 3300009011 | Ga0105251_10003826 | Ga0105251_1000382610 | 178 |
| 105 | iso_pu_bacteria | 2929297113 | 2929298066 | 178 |
| 106 | iso_pu_bacteria | 2599185354 | 2600202735 | 181 |
| 107 | iso_pu_bacteria | 2849076700 | 2849081355 | 181 |
| 108 | 3300031240 | Ga0265320_10329145 | Ga0265320_103291451 | 182 |
| 109 | 3300031344 | Ga0265316_10028640 | Ga0265316_100286405 | 182 |
| 110 | 3300044673 | Ga0453683_0002374 | Ga0453683_0002374_12923_13486 | 182 |
| 111 | iso_pu_bacteria | 2619619299 | 2621299688 | 182 |
| 112 | iso_pu_bacteria | 2623620446 | 2624491291 | 182 |
| 113 | iso_pu_bacteria | 2738541265 | 2738669688 | 182 |
| 114 | iso_pu_bacteria | 2738541282 | 2738748081 | 182 |
| 115 | iso_pu_bacteria | 2738541303 | 2738857123 | 182 |
| 116 | iso_pu_bacteria | 2808606377 | 2808929668 | 182 |
| 117 | iso_pu_bacteria | 2808606381 | 2808951753 | 182 |
| 118 | iso_pu_bacteria | 2808606382 | 2808958560 | 182 |
| 119 | iso_pu_bacteria | 2816332298 | 2817491040 | 182 |
| 120 | iso_pu_bacteria | 2883354860 | 2883357989 | 182 |
| 121 | iso_pu_bacteria | 2919456309 | 2919460743 | 182 |
| 122 | iso_pu_bacteria | 2919697872 | 2919701203 | 182 |
| 123 | iso_pu_bacteria | 8019775933 | 8019778189 | 182 |
| 124 | 3300009545 | Ga0105237_10594786 | Ga0105237_105947861 | 183 |
| 125 | 3300025914 | Ga0207671_10383044 | Ga0207671_103830442 | 183 |
| 126 | 3300031240 | Ga0265320_10158751 | Ga0265320_101587512 | 183 |
| 127 | 3300031251 | Ga0265327_10008070 | Ga0265327_100080703 | 183 |
| 128 | 3300003762 | Ga0055542_1000115 | Ga0055542_100011515 | 184 |
| 129 | 3300003763 | Ga0055529_1000052 | Ga0055529_1000052168 | 184 |
| 130 | 3300009093 | Ga0105240_10007067 | Ga0105240_100070677 | 184 |
| 131 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011379 | 184 |
| 132 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006815 | 184 |
| 133 | 3300025913 | Ga0207695_10026021 | Ga0207695_100260217 | 184 |
| 134 | 3300031247 | Ga0265340_10123955 | Ga0265340_101239552 | 184 |
| 135 | 3300031249 | Ga0265339_10004588 | Ga0265339_1000458812 | 184 |
| 136 | 3300049581 | Ga0501047_0194507 | Ga0501047_0194507_248_802 | 184 |
| 137 | 3300053154 | Ga0500619_001257 | Ga0500619_001257_3624_4178 | 184 |
| 138 | 3300003323 | rootH1_10340779 | rootH1_103407792 | 185 |
| 139 | 3300005327 | Ga0070658_10091916 | Ga0070658_100919165 | 185 |
| 140 | 3300005344 | Ga0070661_100000062 | Ga0070661_10000006242 | 185 |
| 141 | 3300005434 | Ga0070709_10045336 | Ga0070709_100453362 | 185 |
| 142 | 3300005439 | Ga0070711_100142083 | Ga0070711_1001420832 | 185 |
| 143 | 3300005564 | Ga0070664_100000035 | Ga0070664_10000003543 | 185 |
| 144 | 3300006175 | Ga0070712_100284842 | Ga0070712_1002848421 | 185 |
| 145 | 3300009036 | Ga0105244_10000616 | Ga0105244_1000061610 | 185 |
| 146 | 3300009176 | Ga0105242_10000647 | Ga0105242_1000064719 | 185 |
| 147 | 3300009545 | Ga0105237_10000042 | Ga0105237_1000004235 | 185 |
| 148 | 3300011119 | Ga0105246_10020064 | Ga0105246_100200641 | 185 |
| 149 | 3300013100 | Ga0157373_10017195 | Ga0157373_100171952 | 185 |
| 150 | 3300013105 | Ga0157369_10000251 | Ga0157369_1000025147 | 185 |
| 151 | 3300013308 | Ga0157375_10001383 | Ga0157375_1000138315 | 185 |
| 152 | 3300025728 | Ga0207655_1000070 | Ga0207655_1000070110 | 185 |
| 153 | 3300025906 | Ga0207699_10054812 | Ga0207699_100548121 | 185 |
| 154 | 3300025914 | Ga0207671_10002005 | Ga0207671_1000200520 | 185 |
| 155 | 3300025915 | Ga0207693_10115942 | Ga0207693_101159423 | 185 |
| 156 | 3300025916 | Ga0207663_10093522 | Ga0207663_100935222 | 185 |
| 157 | 3300025916 | Ga0207663_10362537 | Ga0207663_103625372 | 185 |
| 158 | 3300025920 | Ga0207649_10000010 | Ga0207649_10000010129 | 185 |
| 159 | 3300025928 | Ga0207700_10356204 | Ga0207700_103562042 | 185 |
| 160 | 3300025929 | Ga0207664_10319872 | Ga0207664_103198722 | 185 |
| 161 | 3300025934 | Ga0207686_10051753 | Ga0207686_100517532 | 185 |
| 162 | 3300025945 | Ga0207679_10000022 | Ga0207679_1000002245 | 185 |
| 163 | 3300031235 | Ga0265330_10000120 | Ga0265330_1000012028 | 185 |
| 164 | 3300031235 | Ga0265330_10108894 | Ga0265330_101088941 | 185 |
| 165 | 3300031238 | Ga0265332_10088531 | Ga0265332_100885312 | 185 |
| 166 | 3300031249 | Ga0265339_10007688 | Ga0265339_100076882 | 185 |
| 167 | 3300031344 | Ga0265316_10005418 | Ga0265316_1000541814 | 185 |
| 168 | 3300031344 | Ga0265316_10268758 | Ga0265316_102687582 | 185 |
| 169 | 3300031712 | Ga0265342_10000077 | Ga0265342_1000007724 | 185 |
| 170 | 3300031712 | Ga0265342_10141210 | Ga0265342_101412101 | 185 |
| 171 | 3300035083 | Ga0373926_0046897 | Ga0373926_0046897_314_871 | 185 |
| 172 | 3300035083 | Ga0373926_0204140 | Ga0373926_0204140_121_681 | 185 |
| 173 | 3300035089 | Ga0373944_0014604 | Ga0373944_0014604_957_1514 | 185 |
| 174 | 3300035111 | Ga0373923_0005760 | Ga0373923_0005760_443_1000 | 185 |
| 175 | 3300035113 | Ga0373936_0060000 | Ga0373936_0060000_718_1275 | 185 |
| 176 | 3300035116 | Ga0373945_0009912 | Ga0373945_0009912_2318_2875 | 185 |
| 177 | 3300035118 | Ga0373954_0077539 | Ga0373954_0077539_882_1439 | 185 |
| 178 | 3300035118 | Ga0373954_0078330 | Ga0373954_0078330_752_1309 | 185 |
| 179 | 3300035119 | Ga0373956_0031374 | Ga0373956_0031374_1047_1631 | 185 |
| 180 | 3300035119 | Ga0373956_0032297 | Ga0373956_0032297_179_736 | 185 |
| 181 | 3300035171 | Ga0373946_0096092 | Ga0373946_0096092_644_1201 | 185 |
| 182 | 3300035171 | Ga0373946_0107116 | Ga0373946_0107116_334_891 | 185 |
| 183 | 3300035172 | Ga0373955_0204501 | Ga0373955_0204501_226_783 | 185 |
| 184 | 3300035172 | Ga0373955_0418250 | Ga0373955_0418250_178_738 | 185 |
| 185 | 3300035172 | Ga0373955_0544514 | Ga0373955_0544514_96_665 | 185 |
| 186 | 3300035410 | Ga0373924_0061685 | Ga0373924_0061685_54_611 | 185 |
| 187 | 3300035410 | Ga0373924_0327067 | Ga0373924_0327067_31_600 | 185 |
| 188 | 3300035692 | Ga0373935_0081917 | Ga0373935_0081917_64_624 | 185 |
| 189 | 3300035692 | Ga0373935_0157308 | Ga0373935_0157308_344_901 | 185 |
| 190 | 3300035695 | Ga0373927_0000531 | Ga0373927_0000531_18545_19102 | 185 |
| 191 | 3300035695 | Ga0373927_0031121 | Ga0373927_0031121_1845_2405 | 185 |
| 192 | 3300035695 | Ga0373927_0343454 | Ga0373927_0343454_326_883 | 185 |
| 193 | 3300035724 | Ga0373933_0048833 | Ga0373933_0048833_1835_2392 | 185 |
| 194 | 3300035724 | Ga0373933_0064709 | Ga0373933_0064709_602_1162 | 185 |
| 195 | 3300035725 | Ga0373947_0006667 | Ga0373947_0006667_3642_4202 | 185 |
| 196 | 3300035725 | Ga0373947_0190049 | Ga0373947_0190049_40_597 | 185 |
| 197 | 3300036401 | Ga0373937_0017555 | Ga0373937_0017555_4082_4639 | 185 |
| 198 | 3300036401 | Ga0373937_0029798 | Ga0373937_0029798_1051_1635 | 185 |
| 199 | 3300036401 | Ga0373937_0078354 | Ga0373937_0078354_2078_2635 | 185 |
| 200 | 3300036401 | Ga0373937_0275408 | Ga0373937_0275408_498_1067 | 185 |
| 201 | 3300037068 | Ga0373925_0010890 | Ga0373925_0010890_4332_4892 | 185 |
| 202 | 3300037068 | Ga0373925_0079430 | Ga0373925_0079430_154_717 | 185 |
| 203 | 3300037588 | Ga0316581_0102560 | Ga0316581_0102560_207_782 | 185 |
| 204 | 3300044712 | Ga0453684_0028695 | Ga0453684_0028695_6562_7167 | 185 |
| 205 | 3300044712 | Ga0453684_0058493 | Ga0453684_0058493_1299_1904 | 185 |
| 206 | 3300046454 | Ga0495592_0026791 | Ga0495592_0026791_3738_4295 | 185 |
| 207 | 3300046455 | Ga0495603_0000079 | Ga0495603_0000079_9950_10510 | 185 |
| 208 | 3300046455 | Ga0495603_0152359 | Ga0495603_0152359_199_756 | 185 |
| 209 | 3300046459 | Ga0495629_0046341 | Ga0495629_0046341_65_625 | 185 |
| 210 | 3300046459 | Ga0495629_0057351 | Ga0495629_0057351_1120_1677 | 185 |
| 211 | 3300046461 | Ga0495641_0010464 | Ga0495641_0010464_3387_3947 | 185 |
| 212 | 3300046462 | Ga0495651_0015833 | Ga0495651_0015833_2297_2854 | 185 |
| 213 | 3300046463 | Ga0495653_0154294 | Ga0495653_0154294_364_921 | 185 |
| 214 | 3300046472 | Ga0495580_0013487 | Ga0495580_0013487_5531_6091 | 185 |
| 215 | 3300046472 | Ga0495580_0383220 | Ga0495580_0383220_370_927 | 185 |
| 216 | 3300046473 | Ga0495582_0004208 | Ga0495582_0004208_3900_4460 | 185 |
| 217 | 3300046473 | Ga0495582_0130561 | Ga0495582_0130561_785_1342 | 185 |
| 218 | 3300046475 | Ga0495639_0007964 | Ga0495639_0007964_3802_4362 | 185 |
| 219 | 3300046475 | Ga0495639_0168221 | Ga0495639_0168221_116_673 | 185 |
| 220 | 3300046476 | Ga0495662_0019513 | Ga0495662_0019513_350_907 | 185 |
| 221 | 3300046477 | Ga0495664_0013914 | Ga0495664_0013914_1435_2019 | 185 |
| 222 | 3300046477 | Ga0495664_0208562 | Ga0495664_0208562_508_1065 | 185 |
| 223 | 3300046499 | Ga0495594_0000174 | Ga0495594_0000174_8087_8647 | 185 |
| 224 | 3300046499 | Ga0495594_0059043 | Ga0495594_0059043_416_973 | 185 |
| 225 | 3300046511 | Ga0495608_0094976 | Ga0495608_0094976_297_881 | 185 |
| 226 | 3300046514 | Ga0495618_0014757 | Ga0495618_0014757_1481_2038 | 185 |
| 227 | 3300046514 | Ga0495618_0109570 | Ga0495618_0109570_1104_1673 | 185 |
| 228 | 3300046516 | Ga0495628_0114368 | Ga0495628_0114368_73_630 | 185 |
| 229 | 3300046517 | Ga0495630_0046260 | Ga0495630_0046260_1756_2313 | 185 |
| 230 | 3300046517 | Ga0495630_0069497 | Ga0495630_0069497_1184_1741 | 185 |
| 231 | 3300046526 | Ga0495666_0016705 | Ga0495666_0016705_1887_2444 | 185 |
| 232 | 3300046526 | Ga0495666_0022879 | Ga0495666_0022879_196_756 | 185 |
| 233 | 3300046529 | Ga0495652_0029539 | Ga0495652_0029539_1157_1714 | 185 |
| 234 | 3300046531 | Ga0495665_0115652 | Ga0495665_0115652_32_589 | 185 |
| 235 | 3300046533 | Ga0495640_0040613 | Ga0495640_0040613_1922_2479 | 185 |
| 236 | 3300046533 | Ga0495640_0157023 | Ga0495640_0157023_169_753 | 185 |
| 237 | 3300046533 | Ga0495640_0197425 | Ga0495640_0197425_371_928 | 185 |
| 238 | 3300046535 | Ga0495586_0059336 | Ga0495586_0059336_1047_1604 | 185 |
| 239 | 3300046536 | Ga0495587_0015330 | Ga0495587_0015330_2851_3435 | 185 |
| 240 | 3300046536 | Ga0495587_0262146 | Ga0495587_0262146_156_713 | 185 |
| 241 | 3300046537 | Ga0495598_0331314 | Ga0495598_0331314_11_568 | 185 |
| 242 | 3300046543 | Ga0495645_0007180 | Ga0495645_0007180_543_1127 | 185 |
| 243 | 3300046543 | Ga0495645_0423307 | Ga0495645_0423307_226_783 | 185 |
| 244 | 3300046557 | Ga0495622_0001062 | Ga0495622_0001062_5231_5791 | 185 |
| 245 | 3300046557 | Ga0495622_0168512 | Ga0495622_0168512_226_783 | 185 |
| 246 | 3300046559 | Ga0495667_0011175 | Ga0495667_0011175_3587_4144 | 185 |
| 247 | 3300046559 | Ga0495667_0015396 | Ga0495667_0015396_1539_2123 | 185 |
| 248 | 3300046559 | Ga0495667_0415472 | Ga0495667_0415472_34_600 | 185 |
| 249 | 3300046642 | Ga0495634_0003953 | Ga0495634_0003953_10911_11471 | 185 |
| 250 | 3300046642 | Ga0495634_0334502 | Ga0495634_0334502_313_870 | 185 |
| 251 | 3300046663 | Ga0495635_0029315 | Ga0495635_0029315_1072_1656 | 185 |
| 252 | 3300046663 | Ga0495635_0116502 | Ga0495635_0116502_516_1073 | 185 |
| 253 | 3300046674 | Ga0495588_0000930 | Ga0495588_0000930_11836_12396 | 185 |
| 254 | 3300046674 | Ga0495588_0023662 | Ga0495588_0023662_299_856 | 185 |
| 255 | 3300046675 | Ga0495657_0048335 | Ga0495657_0048335_1275_1859 | 185 |
| 256 | 3300046675 | Ga0495657_0311966 | Ga0495657_0311966_153_710 | 185 |
| 257 | 3300046680 | Ga0495646_0330081 | Ga0495646_0330081_35_592 | 185 |
| 258 | 3300046683 | Ga0495658_0004670 | Ga0495658_0004670_4017_4577 | 185 |
| 259 | 3300046683 | Ga0495658_0198548 | Ga0495658_0198548_12_569 | 185 |
| 260 | 3300046683 | Ga0495658_0695809 | Ga0495658_0695809_31_588 | 185 |
| 261 | 3300046689 | Ga0495613_0000263 | Ga0495613_0000263_9133_9693 | 185 |
| 262 | 3300046689 | Ga0495613_0033972 | Ga0495613_0033972_17_574 | 185 |
| 263 | 3300046690 | Ga0495624_0058641 | Ga0495624_0058641_81_641 | 185 |
| 264 | 3300046691 | Ga0495670_0052837 | Ga0495670_0052837_1332_1889 | 185 |
| 265 | 3300046809 | Ga0495600_0059015 | Ga0495600_0059015_109_666 | 185 |
| 266 | 3300047315 | Ga0495581_0004725 | Ga0495581_0004725_3923_4483 | 185 |
| 267 | 3300047315 | Ga0495581_0030632 | Ga0495581_0030632_891_1448 | 185 |
| 268 | 3300047317 | Ga0495604_0014044 | Ga0495604_0014044_3374_3958 | 185 |
| 269 | 3300047319 | Ga0495674_0003342 | Ga0495674_0003342_1137_1694 | 185 |
| 270 | 3300047321 | Ga0495676_0004991 | Ga0495676_0004991_1760_2320 | 185 |
| 271 | 3300047322 | Ga0495680_0031012 | Ga0495680_0031012_259_819 | 185 |
| 272 | 3300047322 | Ga0495680_0061202 | Ga0495680_0061202_2110_2694 | 185 |
| 273 | 3300047322 | Ga0495680_0100885 | Ga0495680_0100885_772_1329 | 185 |
| 274 | 3300047444 | Ga0495675_0156968 | Ga0495675_0156968_793_1350 | 185 |
| 275 | 3300047471 | Ga0495684_0134742 | Ga0495684_0134742_884_1468 | 185 |
| 276 | 3300047673 | Ga0495593_0004260 | Ga0495593_0004260_2371_2931 | 185 |
| 277 | 3300048088 | Ga0495602_0001754 | Ga0495602_0001754_19791_20375 | 185 |
| 278 | 3300048089 | Ga0495614_0003495 | Ga0495614_0003495_3848_4408 | 185 |
| 279 | 3300048089 | Ga0495614_0013887 | Ga0495614_0013887_268_825 | 185 |
| 280 | 3300048903 | Ga0496100_0213528 | Ga0496100_0213528_463_1032 | 185 |
| 281 | 3300048905 | Ga0496102_0223391 | Ga0496102_0223391_1174_1761 | 185 |
| 282 | 3300048907 | Ga0496104_0095288 | Ga0496104_0095288_48_617 | 185 |
| 283 | 3300048907 | Ga0496104_0263178 | Ga0496104_0263178_930_1517 | 185 |
| 284 | 3300048908 | Ga0496105_0086078 | Ga0496105_0086078_80_649 | 185 |
| 285 | 3300048908 | Ga0496105_0600029 | Ga0496105_0600029_189_776 | 185 |
| 286 | 3300048912 | Ga0496109_0306336 | Ga0496109_0306336_573_1160 | 185 |
| 287 | 3300048915 | Ga0496112_0009884 | Ga0496112_0009884_3463_4050 | 185 |
| 288 | 3300048915 | Ga0496112_0103191 | Ga0496112_0103191_813_1382 | 185 |
| 289 | 3300048928 | Ga0496125_0000410 | Ga0496125_0000410_47841_48398 | 185 |
| 290 | 3300049569 | Ga0501032_0296831 | Ga0501032_0296831_166_723 | 185 |
| 291 | 3300049570 | Ga0501033_0118071 | Ga0501033_0118071_1221_1796 | 185 |
| 292 | 3300049572 | Ga0501036_0017682 | Ga0501036_0017682_4203_4778 | 185 |
| 293 | 3300049572 | Ga0501036_0264466 | Ga0501036_0264466_42_617 | 185 |
| 294 | 3300049575 | Ga0501039_0016498 | Ga0501039_0016498_2535_3110 | 185 |
| 295 | 3300049576 | Ga0501040_0003790 | Ga0501040_0003790_2091_2666 | 185 |
| 296 | 3300049576 | Ga0501040_0620474 | Ga0501040_0620474_111_686 | 185 |
| 297 | 3300049576 | Ga0501040_1025323 | Ga0501040_1025323_11_586 | 185 |
| 298 | 3300049578 | Ga0501042_0108705 | Ga0501042_0108705_394_969 | 185 |
| 299 | 3300049580 | Ga0501046_0224960 | Ga0501046_0224960_429_1004 | 185 |
| 300 | 3300049581 | Ga0501047_0228860 | Ga0501047_0228860_931_1488 | 185 |
| 301 | 3300049582 | Ga0501048_0225958 | Ga0501048_0225958_390_965 | 185 |
| 302 | 3300049584 | Ga0501068_0055248 | Ga0501068_0055248_393_968 | 185 |
| 303 | 3300049587 | Ga0501071_0404233 | Ga0501071_0404233_447_1022 | 185 |
| 304 | 3300049588 | Ga0501072_0016230 | Ga0501072_0016230_788_1363 | 185 |
| 305 | 3300049590 | Ga0501074_0194631 | Ga0501074_0194631_18_593 | 185 |
| 306 | 3300049591 | Ga0501075_0191370 | Ga0501075_0191370_94_669 | 185 |
| 307 | 3300049592 | Ga0501076_0023267 | Ga0501076_0023267_2150_2725 | 185 |
| 308 | 3300049593 | Ga0501077_0306069 | Ga0501077_0306069_24_677 | 185 |
| 309 | 3300049741 | Ga0501079_0084490 | Ga0501079_0084490_273_848 | 185 |
| 310 | 3300049743 | Ga0501081_0021144 | Ga0501081_0021144_3171_3746 | 185 |
| 311 | 3300049823 | Ga0501044_0056519 | Ga0501044_0056519_537_1094 | 185 |
| 312 | 3300049824 | Ga0501045_0044084 | Ga0501045_0044084_538_1113 | 185 |
| 313 | 3300053077 | Ga0495601_0000609 | Ga0495601_0000609_17499_18083 | 185 |
| 314 | 3300053078 | Ga0495612_0006154 | Ga0495612_0006154_1875_2432 | 185 |
| 315 | 3300053084 | Ga0495595_0010669 | Ga0495595_0010669_822_1406 | 185 |
| 316 | 3300053084 | Ga0495595_0161586 | Ga0495595_0161586_267_827 | 185 |
| 317 | 3300053085 | Ga0495619_0001480 | Ga0495619_0001480_11304_11864 | 185 |
| 318 | 3300053085 | Ga0495619_0018742 | Ga0495619_0018742_2859_3416 | 185 |
| 319 | 3300053085 | Ga0495619_0416708 | Ga0495619_0416708_241_798 | 185 |
| 320 | 3300053130 | Ga0500642_0033395 | Ga0500642_0033395_886_1458 | 185 |
| 321 | 3300054114 | Ga0501084_0741928 | Ga0501084_0741928_147_722 | 185 |
| 322 | 3300060353 | Ga0501082_0035477 | Ga0501082_0035477_2163_2738 | 185 |
| 323 | iso_pu_bacteria | 2816332527 | 2818242774 | 185 |
| 324 | 2124908027 | MRS2a_Contig_6575 | MRS2a_00447770 | 186 |
| 325 | 3300002459 | JGI24751J29686_10026929 | JGI24751J29686_100269292 | 186 |
| 326 | 3300002737 | JGI25162J39368_1000078 | JGI25162J39368_100007834 | 186 |
| 327 | 3300002771 | JGI25163J39215_1000029 | JGI25163J39215_100002928 | 186 |
| 328 | 3300002772 | JGI25164J39214_1000096 | JGI25164J39214_100009634 | 186 |
| 329 | 3300003214 | JGI25165J46597_1000143 | JGI25165J46597_100014371 | 186 |
| 330 | 3300003322 | rootL2_10369569 | rootL2_103695692 | 186 |
| 331 | 3300005288 | Ga0065714_10064625 | Ga0065714_1006462510 | 186 |
| 332 | 3300005289 | Ga0065704_10226886 | Ga0065704_102268862 | 186 |
| 333 | 3300005329 | Ga0070683_100160618 | Ga0070683_1001606182 | 186 |
| 334 | 3300005331 | Ga0070670_100073247 | Ga0070670_1000732473 | 186 |
| 335 | 3300005336 | Ga0070680_100552870 | Ga0070680_1005528701 | 186 |
| 336 | 3300005339 | Ga0070660_100075444 | Ga0070660_1000754442 | 186 |
| 337 | 3300005341 | Ga0070691_10257571 | Ga0070691_102575711 | 186 |
| 338 | 3300005343 | Ga0070687_100124154 | Ga0070687_1001241542 | 186 |
| 339 | 3300005355 | Ga0070671_100157136 | Ga0070671_1001571361 | 186 |
| 340 | 3300005365 | Ga0070688_100157443 | Ga0070688_1001574431 | 186 |
| 341 | 3300005434 | Ga0070709_10536874 | Ga0070709_105368742 | 186 |
| 342 | 3300005436 | Ga0070713_100507964 | Ga0070713_1005079642 | 186 |
| 343 | 3300005458 | Ga0070681_10052286 | Ga0070681_100522862 | 186 |
| 344 | 3300005535 | Ga0070684_100036883 | Ga0070684_1000368832 | 186 |
| 345 | 3300005548 | Ga0070665_100013279 | Ga0070665_1000132798 | 186 |
| 346 | 3300005564 | Ga0070664_100083995 | Ga0070664_1000839952 | 186 |
| 347 | 3300005614 | Ga0068856_100010943 | Ga0068856_1000109435 | 186 |
| 348 | 3300005614 | Ga0068856_101386997 | Ga0068856_1013869971 | 186 |
| 349 | 3300005841 | Ga0068863_100526232 | Ga0068863_1005262322 | 186 |
| 350 | 3300005842 | Ga0068858_100218238 | Ga0068858_1002182382 | 186 |
| 351 | 3300006175 | Ga0070712_100133706 | Ga0070712_1001337064 | 186 |
| 352 | 3300006237 | Ga0097621_100000035 | Ga0097621_10000003536 | 186 |
| 353 | 3300006358 | Ga0068871_100000384 | Ga0068871_10000038427 | 186 |
| 354 | 3300006847 | Ga0075431_100075386 | Ga0075431_1000753863 | 186 |
| 355 | 3300006852 | Ga0075433_10282507 | Ga0075433_102825072 | 186 |
| 356 | 3300006871 | Ga0075434_100005391 | Ga0075434_1000053913 | 186 |
| 357 | 3300009011 | Ga0105251_10014136 | Ga0105251_100141362 | 186 |
| 358 | 3300009036 | Ga0105244_10000614 | Ga0105244_1000061415 | 186 |
| 359 | 3300009036 | Ga0105244_10100058 | Ga0105244_101000582 | 186 |
| 360 | 3300009094 | Ga0111539_10291521 | Ga0111539_102915212 | 186 |
| 361 | 3300009101 | Ga0105247_10056610 | Ga0105247_100566102 | 186 |
| 362 | 3300009147 | Ga0114129_10023918 | Ga0114129_100239183 | 186 |
| 363 | 3300009148 | Ga0105243_10000026 | Ga0105243_1000002619 | 186 |
| 364 | 3300009174 | Ga0105241_10017871 | Ga0105241_100178713 | 186 |
| 365 | 3300009551 | Ga0105238_10119210 | Ga0105238_101192102 | 186 |
| 366 | 3300009553 | Ga0105249_10322986 | Ga0105249_103229862 | 186 |
| 367 | 3300010375 | Ga0105239_10239757 | Ga0105239_102397572 | 186 |
| 368 | 3300010375 | Ga0105239_10337814 | Ga0105239_103378143 | 186 |
| 369 | 3300011119 | Ga0105246_10000110 | Ga0105246_1000011012 | 186 |
| 370 | 3300011119 | Ga0105246_10105910 | Ga0105246_101059103 | 186 |
| 371 | 3300013102 | Ga0157371_10004131 | Ga0157371_100041314 | 186 |
| 372 | 3300013104 | Ga0157370_10008032 | Ga0157370_100080323 | 186 |
| 373 | 3300013104 | Ga0157370_10697422 | Ga0157370_106974222 | 186 |
| 374 | 3300013105 | Ga0157369_10000191 | Ga0157369_1000019125 | 186 |
| 375 | 3300013306 | Ga0163162_10051590 | Ga0163162_100515904 | 186 |
| 376 | 3300013308 | Ga0157375_10503258 | Ga0157375_105032582 | 186 |
| 377 | 3300014325 | Ga0163163_10001080 | Ga0163163_1000108020 | 186 |
| 378 | 3300014497 | Ga0182008_10015393 | Ga0182008_100153932 | 186 |
| 379 | 3300014497 | Ga0182008_10122449 | Ga0182008_101224492 | 186 |
| 380 | 3300015261 | Ga0182006_1000083 | Ga0182006_100008397 | 186 |
| 381 | 3300015262 | Ga0182007_10000086 | Ga0182007_1000008627 | 186 |
| 382 | 3300015262 | Ga0182007_10008020 | Ga0182007_100080202 | 186 |
| 383 | 3300015265 | Ga0182005_1001544 | Ga0182005_10015447 | 186 |
| 384 | 3300015265 | Ga0182005_1043938 | Ga0182005_10439382 | 186 |
| 385 | 3300015265 | Ga0182005_1073372 | Ga0182005_10733722 | 186 |
| 386 | 3300021361 | Ga0213872_10000876 | Ga0213872_1000087617 | 186 |
| 387 | 3300025207 | Ga0209760_100049 | Ga0209760_10004944 | 186 |
| 388 | 3300025231 | Ga0207427_100048 | Ga0207427_100048158 | 186 |
| 389 | 3300025233 | Ga0209437_100094 | Ga0209437_100094158 | 186 |
| 390 | 3300025261 | Ga0209233_1000106 | Ga0209233_100010699 | 186 |
| 391 | 3300025728 | Ga0207655_1000076 | Ga0207655_100007640 | 186 |
| 392 | 3300025728 | Ga0207655_1006677 | Ga0207655_10066778 | 186 |
| 393 | 3300025735 | Ga0207713_1026120 | Ga0207713_10261202 | 186 |
| 394 | 3300025911 | Ga0207654_10059217 | Ga0207654_100592172 | 186 |
| 395 | 3300025912 | Ga0207707_10158905 | Ga0207707_101589053 | 186 |
| 396 | 3300025913 | Ga0207695_10305816 | Ga0207695_103058162 | 186 |
| 397 | 3300025914 | Ga0207671_10009256 | Ga0207671_100092563 | 186 |
| 398 | 3300025915 | Ga0207693_10083921 | Ga0207693_100839211 | 186 |
| 399 | 3300025917 | Ga0207660_10280729 | Ga0207660_102807292 | 186 |
| 400 | 3300025918 | Ga0207662_10208690 | Ga0207662_102086902 | 186 |
| 401 | 3300025919 | Ga0207657_10007517 | Ga0207657_1000751713 | 186 |
| 402 | 3300025921 | Ga0207652_10106114 | Ga0207652_101061143 | 186 |
| 403 | 3300025924 | Ga0207694_10004306 | Ga0207694_100043065 | 186 |
| 404 | 3300025925 | Ga0207650_10058174 | Ga0207650_100581743 | 186 |
| 405 | 3300025928 | Ga0207700_10062989 | Ga0207700_100629892 | 186 |
| 406 | 3300025935 | Ga0207709_10000004 | Ga0207709_10000004155 | 186 |
| 407 | 3300025945 | Ga0207679_10182000 | Ga0207679_101820002 | 186 |
| 408 | 3300025961 | Ga0207712_10373475 | Ga0207712_103734752 | 186 |
| 409 | 3300026035 | Ga0207703_10082107 | Ga0207703_100821072 | 186 |
| 410 | 3300026078 | Ga0207702_10006705 | Ga0207702_1000670511 | 186 |
| 411 | 3300026078 | Ga0207702_10799943 | Ga0207702_107999432 | 186 |
| 412 | 3300026088 | Ga0207641_10357194 | Ga0207641_103571942 | 186 |
| 413 | 3300027907 | Ga0207428_10127289 | Ga0207428_101272892 | 186 |
| 414 | 3300028379 | Ga0268266_10190424 | Ga0268266_101904243 | 186 |
| 415 | 3300028558 | Ga0265326_10008473 | Ga0265326_100084732 | 186 |
| 416 | 3300028558 | Ga0265326_10041509 | Ga0265326_100415091 | 186 |
| 417 | 3300028558 | Ga0265326_10083180 | Ga0265326_100831802 | 186 |
| 418 | 3300028558 | Ga0265326_10091838 | Ga0265326_100918381 | 186 |
| 419 | 3300028573 | Ga0265334_10031909 | Ga0265334_100319092 | 186 |
| 420 | 3300028577 | Ga0265318_10107486 | Ga0265318_101074861 | 186 |
| 421 | 3300028653 | Ga0265323_10013915 | Ga0265323_100139155 | 186 |
| 422 | 3300028654 | Ga0265322_10002230 | Ga0265322_100022307 | 186 |
| 423 | 3300028654 | Ga0265322_10002561 | Ga0265322_100025613 | 186 |
| 424 | 3300028800 | Ga0265338_10007808 | Ga0265338_1000780818 | 186 |
| 425 | 3300028800 | Ga0265338_10323991 | Ga0265338_103239912 | 186 |
| 426 | 3300028800 | Ga0265338_10468685 | Ga0265338_104686851 | 186 |
| 427 | 3300029957 | Ga0265324_10007248 | Ga0265324_100072485 | 186 |
| 428 | 3300031235 | Ga0265330_10374052 | Ga0265330_103740521 | 186 |
| 429 | 3300031239 | Ga0265328_10000070 | Ga0265328_1000007054 | 186 |
| 430 | 3300031240 | Ga0265320_10096247 | Ga0265320_100962472 | 186 |
| 431 | 3300031241 | Ga0265325_10016363 | Ga0265325_100163633 | 186 |
| 432 | 3300031241 | Ga0265325_10035841 | Ga0265325_100358411 | 186 |
| 433 | 3300031241 | Ga0265325_10182382 | Ga0265325_101823821 | 186 |
| 434 | 3300031247 | Ga0265340_10106911 | Ga0265340_101069112 | 186 |
| 435 | 3300031249 | Ga0265339_10030792 | Ga0265339_100307922 | 186 |
| 436 | 3300031249 | Ga0265339_10220328 | Ga0265339_102203281 | 186 |
| 437 | 3300031250 | Ga0265331_10002466 | Ga0265331_100024664 | 186 |
| 438 | 3300031250 | Ga0265331_10047206 | Ga0265331_100472063 | 186 |
| 439 | 3300031250 | Ga0265331_10059809 | Ga0265331_100598091 | 186 |
| 440 | 3300031251 | Ga0265327_10026102 | Ga0265327_100261021 | 186 |
| 441 | 3300031344 | Ga0265316_10010540 | Ga0265316_100105405 | 186 |
| 442 | 3300031344 | Ga0265316_10267416 | Ga0265316_102674162 | 186 |
| 443 | 3300031344 | Ga0265316_10424097 | Ga0265316_104240971 | 186 |
| 444 | 3300031595 | Ga0265313_10004390 | Ga0265313_100043902 | 186 |
| 445 | 3300031711 | Ga0265314_10036142 | Ga0265314_100361424 | 186 |
| 446 | 3300031711 | Ga0265314_10096809 | Ga0265314_100968091 | 186 |
| 447 | 3300031712 | Ga0265342_10007817 | Ga0265342_100078172 | 186 |
| 448 | 3300031712 | Ga0265342_10013742 | Ga0265342_100137422 | 186 |
| 449 | 3300031712 | Ga0265342_10083656 | Ga0265342_100836562 | 186 |
| 450 | 3300035111 | Ga0373923_0095535 | Ga0373923_0095535_193_753 | 186 |
| 451 | 3300035111 | Ga0373923_0289405 | Ga0373923_0289405_95_655 | 186 |
| 452 | 3300035111 | Ga0373923_0463388 | Ga0373923_0463388_12_572 | 186 |
| 453 | 3300035116 | Ga0373945_0009648 | Ga0373945_0009648_1583_2143 | 186 |
| 454 | 3300035116 | Ga0373945_0225638 | Ga0373945_0225638_156_719 | 186 |
| 455 | 3300035118 | Ga0373954_0134388 | Ga0373954_0134388_310_897 | 186 |
| 456 | 3300035119 | Ga0373956_0003454 | Ga0373956_0003454_5613_6200 | 186 |
| 457 | 3300035170 | Ga0373943_0012682 | Ga0373943_0012682_860_1420 | 186 |
| 458 | 3300035691 | Ga0373931_0215343 | Ga0373931_0215343_88_648 | 186 |
| 459 | 3300035692 | Ga0373935_0037333 | Ga0373935_0037333_581_1141 | 186 |
| 460 | 3300035692 | Ga0373935_0046948 | Ga0373935_0046948_1584_2144 | 186 |
| 461 | 3300035695 | Ga0373927_0061357 | Ga0373927_0061357_1313_1873 | 186 |
| 462 | 3300035695 | Ga0373927_0272979 | Ga0373927_0272979_248_808 | 186 |
| 463 | 3300035724 | Ga0373933_0197248 | Ga0373933_0197248_173_760 | 186 |
| 464 | 3300035724 | Ga0373933_0710039 | Ga0373933_0710039_26_586 | 186 |
| 465 | 3300035725 | Ga0373947_0078047 | Ga0373947_0078047_1196_1756 | 186 |
| 466 | 3300036401 | Ga0373937_0000803 | Ga0373937_0000803_444_1031 | 186 |
| 467 | 3300036401 | Ga0373937_0202371 | Ga0373937_0202371_288_848 | 186 |
| 468 | 3300036401 | Ga0373937_0408706 | Ga0373937_0408706_297_857 | 186 |
| 469 | 3300037068 | Ga0373925_0071820 | Ga0373925_0071820_1034_1594 | 186 |
| 470 | 3300037068 | Ga0373925_0196040 | Ga0373925_0196040_241_801 | 186 |
| 471 | 3300039447 | Ga0436361_0034567 | Ga0436361_0034567_13959_14528 | 186 |
| 472 | 3300041407 | Ga0439447_000008 | Ga0439447_000008_73863_74423 | 186 |
| 473 | 3300041408 | Ga0439453_0053395 | Ga0439453_0053395_72_752 | 186 |
| 474 | 3300041411 | Ga0439466_0012249 | Ga0439466_0012249_269_829 | 186 |
| 475 | 3300042137 | Ga0450902_023709 | Ga0450902_023709_176_736 | 186 |
| 476 | 3300046452 | Ga0495617_011469 | Ga0495617_011469_304_864 | 186 |
| 477 | 3300046454 | Ga0495592_0307156 | Ga0495592_0307156_290_850 | 186 |
| 478 | 3300046455 | Ga0495603_0009670 | Ga0495603_0009670_1444_2004 | 186 |
| 479 | 3300046455 | Ga0495603_0440544 | Ga0495603_0440544_52_612 | 186 |
| 480 | 3300046457 | Ga0495590_0001309 | Ga0495590_0001309_2133_2693 | 186 |
| 481 | 3300046458 | Ga0495591_006244 | Ga0495591_006244_1692_2252 | 186 |
| 482 | 3300046460 | Ga0495638_0000088 | Ga0495638_0000088_37084_37644 | 186 |
| 483 | 3300046461 | Ga0495641_0013908 | Ga0495641_0013908_2648_3208 | 186 |
| 484 | 3300046462 | Ga0495651_0007423 | Ga0495651_0007423_3065_3652 | 186 |
| 485 | 3300046463 | Ga0495653_0221134 | Ga0495653_0221134_429_989 | 186 |
| 486 | 3300046472 | Ga0495580_0056173 | Ga0495580_0056173_603_1163 | 186 |
| 487 | 3300046473 | Ga0495582_0086756 | Ga0495582_0086756_151_711 | 186 |
| 488 | 3300046474 | Ga0495605_0000313 | Ga0495605_0000313_10165_10725 | 186 |
| 489 | 3300046474 | Ga0495605_0043295 | Ga0495605_0043295_1595_2155 | 186 |
| 490 | 3300046475 | Ga0495639_0000001 | Ga0495639_0000001_156972_157532 | 186 |
| 491 | 3300046476 | Ga0495662_0156298 | Ga0495662_0156298_225_785 | 186 |
| 492 | 3300046491 | Ga0495584_0019640 | Ga0495584_0019640_1948_2508 | 186 |
| 493 | 3300046499 | Ga0495594_0000150 | Ga0495594_0000150_24936_25496 | 186 |
| 494 | 3300046499 | Ga0495594_0010204 | Ga0495594_0010204_3048_3608 | 186 |
| 495 | 3300046501 | Ga0495607_0001623 | Ga0495607_0001623_17195_17755 | 186 |
| 496 | 3300046506 | Ga0495583_0000323 | Ga0495583_0000323_66651_67211 | 186 |
| 497 | 3300046506 | Ga0495583_0010532 | Ga0495583_0010532_3917_4477 | 186 |
| 498 | 3300046513 | Ga0495616_0002937 | Ga0495616_0002937_8788_9348 | 186 |
| 499 | 3300046517 | Ga0495630_0000617 | Ga0495630_0000617_20541_21101 | 186 |
| 500 | 3300046517 | Ga0495630_0393671 | Ga0495630_0393671_435_995 | 186 |
| 501 | 3300046517 | Ga0495630_1086073 | Ga0495630_1086073_24_584 | 186 |
| 502 | 3300046519 | Ga0495632_0006296 | Ga0495632_0006296_6214_6774 | 186 |
| 503 | 3300046522 | Ga0495643_0048453 | Ga0495643_0048453_951_1511 | 186 |
| 504 | 3300046523 | Ga0495644_0000005 | Ga0495644_0000005_17420_17980 | 186 |
| 505 | 3300046526 | Ga0495666_0000015 | Ga0495666_0000015_41817_42377 | 186 |
| 506 | 3300046526 | Ga0495666_0084073 | Ga0495666_0084073_242_802 | 186 |
| 507 | 3300046529 | Ga0495652_0168278 | Ga0495652_0168278_1056_1616 | 186 |
| 508 | 3300046530 | Ga0495654_0000088 | Ga0495654_0000088_28335_28895 | 186 |
| 509 | 3300046530 | Ga0495654_0042167 | Ga0495654_0042167_1552_2112 | 186 |
| 510 | 3300046536 | Ga0495587_0015955 | Ga0495587_0015955_1496_2056 | 186 |
| 511 | 3300046542 | Ga0495597_0032090 | Ga0495597_0032090_1176_1736 | 186 |
| 512 | 3300046543 | Ga0495645_0016325 | Ga0495645_0016325_2642_3202 | 186 |
| 513 | 3300046557 | Ga0495622_0000181 | Ga0495622_0000181_3700_4260 | 186 |
| 514 | 3300046559 | Ga0495667_0028473 | Ga0495667_0028473_251_811 | 186 |
| 515 | 3300046648 | Ga0495611_0001442 | Ga0495611_0001442_2286_2846 | 186 |
| 516 | 3300046664 | Ga0495659_0000002 | Ga0495659_0000002_148256_148816 | 186 |
| 517 | 3300046665 | Ga0495661_0369938 | Ga0495661_0369938_93_653 | 186 |
| 518 | 3300046674 | Ga0495588_0022417 | Ga0495588_0022417_1583_2143 | 186 |
| 519 | 3300046678 | Ga0495599_0005304 | Ga0495599_0005304_4788_5348 | 186 |
| 520 | 3300046679 | Ga0495623_0064722 | Ga0495623_0064722_943_1503 | 186 |
| 521 | 3300046679 | Ga0495623_0164422 | Ga0495623_0164422_717_1277 | 186 |
| 522 | 3300046680 | Ga0495646_0192883 | Ga0495646_0192883_257_817 | 186 |
| 523 | 3300046681 | Ga0495647_0010085 | Ga0495647_0010085_782_1342 | 186 |
| 524 | 3300046683 | Ga0495658_0012392 | Ga0495658_0012392_1049_1609 | 186 |
| 525 | 3300046690 | Ga0495624_0033107 | Ga0495624_0033107_2080_2640 | 186 |
| 526 | 3300046692 | Ga0495671_0021457 | Ga0495671_0021457_1461_2021 | 186 |
| 527 | 3300046694 | Ga0495649_0000060 | Ga0495649_0000060_72636_73196 | 186 |
| 528 | 3300046694 | Ga0495649_0000330 | Ga0495649_0000330_27397_27957 | 186 |
| 529 | 3300046794 | Ga0495589_0008956 | Ga0495589_0008956_3767_4327 | 186 |
| 530 | 3300046809 | Ga0495600_0025345 | Ga0495600_0025345_1477_2037 | 186 |
| 531 | 3300046810 | Ga0495660_0004514 | Ga0495660_0004514_4582_5142 | 186 |
| 532 | 3300047315 | Ga0495581_0002397 | Ga0495581_0002397_3712_4272 | 186 |
| 533 | 3300047315 | Ga0495581_0039866 | Ga0495581_0039866_1680_2240 | 186 |
| 534 | 3300047315 | Ga0495581_0120998 | Ga0495581_0120998_89_649 | 186 |
| 535 | 3300047317 | Ga0495604_0003775 | Ga0495604_0003775_9052_9612 | 186 |
| 536 | 3300047317 | Ga0495604_0084819 | Ga0495604_0084819_1007_1567 | 186 |
| 537 | 3300047319 | Ga0495674_0080357 | Ga0495674_0080357_656_1216 | 186 |
| 538 | 3300047319 | Ga0495674_0211736 | Ga0495674_0211736_793_1353 | 186 |
| 539 | 3300047320 | Ga0495672_0000639 | Ga0495672_0000639_1176_1736 | 186 |
| 540 | 3300047320 | Ga0495672_0000812 | Ga0495672_0000812_13303_13863 | 186 |
| 541 | 3300047320 | Ga0495672_0027421 | Ga0495672_0027421_1362_1922 | 186 |
| 542 | 3300047321 | Ga0495676_0046308 | Ga0495676_0046308_1748_2308 | 186 |
| 543 | 3300047322 | Ga0495680_0179584 | Ga0495680_0179584_769_1329 | 186 |
| 544 | 3300047323 | Ga0495683_0001032 | Ga0495683_0001032_15998_16558 | 186 |
| 545 | 3300047443 | Ga0495687_012893 | Ga0495687_012893_2931_3491 | 186 |
| 546 | 3300047443 | Ga0495687_040302 | Ga0495687_040302_896_1456 | 186 |
| 547 | 3300047444 | Ga0495675_0011807 | Ga0495675_0011807_1980_2540 | 186 |
| 548 | 3300047445 | Ga0495677_0105630 | Ga0495677_0105630_196_756 | 186 |
| 549 | 3300047471 | Ga0495684_0011608 | Ga0495684_0011608_5151_5711 | 186 |
| 550 | 3300047471 | Ga0495684_0062447 | Ga0495684_0062447_417_977 | 186 |
| 551 | 3300047471 | Ga0495684_0276279 | Ga0495684_0276279_558_1118 | 186 |
| 552 | 3300047673 | Ga0495593_0000027 | Ga0495593_0000027_34369_34929 | 186 |
| 553 | 3300047673 | Ga0495593_0034446 | Ga0495593_0034446_1751_2311 | 186 |
| 554 | 3300047673 | Ga0495593_0263648 | Ga0495593_0263648_110_670 | 186 |
| 555 | 3300048088 | Ga0495602_0001002 | Ga0495602_0001002_8068_8628 | 186 |
| 556 | 3300048091 | Ga0495626_0000031 | Ga0495626_0000031_169440_170000 | 186 |
| 557 | 3300048903 | Ga0496100_0068248 | Ga0496100_0068248_858_1418 | 186 |
| 558 | 3300048904 | Ga0496101_0184560 | Ga0496101_0184560_769_1329 | 186 |
| 559 | 3300048905 | Ga0496102_0383496 | Ga0496102_0383496_294_854 | 186 |
| 560 | 3300048906 | Ga0496103_0019803 | Ga0496103_0019803_2049_2609 | 186 |
| 561 | 3300048907 | Ga0496104_0007532 | Ga0496104_0007532_7078_7638 | 186 |
| 562 | 3300048908 | Ga0496105_0004762 | Ga0496105_0004762_1396_1956 | 186 |
| 563 | 3300048908 | Ga0496105_0048875 | Ga0496105_0048875_2530_3090 | 186 |
| 564 | 3300048909 | Ga0496106_0022280 | Ga0496106_0022280_1445_2005 | 186 |
| 565 | 3300048909 | Ga0496106_0024081 | Ga0496106_0024081_1342_1902 | 186 |
| 566 | 3300048910 | Ga0496107_0168941 | Ga0496107_0168941_702_1262 | 186 |
| 567 | 3300048911 | Ga0496108_0221625 | Ga0496108_0221625_540_1100 | 186 |
| 568 | 3300048912 | Ga0496109_0001209 | Ga0496109_0001209_16969_17529 | 186 |
| 569 | 3300048913 | Ga0496110_0017292 | Ga0496110_0017292_2053_2613 | 186 |
| 570 | 3300048913 | Ga0496110_0030722 | Ga0496110_0030722_1447_2007 | 186 |
| 571 | 3300048914 | Ga0496111_0004625 | Ga0496111_0004625_2303_2863 | 186 |
| 572 | 3300048914 | Ga0496111_0572811 | Ga0496111_0572811_182_742 | 186 |
| 573 | 3300048915 | Ga0496112_0004925 | Ga0496112_0004925_9920_10480 | 186 |
| 574 | 3300048916 | Ga0496113_0009192 | Ga0496113_0009192_2322_2882 | 186 |
| 575 | 3300048917 | Ga0496114_0164119 | Ga0496114_0164119_862_1422 | 186 |
| 576 | 3300048918 | Ga0496115_0230446 | Ga0496115_0230446_513_1073 | 186 |
| 577 | 3300048919 | Ga0496116_0000475 | Ga0496116_0000475_27094_27654 | 186 |
| 578 | 3300048920 | Ga0496117_0067204 | Ga0496117_0067204_267_827 | 186 |
| 579 | 3300048922 | Ga0496119_0140469 | Ga0496119_0140469_525_1085 | 186 |
| 580 | 3300048924 | Ga0496121_0065408 | Ga0496121_0065408_1673_2233 | 186 |
| 581 | 3300048925 | Ga0496122_0064776 | Ga0496122_0064776_1609_2169 | 186 |
| 582 | 3300048927 | Ga0496124_0000276 | Ga0496124_0000276_50182_50742 | 186 |
| 583 | 3300048929 | Ga0496126_0000692 | Ga0496126_0000692_25744_26304 | 186 |
| 584 | 3300049459 | Ga0495678_016249 | Ga0495678_016249_873_1433 | 186 |
| 585 | 3300049570 | Ga0501033_0010195 | Ga0501033_0010195_6505_7149 | 186 |
| 586 | 3300049572 | Ga0501036_0304055 | Ga0501036_0304055_231_875 | 186 |
| 587 | 3300049581 | Ga0501047_0017651 | Ga0501047_0017651_294_938 | 186 |
| 588 | 3300049581 | Ga0501047_0319747 | Ga0501047_0319747_476_1090 | 186 |
| 589 | 3300049581 | Ga0501047_0350695 | Ga0501047_0350695_76_639 | 186 |
| 590 | 3300049581 | Ga0501047_0486066 | Ga0501047_0486066_403_963 | 186 |
| 591 | 3300049583 | Ga0501067_0427701 | Ga0501067_0427701_133_693 | 186 |
| 592 | 3300049589 | Ga0501073_0300131 | Ga0501073_0300131_526_1086 | 186 |
| 593 | 3300049742 | Ga0501080_0039237 | Ga0501080_0039237_2766_3362 | 186 |
| 594 | 3300049742 | Ga0501080_0159783 | Ga0501080_0159783_182_742 | 186 |
| 595 | 3300049744 | Ga0501083_0004796 | Ga0501083_0004796_7855_8415 | 186 |
| 596 | 3300049823 | Ga0501044_0017674 | Ga0501044_0017674_3303_3947 | 186 |
| 597 | 3300050510 | nmdc:mga06r32_353361_c1 | nmdc:mga06r32_353361_c1_477_1037 | 186 |
| 598 | 3300050511 | nmdc:mga08y16_84366_c1 | nmdc:mga08y16_84366_c1_771_1331 | 186 |
| 599 | 3300050512 | nmdc:mga0n895_175627_c1 | nmdc:mga0n895_175627_c1_663_1223 | 186 |
| 600 | 3300050515 | nmdc:mga0a205_756561_c1 | nmdc:mga0a205_756561_c1_62_622 | 186 |
| 601 | 3300053077 | Ga0495601_0016010 | Ga0495601_0016010_1628_2188 | 186 |
| 602 | 3300053078 | Ga0495612_0027440 | Ga0495612_0027440_1144_1704 | 186 |
| 603 | 3300053084 | Ga0495595_0058724 | Ga0495595_0058724_1094_1654 | 186 |
| 604 | 3300053085 | Ga0495619_0284675 | Ga0495619_0284675_547_1107 | 186 |
| 605 | 3300053148 | Ga0500590_015365 | Ga0500590_015365_172_735 | 186 |
| 606 | 3300061734 | Ga0530510_0029111 | Ga0530510_0029111_316_876 | 186 |
| 607 | iso_pu_bacteria | 2988728565 | 2988729025 | 186 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ttb-assembly1.cif.gz_B | crystal structure of homo sapiens iodotyrosine deiodinase (iyd) bound to fmn | 0.8659 | 3 | 180 |
| 3ek3-assembly1.cif.gz_A-2 | crystal structure of nitroreductase with bound fmn (yp_211706.1) from bacteroides fragilis nctc 9343 at 1.70 a resolution | 0.8453 | 1 | 186 |
| 3gb5-assembly1.cif.gz_A-2 | crystal structure of mus musculus iodotyrosine deiodinase (iyd) bound to fmn | 0.8444 | 3 | 186 |
| 3ek3-assembly1.cif.gz_A-2 | crystal structure of nitroreductase with bound fmn (yp_211706.1) from bacteroides fragilis nctc 9343 at 1.70 a resolution | 0.8412 | 1 | 186 |
| 3kwk-assembly1.cif.gz_A-2 | crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (np_809094.1) from bacteroides thetaiotaomicron vpi-5482 at 1.54 a resolution | 0.8334 | 3 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ek3A01 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.86 | 1 | 168 | 3.40.109.10 |
| 3ek3A01 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8457 | 1 | 168 | 3.40.109.10 |
| 3gb5A00 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8444 | 3 | 186 | 3.40.109.10 |
| 3pxvA00 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.82 | 3 | 186 | 3.40.109.10 |
| 5j6cB00 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8166 | 4 | 176 | 3.40.109.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0Y410-F1-model_v4 | Nitroreductase | 0.9829 | 1 | 147 |
GO:0016020
GO:0016491 |
| AF-A0A5J6MZK5-F1-model_v4 | Nitroreductase | 0.978 | 1 | 186 |
GO:0016491
|
| AF-A0A840VBT1-F1-model_v4 | Nitroreductase | 0.9768 | 1 | 186 |
GO:0016491
|
| AF-A0A3C0Y410-F1-model_v4 | Nitroreductase | 0.9763 | 1 | 147 |
GO:0016020
GO:0016491 |
| AF-B0SYI7-F1-model_v4 | Nitroreductase | 0.976 | 1 | 186 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar