F468712

General Info

Members Datasets Scaffolds Average Seq Length
607 268 1214 223

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0006817|Ga0395899_0006817_3614_4333
Length 239
Sequence LAAGEPATKEVVMAVFAEERPRPTLVELAPVADPAPLGLAAFALTTFMLSGHNATFIPDVLWVGLALFYGGVAQLLAGMWEFRNRNVFGATAFSTYGGFWLALGVSIVLIETTSLGSALKGPDIDNGLAWFLLAFAIFNTYMLFGSLRVNMAVFGVFLTLEITEILLAIGFFRLAHDGTPWILHAGGWAGIATAVVAWYASAAGVINGMSTDPVLPVGRPLWNRLPIISHLGTPMPRGT

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
153 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.02
Metatranscriptomes 29.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.1
Rhizosphere 93.25
Stem 0
Stem Tuber 0
Unclassified 8.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0006817 3300037312 Bacteria 8845
2 Ga0006778J45830_1046933 3300003162 Bacteria 1219
3 Ga0006777J48905_1034236 3300003308 Bacteria 1328
4 Ga0006777J48905_1054924 3300003308 Unclassified 753
5 Ga0007429J51699_1033401 3300003579 Bacteria 1307
6 Ga0007429J51699_1035782 3300003579 Bacteria 1321
7 Ga0007429J51699_1037001 3300003579 Bacteria 1081
8 Ga0058863_10162758 3300004799 Unclassified 935
9 Ga0058861_10061845 3300004800 Bacteria 1364
10 Ga0058861_10094513 3300004800 Bacteria 1390
11 Ga0058862_10258641 3300004803 Unclassified 936
12 Ga0058862_12291324 3300004803 Bacteria 832
13 Ga0070658_10017971 3300005327 Bacteria 5656
14 Ga0070658_10467579 3300005327 Bacteria 1088
15 Ga0070658_10576907 3300005327 Bacteria 974
16 Ga0070683_100013353 3300005329 Bacteria 7159
17 Ga0070683_100021503 3300005329 Bacteria 5759
18 Ga0070683_100025113 3300005329 Bacteria 5347
19 Ga0070683_100054839 3300005329 Bacteria 3697
20 Ga0070683_100124246 3300005329 Bacteria 2439
21 Ga0070683_100207107 3300005329 Archaea 1863
22 Ga0070680_100119998 3300005336 Bacteria 2194
23 Ga0070682_100014551 3300005337 Bacteria 4549
24 Ga0070682_100042489 3300005337 Bacteria 2806
25 Ga0070682_100072012 3300005337 Bacteria 2214
26 Ga0070682_100074011 3300005337 Bacteria 2187
27 Ga0068868_100102574 3300005338 Bacteria 2317
28 Ga0068868_100680054 3300005338 Bacteria 919
29 Ga0070660_100024791 3300005339 Bacteria 4454
30 Ga0070660_100089471 3300005339 Bacteria 2425
31 Ga0070660_100842905 3300005339 Bacteria 772
32 Ga0070691_10077027 3300005341 Bacteria 1627
33 Ga0070661_100515709 3300005344 Unclassified 958
34 Ga0070659_100004986 3300005366 Bacteria 9507
35 Ga0070659_100650205 3300005366 Bacteria 909
36 Ga0070709_10010616 3300005434 Bacteria 5106
37 Ga0070709_10406572 3300005434 Bacteria 1017
38 Ga0070714_100000004 3300005435 Bacteria 310983
39 Ga0070714_100008041 3300005435 Bacteria 8219
40 Ga0070714_100016585 3300005435 Bacteria 5953
41 Ga0070714_100034006 3300005435 Bacteria 4267
42 Ga0070714_100044409 3300005435 Bacteria 3762
43 Ga0070714_100118359 3300005435 Bacteria 2354
44 Ga0070714_100207153 3300005435 Bacteria 1796
45 Ga0070714_100232348 3300005435 Bacteria 1699
46 Ga0070714_100238314 3300005435 Unclassified 1678
47 Ga0070713_100057847 3300005436 Bacteria 3230
48 Ga0070713_100081529 3300005436 Bacteria 2761
49 Ga0070710_10007711 3300005437 Bacteria 5219
50 Ga0070711_100083617 3300005439 Bacteria 2281
51 Ga0070711_100330320 3300005439 Bacteria 1220
52 Ga0070705_100132116 3300005440 Bacteria 1630
53 Ga0070700_100152516 3300005441 Bacteria 1582
54 Ga0070708_100029860 3300005445 Bacteria 4706
55 Ga0070708_100440173 3300005445 Bacteria 1229
56 Ga0070708_100448277 3300005445 Bacteria 1217
57 Ga0070708_100601714 3300005445 Bacteria 1036
58 Ga0070663_100056557 3300005455 Bacteria 2811
59 Ga0070662_100053410 3300005457 Bacteria 2925
60 Ga0070681_10055588 3300005458 Unclassified 3940
61 Ga0068867_100588656 3300005459 Bacteria 969
62 Ga0070706_100000171 3300005467 Bacteria 82241
63 Ga0070706_100004496 3300005467 Bacteria 13449
64 Ga0070706_100050569 3300005467 Bacteria 3835
65 Ga0070706_100271607 3300005467 Bacteria 1582
66 Ga0070706_100434089 3300005467 Bacteria 1222
67 Ga0070706_100470422 3300005467 Bacteria 1169
68 Ga0070707_100001413 3300005468 Bacteria 23545
69 Ga0070707_100103489 3300005468 Bacteria 2759
70 Ga0070707_100248921 3300005468 Bacteria 1729
71 Ga0070707_100479435 3300005468 Bacteria 1205
72 Ga0070698_100013485 3300005471 Bacteria 8652
73 Ga0070698_100078640 3300005471 Bacteria 3296
74 Ga0070699_100000071 3300005518 Bacteria 96895
75 Ga0070699_100000782 3300005518 Bacteria 29356
76 Ga0070699_100001466 3300005518 Bacteria 21605
77 Ga0070679_100163836 3300005530 Bacteria 2197
78 Ga0070679_100607814 3300005530 Bacteria 1036
79 Ga0070684_100081771 3300005535 Bacteria 2859
80 Ga0070684_100100128 3300005535 Bacteria 2587
81 Ga0070684_100128594 3300005535 Bacteria 2284
82 Ga0070684_100306533 3300005535 Bacteria 1458
83 Ga0070684_100692771 3300005535 Unclassified 950
84 Ga0070697_100000064 3300005536 Bacteria 84569
85 Ga0070697_100004794 3300005536 Bacteria 10359
86 Ga0070697_100616170 3300005536 Bacteria 954
87 Ga0068853_100375003 3300005539 Unclassified 1328
88 Ga0070686_100135754 3300005544 Bacteria 1707
89 Ga0070695_100198891 3300005545 Unclassified 1431
90 Ga0070693_100008935 3300005547 Bacteria 4969
91 Ga0070693_100080334 3300005547 Bacteria 1942
92 Ga0068855_100106950 3300005563 Bacteria 3214
93 Ga0068855_100109873 3300005563 Bacteria 3165
94 Ga0070664_100444863 3300005564 Bacteria 1189
95 Ga0068854_100027964 3300005578 Bacteria 3892
96 Ga0068854_100231037 3300005578 Bacteria 1468
97 Ga0068856_100017118 3300005614 Bacteria 7027
98 Ga0068856_100017942 3300005614 Bacteria 6861
99 Ga0068856_100048466 3300005614 Bacteria 4187
100 Ga0068856_100059315 3300005614 Bacteria 3780
101 Ga0068856_100114291 3300005614 Bacteria 2698
102 Ga0068856_100121310 3300005614 Bacteria 2616
103 Ga0070702_100161030 3300005615 Bacteria 1451
104 Ga0070702_100251141 3300005615 Bacteria 1199
105 Ga0068852_100215410 3300005616 Bacteria 1824
106 Ga0068866_10304762 3300005718 Bacteria 996
107 Ga0068861_100331827 3300005719 Bacteria 1328
108 Ga0068870_10128262 3300005840 Bacteria 1470
109 Ga0081455_10016539 3300005937 Bacteria 7117
110 Ga0081455_10020921 3300005937 Bacteria 6148
111 Ga0081455_10068090 3300005937 Unclassified 2965
112 Ga0081539_10001238 3300005985 Bacteria 45456
113 Ga0070717_10000009 3300006028 Bacteria 297183
114 Ga0070717_10000234 3300006028 Bacteria 38382
115 Ga0070717_10000584 3300006028 Bacteria 23267
116 Ga0070717_10019874 3300006028 Bacteria 5274
117 Ga0070717_10021141 3300006028 Bacteria 5127
118 Ga0070717_10034549 3300006028 Bacteria 4088
119 Ga0070717_10066125 3300006028 Bacteria 3006
120 Ga0070717_10170326 3300006028 Bacteria 1893
121 Ga0070717_10481447 3300006028 Bacteria 1121
122 Ga0070717_10594292 3300006028 Bacteria 1004
123 Ga0070715_10003708 3300006163 Bacteria 4908
124 Ga0070716_100079995 3300006173 Bacteria 1947
125 Ga0070716_100116921 3300006173 Bacteria 1663
126 Ga0070716_100160889 3300006173 Bacteria 1455
127 Ga0097621_100399327 3300006237 Bacteria 1230
128 Ga0068871_100006687 3300006358 Bacteria 8181
129 Ga0068871_100378766 3300006358 Bacteria 1257
130 Ga0075428_100336479 3300006844 Bacteria 1621
131 Ga0075431_100562742 3300006847 Unclassified 1127
132 Ga0075433_10023169 3300006852 Bacteria 5222
133 Ga0075434_100006283 3300006871 Bacteria 10885
134 Ga0075434_100334360 3300006871 Bacteria 1535
135 Ga0075434_100735860 3300006871 Unclassified 1003
136 Ga0075429_100100089 3300006880 Bacteria 2530
137 Ga0075436_100062988 3300006914 Bacteria 2563
138 Ga0075436_100093250 3300006914 Bacteria 2093
139 Ga0075435_100053835 3300007076 Bacteria 3247
140 Ga0075435_100225690 3300007076 Bacteria 1591
141 Ga0105240_10008131 3300009093 Bacteria 15049
142 Ga0105240_10647585 3300009093 Bacteria 1158
143 Ga0105240_10689739 3300009093 Bacteria 1116
144 Ga0105240_10927869 3300009093 Bacteria 935
145 Ga0105245_10039503 3300009098 Bacteria 4200
146 Ga0105245_10049721 3300009098 Bacteria 3755
147 Ga0105245_10128847 3300009098 Bacteria 2371
148 Ga0105245_10442478 3300009098 Bacteria 1307
149 Ga0114129_10259849 3300009147 Bacteria 2328
150 Ga0105243_10239091 3300009148 Bacteria 1615
151 Ga0105241_10057676 3300009174 Bacteria 2980
152 Ga0105238_10048038 3300009551 Bacteria 4302
153 Ga0105238_10937233 3300009551 Bacteria 885
154 Ga0105239_10095076 3300010375 Bacteria 3292
155 Ga0105239_10424501 3300010375 Bacteria 1506
156 Ga0105239_10591577 3300010375 Bacteria 1265
157 Ga0154016_140780 3300013045 Bacteria 1050
158 Ga0154012_112501 3300013059 Unclassified 753
159 Ga0154012_122835 3300013059 Bacteria 1150
160 Ga0157373_10207814 3300013100 Bacteria 1380
161 Ga0157371_10460881 3300013102 Bacteria 935
162 Ga0157370_10392488 3300013104 Bacteria 1278
163 Ga0157369_10039129 3300013105 Bacteria 5184
164 Ga0157369_10053567 3300013105 Bacteria 4359
165 Ga0157369_10192377 3300013105 Bacteria 2143
166 Ga0157369_10219882 3300013105 Bacteria 1988
167 Ga0157374_10220186 3300013296 Bacteria 1862
168 Ga0157378_10336120 3300013297 Bacteria 1471
169 Ga0157372_10570121 3300013307 Bacteria 1319
170 Ga0157376_10041715 3300014969 Bacteria 3759
171 Ga0182005_1069699 3300015265 Bacteria 965
172 Ga0197907_10199073 3300020069 Unclassified 1169
173 Ga0197907_10288058 3300020069 Bacteria 1128
174 Ga0197907_10353616 3300020069 Unclassified 871
175 Ga0197907_10411427 3300020069 Bacteria 2138
176 Ga0197907_10956749 3300020069 Bacteria 2467
177 Ga0197907_11511263 3300020069 Bacteria 2116
178 Ga0206356_10031978 3300020070 Bacteria 2772
179 Ga0206356_10979336 3300020070 Bacteria 938
180 Ga0206356_11808036 3300020070 Bacteria 1604
181 Ga0206349_1157557 3300020075 Bacteria 2843
182 Ga0206349_1454904 3300020075 Bacteria 1141
183 Ga0206349_1458029 3300020075 Bacteria 2424
184 Ga0206349_1541529 3300020075 Bacteria 787
185 Ga0206355_1181590 3300020076 Bacteria 760
186 Ga0206355_1440801 3300020076 Unclassified 828
187 Ga0206355_1588096 3300020076 Bacteria 1209
188 Ga0206351_10401032 3300020077 Bacteria 1437
189 Ga0206351_10437600 3300020077 Bacteria 920
190 Ga0206352_10390842 3300020078 Bacteria 1177
191 Ga0206352_10398134 3300020078 Bacteria 2737
192 Ga0206350_10062944 3300020080 Bacteria 821
193 Ga0206350_10094212 3300020080 Bacteria 849
194 Ga0206350_10250503 3300020080 Bacteria 757
195 Ga0206350_10458458 3300020080 Bacteria 1134
196 Ga0206350_10582101 3300020080 Bacteria 3112
197 Ga0206354_10786195 3300020081 Bacteria 2127
198 Ga0206353_10056259 3300020082 Bacteria 4127
199 Ga0206353_10080838 3300020082 Bacteria 1358
200 Ga0206353_10691849 3300020082 Bacteria 1438
201 Ga0206353_10723633 3300020082 Bacteria 959
202 Ga0154015_1033170 3300020610 Bacteria 1409
203 Ga0154015_1083977 3300020610 Bacteria 1399
204 Ga0154015_1610023 3300020610 Bacteria 1422
205 Ga0224712_10007955 3300022467 Bacteria 3111
206 Ga0224712_10008611 3300022467 Bacteria 3033
207 Ga0224712_10027064 3300022467 Bacteria 2036
208 Ga0224712_10027191 3300022467 Bacteria 2032
209 Ga0224712_10032242 3300022467 Bacteria 1908
210 Ga0224712_10035631 3300022467 Bacteria 1838
211 Ga0207692_10008882 3300025898 Bacteria 4176
212 Ga0207692_10022511 3300025898 Bacteria 2900
213 Ga0207688_10260750 3300025901 Bacteria 1052
214 Ga0207680_10244059 3300025903 Bacteria 1239
215 Ga0207685_10003839 3300025905 Bacteria 3720
216 Ga0207699_10023261 3300025906 Bacteria 3370
217 Ga0207699_10037660 3300025906 Bacteria 2766
218 Ga0207705_10010732 3300025909 Bacteria 6650
219 Ga0207684_10000003 3300025910 Bacteria 766933
220 Ga0207684_10000012 3300025910 Bacteria 478666
221 Ga0207684_10000485 3300025910 Bacteria 51125
222 Ga0207684_10087834 3300025910 Bacteria 2649
223 Ga0207684_10235317 3300025910 Bacteria 1580
224 Ga0207654_10081824 3300025911 Bacteria 1946
225 Ga0207707_10100311 3300025912 Bacteria 2530
226 Ga0207695_10032725 3300025913 Bacteria 5686
227 Ga0207693_10006545 3300025915 Bacteria 9643
228 Ga0207663_10024769 3300025916 Bacteria 3460
229 Ga0207663_10422041 3300025916 Bacteria 1024
230 Ga0207660_10381309 3300025917 Unclassified 1133
231 Ga0207657_10008296 3300025919 Bacteria 10568
232 Ga0207657_10051327 3300025919 Bacteria 3585
233 Ga0207649_10028768 3300025920 Bacteria 3275
234 Ga0207649_10057187 3300025920 Bacteria 2438
235 Ga0207652_10172995 3300025921 Bacteria 1938
236 Ga0207646_10000779 3300025922 Bacteria 41345
237 Ga0207646_10001583 3300025922 Bacteria 27794
238 Ga0207646_10003154 3300025922 Bacteria 18881
239 Ga0207646_10010089 3300025922 Bacteria 9260
240 Ga0207646_10309501 3300025922 Bacteria 1427
241 Ga0207646_10429443 3300025922 Bacteria 1192
242 Ga0207694_10282743 3300025924 Bacteria 1363
243 Ga0207659_11061631 3300025926 Bacteria 697
244 Ga0207687_10024956 3300025927 Bacteria 3998
245 Ga0207687_10071237 3300025927 Bacteria 2483
246 Ga0207687_10136943 3300025927 Archaea 1853
247 Ga0207687_10713576 3300025927 Bacteria 852
248 Ga0207700_10000021 3300025928 Bacteria 168335
249 Ga0207700_10055175 3300025928 Bacteria 2986
250 Ga0207700_10087738 3300025928 Bacteria 2447
251 Ga0207700_10338776 3300025928 Bacteria 1307
252 Ga0207664_10000018 3300025929 Bacteria 222788
253 Ga0207664_10012279 3300025929 Bacteria 6122
254 Ga0207664_10031861 3300025929 Bacteria 4037
255 Ga0207664_10040478 3300025929 Bacteria 3624
256 Ga0207664_10044215 3300025929 Bacteria 3487
257 Ga0207664_10051387 3300025929 Bacteria 3254
258 Ga0207664_10066059 3300025929 Bacteria 2898
259 Ga0207664_10284610 3300025929 Unclassified 1451
260 Ga0207664_10291240 3300025929 Bacteria 1435
261 Ga0207690_10887786 3300025932 Bacteria 739
262 Ga0207706_10068259 3300025933 Bacteria 3129
263 Ga0207669_10547678 3300025937 Bacteria 933
264 Ga0207665_10002447 3300025939 Bacteria 12534
265 Ga0207665_10015388 3300025939 Bacteria 5023
266 Ga0207665_10244008 3300025939 Bacteria 1325
267 Ga0207665_10827800 3300025939 Bacteria 732
268 Ga0207661_10086197 3300025944 Bacteria 2606
269 Ga0207661_10222825 3300025944 Archaea 1667
270 Ga0207661_10300352 3300025944 Bacteria 1439
271 Ga0207661_10577332 3300025944 Bacteria 1031
272 Ga0207667_10051598 3300025949 Bacteria 4335
273 Ga0207667_10052247 3300025949 Bacteria 4305
274 Ga0207667_10214127 3300025949 Bacteria 1974
275 Ga0207677_10075698 3300026023 Bacteria 2393
276 Ga0207639_10309193 3300026041 Bacteria 1400
277 Ga0207678_10046705 3300026067 Bacteria 3745
278 Ga0207708_10312095 3300026075 Bacteria 1281
279 Ga0207708_10541757 3300026075 Bacteria 980
280 Ga0207702_10003936 3300026078 Bacteria 13350
281 Ga0207702_10009634 3300026078 Bacteria 8109
282 Ga0207702_10182059 3300026078 Bacteria 1936
283 Ga0207702_10213897 3300026078 Bacteria 1793
284 Ga0207702_10253977 3300026078 Bacteria 1652
285 Ga0207702_10318094 3300026078 Bacteria 1481
286 Ga0207702_10388526 3300026078 Bacteria 1343
287 Ga0207648_10536467 3300026089 Bacteria 1073
288 Ga0207648_10890226 3300026089 Bacteria 831
289 Ga0207675_100309614 3300026118 Bacteria 1540
290 Ga0207683_10001031 3300026121 Bacteria 25414
291 Ga0207698_10178339 3300026142 Bacteria 1879
292 Ga0265322_10020648 3300028654 Bacteria 1887
293 Ga0265338_10010639 3300028800 Bacteria 10751
294 Ga0265338_10307668 3300028800 Bacteria 1150
295 Ga0307415_100149097 3300032126 Bacteria 1798
296 Ga0373958_0043867 3300034819 Bacteria 924
297 Ga0373928_0106423 3300035084 Bacteria 737
298 Ga0373949_0037597 3300035090 Bacteria 1178
299 Ga0373952_0043224 3300035092 Bacteria 1049
300 Ga0373936_0083502 3300035113 Bacteria 1332
301 Ga0373945_0029460 3300035116 Bacteria 1929
302 Ga0373960_0065789 3300035121 Bacteria 1109
303 Ga0373943_0003105 3300035170 Bacteria 7543
304 Ga0373946_0022399 3300035171 Bacteria 2459
305 Ga0373942_0108689 3300035207 Bacteria 855
306 Ga0373931_0028284 3300035691 Bacteria 2868
307 Ga0373947_0004365 3300035725 Bacteria 8294
308 Ga0373947_0137048 3300035725 Bacteria 1567
309 Ga0373937_0267283 3300036401 Bacteria 1614
310 Ga0373925_0060860 3300037068 Bacteria 2835
311 Ga0395899_0028998 3300037312 Bacteria 4163
312 Ga0395899_0187012 3300037312 Unclassified 1451
313 Ga0395900_0004133 3300037418 Bacteria 15453
314 Ga0395900_0006485 3300037418 Bacteria 12203
315 Ga0395900_0060366 3300037418 Unclassified 3902
316 Ga0395900_0132483 3300037418 Bacteria 2554
317 Ga0395900_0324255 3300037418 Unclassified 1520
318 Ga0395898_0002328 3300037466 Bacteria 22664
319 Ga0395898_0032494 3300037466 Bacteria 5209
320 Ga0395898_0246186 3300037466 Bacteria 1705
321 Ga0395898_0610659 3300037466 Unclassified 1033
322 Ga0395905_0002088 3300037471 Bacteria 22707
323 Ga0395905_0002224 3300037471 Bacteria 21889
324 Ga0395905_0124484 3300037471 Bacteria 2424
325 Ga0395905_0246190 3300037471 Unclassified 1670
326 Ga0395901_0004925 3300038443 Bacteria 13477
327 Ga0395901_0017072 3300038443 Bacteria 7399
328 Ga0395901_0050877 3300038443 Bacteria 4305
329 Ga0395901_0134000 3300038443 Bacteria 2603
330 Ga0395901_0380508 3300038443 Bacteria 1453
331 Ga0436363_1489138 3300039450 Bacteria 4868
332 Ga0436362_0657798 3300039453 Bacteria 1512
333 Ga0451804_0656621 3300041463 Bacteria 1020
334 Ga0451849_0020420 3300041505 Unclassified 940
335 Ga0451853_0440107 3300041512 Bacteria 2624
336 Ga0451853_3025537 3300041512 Bacteria 4298
337 Ga0439448_0067685 3300042005 Bacteria 1186
338 Ga0466972_0212606 3300044658 Unclassified 905
339 Ga0466966_0017608 3300044684 Bacteria 4720
340 Ga0466966_0042409 3300044684 Bacteria 2920
341 Ga0466966_0144073 3300044684 Bacteria 1455
342 Ga0466961_0029169 3300044693 Bacteria 3547
343 Ga0466961_0242918 3300044693 Bacteria 1106
344 Ga0466963_0013532 3300044694 Bacteria 5010
345 Ga0466963_0048693 3300044694 Bacteria 2801
346 Ga0466963_0089458 3300044694 Bacteria 2094
347 Ga0466963_0118312 3300044694 Bacteria 1822
348 Ga0466963_0234784 3300044694 Bacteria 1285
349 Ga0466964_0001921 3300044706 Bacteria 7270
350 Ga0466964_0006965 3300044706 Bacteria 4226
351 Ga0466964_0012845 3300044706 Bacteria 3172
352 Ga0466964_0017348 3300044706 Bacteria 2754
353 Ga0466964_0060192 3300044706 Bacteria 1579
354 Ga0466964_0063938 3300044706 Bacteria 1538
355 Ga0466971_0001404 3300044719 Bacteria 10116
356 Ga0466968_0038545 3300044735 Bacteria 2008
357 Ga0466970_0086106 3300044765 Bacteria 1703
358 Ga0466970_0107221 3300044765 Bacteria 1524
359 Ga0466957_0026133 3300044842 Bacteria 3462
360 Ga0466960_0074108 3300044901 Bacteria 1700
361 Ga0466960_0083080 3300044901 Bacteria 1618
362 Ga0466960_0139911 3300044901 Bacteria 1285
363 Ga0466959_0008546 3300045049 Bacteria 7245
364 Ga0466958_0010225 3300045836 Bacteria 5248
365 Ga0466958_0032175 3300045836 Bacteria 3119
366 Ga0466958_0127277 3300045836 Bacteria 1597
367 Ga0466958_0259839 3300045836 Bacteria 1111
368 Ga0466967_0002953 3300045976 Bacteria 10866
369 Ga0466967_0023142 3300045976 Bacteria 5087
370 Ga0466967_0023418 3300045976 Bacteria 5059
371 Ga0466967_0026193 3300045976 Bacteria 4825
372 Ga0466967_0040748 3300045976 Bacteria 4000
373 Ga0466967_0079370 3300045976 Bacteria 2958
374 Ga0466967_0096369 3300045976 Bacteria 2698
375 Ga0466967_0202919 3300045976 Bacteria 1878
376 Ga0466967_0282033 3300045976 Bacteria 1594
377 Ga0466967_0343650 3300045976 Bacteria 1443
378 Ga0466967_0621466 3300045976 Bacteria 1067
379 Ga0495592_0002297 3300046454 Bacteria 13484
380 Ga0495592_0141858 3300046454 Bacteria 1670
381 Ga0495603_0001374 3300046455 Bacteria 14134
382 Ga0495641_0001029 3300046461 Bacteria 23958
383 Ga0495651_0063055 3300046462 Bacteria 2834
384 Ga0495651_0067201 3300046462 Bacteria 2735
385 Ga0495653_0085487 3300046463 Bacteria 2320
386 Ga0495653_0458011 3300046463 Unclassified 801
387 Ga0495580_0058991 3300046472 Bacteria 2697
388 Ga0495582_0062823 3300046473 Bacteria 2051
389 Ga0495582_0063070 3300046473 Bacteria 2047
390 Ga0495582_0120801 3300046473 Unclassified 1476
391 Ga0495639_0046160 3300046475 Bacteria 1972
392 Ga0495639_0081940 3300046475 Bacteria 1504
393 Ga0495594_0010001 3300046499 Bacteria 4914
394 Ga0495608_0109497 3300046511 Bacteria 1776
395 Ga0495618_0066905 3300046514 Bacteria 2284
396 Ga0495628_0025903 3300046516 Bacteria 4789
397 Ga0495630_0002755 3300046517 Bacteria 12186
398 Ga0495666_0006362 3300046526 Bacteria 5946
399 Ga0495652_0060674 3300046529 Bacteria 3195
400 Ga0495652_0125760 3300046529 Bacteria 2037
401 Ga0495587_0032660 3300046536 Bacteria 3145
402 Ga0495645_0033507 3300046543 Bacteria 3747
403 Ga0495667_0150623 3300046559 Bacteria 1498
404 Ga0495667_0245668 3300046559 Unclassified 1139
405 Ga0495635_0134043 3300046663 Bacteria 1688
406 Ga0495588_0001380 3300046674 Bacteria 10369
407 Ga0495599_0013577 3300046678 Bacteria 5033
408 Ga0495646_0052426 3300046680 Bacteria 2464
409 Ga0495674_0428072 3300047319 Bacteria 1066
410 Ga0495676_0021605 3300047321 Bacteria 5616
411 Ga0495676_0033643 3300047321 Bacteria 4313
412 Ga0495676_0302963 3300047321 Unclassified 1077
413 Ga0495675_0033522 3300047444 Bacteria 3278
414 Ga0495602_0060717 3300048088 Bacteria 3292
415 Ga0495602_0362884 3300048088 Bacteria 1042
416 Ga0496100_0100341 3300048903 Bacteria 1994
417 Ga0496101_0037427 3300048904 Bacteria 3441
418 Ga0496101_0043081 3300048904 Bacteria 3224
419 Ga0496101_0119683 3300048904 Bacteria 1990
420 Ga0496102_0033720 3300048905 Bacteria 4603
421 Ga0496102_0160067 3300048905 Bacteria 2117
422 Ga0496103_0023143 3300048906 Bacteria 3745
423 Ga0496103_0125428 3300048906 Bacteria 1637
424 Ga0496104_0012149 3300048907 Bacteria 7734
425 Ga0496104_0012510 3300048907 Bacteria 7630
426 Ga0496104_0515054 3300048907 Bacteria 1107
427 Ga0496105_0017035 3300048908 Bacteria 5816
428 Ga0496105_0057721 3300048908 Bacteria 3204
429 Ga0496105_0192672 3300048908 Bacteria 1666
430 Ga0496108_0147565 3300048911 Bacteria 2028
431 Ga0496108_0233677 3300048911 Bacteria 1599
432 Ga0496109_0040723 3300048912 Bacteria 4208
433 Ga0496109_0121328 3300048912 Bacteria 2435
434 Ga0496109_0179473 3300048912 Bacteria 1988
435 Ga0496110_0045368 3300048913 Bacteria 3842
436 Ga0496110_0296935 3300048913 Bacteria 1472
437 Ga0496111_0022989 3300048914 Bacteria 4372
438 Ga0496111_0143037 3300048914 Bacteria 1773
439 Ga0496111_0150434 3300048914 Bacteria 1726
440 Ga0496111_0331435 3300048914 Bacteria 1127
441 Ga0496112_0057801 3300048915 Bacteria 3820
442 Ga0496112_0100595 3300048915 Bacteria 2860
443 Ga0496112_0275798 3300048915 Bacteria 1629
444 Ga0496113_0074599 3300048916 Bacteria 2586
445 Ga0496113_0088291 3300048916 Bacteria 2385
446 Ga0496113_0717135 3300048916 Bacteria 797
447 Ga0496114_0003589 3300048917 Bacteria 11921
448 Ga0496114_0012957 3300048917 Bacteria 6680
449 Ga0496115_0059987 3300048918 Bacteria 3064
450 Ga0496115_0262940 3300048918 Bacteria 1419
451 Ga0496115_0627860 3300048918 Bacteria 851
452 Ga0501047_0044250 3300049581 Bacteria 4301
453 Ga0501047_0180715 3300049581 Bacteria 1976
454 Ga0501067_0003757 3300049583 Bacteria 8366
455 Ga0501069_0057664 3300049585 Bacteria 2165
456 Ga0501070_0023174 3300049586 Bacteria 5201
457 Ga0501035_0307703 3300049822 Bacteria 1334
458 Ga0501044_0222524 3300049823 Bacteria 1838
459 nmdc:mga05p37_222731_c1 3300050507 Bacteria 2276
460 nmdc:mga0n895_180276_c1 3300050512 Bacteria 2144
461 nmdc:mga0n895_367662_c1 3300050512 Bacteria 1456
462 nmdc:mga0n895_579136_c1 3300050512 Bacteria 1126
463 nmdc:mga0n895_89520_c1 3300050512 Bacteria 3079
464 nmdc:mga0rr50_113657_c1 3300050513 Bacteria 2146
465 nmdc:mga0rr50_98071_c1 3300050513 Bacteria 2296
466 nmdc:mga08x19_16014_c1 3300050514 Bacteria 4568
467 nmdc:mga08x19_61370_c1 3300050514 Bacteria 2436
468 Ga0495601_0043963 3300053077 Bacteria 2807
469 Ga0495601_0079885 3300053077 Bacteria 2097
470 Ga0495601_0403268 3300053077 Unclassified 886
471 Ga0495612_0037476 3300053078 Bacteria 1969
472 Ga0495595_0022685 3300053084 Bacteria 2757
473 Ga0495595_0054577 3300053084 Bacteria 1858
474 Ga0495595_0174930 3300053084 Bacteria 1063
475 Ga0587084_007130 3300059477 Bacteria 1379
476 Ga0587093_024421 3300059478 Unclassified 832
477 Ga0587066_016909 3300059490 Bacteria 1155
478 Ga0587066_020250 3300059490 Unclassified 1091
479 Ga0587066_025380 3300059490 Bacteria 1016
480 Ga0587066_049865 3300059490 Unclassified 820
481 Ga0587070_023862 3300059491 Bacteria 1054
482 Ga0587070_026890 3300059491 Bacteria 1015
483 Ga0587070_034292 3300059491 Unclassified 938
484 Ga0587070_047803 3300059491 Unclassified 843
485 Ga0587073_0005728 3300059492 Bacteria 1869
486 Ga0587073_0011475 3300059492 Bacteria 1513
487 Ga0587073_0015227 3300059492 Bacteria 1383
488 Ga0587073_0022631 3300059492 Bacteria 1222
489 Ga0587073_0025007 3300059492 Bacteria 1184
490 Ga0587073_0030655 3300059492 Bacteria 1108
491 Ga0587073_0045831 3300059492 Bacteria 972
492 Ga0587073_0079124 3300059492 Bacteria 812
493 Ga0587073_0103526 3300059492 Bacteria 743
494 Ga0587077_007338 3300059493 Bacteria 1601
495 Ga0587080_001371 3300059503 Bacteria 2617
496 Ga0587080_004796 3300059503 Bacteria 1781
497 Ga0587080_020936 3300059503 Unclassified 1072
498 Ga0587080_039551 3300059503 Bacteria 854
499 Ga0587082_001746 3300059504 Bacteria 2324
500 Ga0587082_013030 3300059504 Bacteria 1246
501 Ga0587082_022875 3300059504 Unclassified 1032
502 Ga0587082_034728 3300059504 Bacteria 897
503 Ga0587082_046650 3300059504 Bacteria 813
504 Ga0587083_0003155 3300059505 Bacteria 2152
505 Ga0587083_0004990 3300059505 Bacteria 1888
506 Ga0587083_0016287 3300059505 Bacteria 1313
507 Ga0587083_0019765 3300059505 Bacteria 1233
508 Ga0587083_0033981 3300059505 Unclassified 1032
509 Ga0587083_0082325 3300059505 Bacteria 769
510 Ga0587085_024971 3300059506 Bacteria 941
511 Ga0587086_004538 3300059507 Bacteria 1459
512 Ga0587086_023087 3300059507 Bacteria 865
513 Ga0587088_005801 3300059508 Bacteria 1640
514 Ga0587088_027099 3300059508 Bacteria 999
515 Ga0587088_027976 3300059508 Bacteria 989
516 Ga0587088_028753 3300059508 Bacteria 980
517 Ga0587089_004085 3300059509 Bacteria 1596
518 Ga0587089_021482 3300059509 Bacteria 896
519 Ga0587089_035952 3300059509 Bacteria 749
520 Ga0587090_007336 3300059510 Bacteria 1445
521 Ga0587090_018402 3300059510 Bacteria 1067
522 Ga0587090_019651 3300059510 Bacteria 1044
523 Ga0587090_036698 3300059510 Bacteria 845
524 Ga0587090_037863 3300059510 Unclassified 836
525 Ga0587091_010343 3300059511 Bacteria 1426
526 Ga0587091_021919 3300059511 Bacteria 1124
527 Ga0587091_031929 3300059511 Unclassified 993
528 Ga0587091_037176 3300059511 Unclassified 944
529 Ga0587092_020687 3300059512 Bacteria 1015
530 Ga0587094_014717 3300059513 Bacteria 1073
531 Ga0587095_001180 3300059514 Bacteria 1555
532 Ga0587098_005611 3300059604 Bacteria 1239
533 Ga0587106_000914 3300059605 Bacteria 2389
534 Ga0587106_012082 3300059605 Bacteria 1152
535 Ga0587106_016955 3300059605 Bacteria 1036
536 Ga0587106_019733 3300059605 Bacteria 987
537 Ga0587106_037563 3300059605 Bacteria 808
538 Ga0587125_007673 3300059607 Bacteria 1052
539 Ga0587125_022763 3300059607 Unclassified 751
540 Ga0587129_000372 3300059608 Bacteria 1945
541 Ga0587129_008139 3300059608 Unclassified 772
542 Ga0587099_004479 3300059622 Bacteria 1214
543 Ga0587099_008800 3300059622 Bacteria 981
544 Ga0587099_010201 3300059622 Bacteria 934
545 Ga0587099_012061 3300059622 Unclassified 884
546 Ga0587099_019333 3300059622 Bacteria 758
547 Ga0587101_013962 3300059623 Bacteria 1066
548 Ga0587113_000759 3300059625 Bacteria 1874
549 Ga0587113_003209 3300059625 Bacteria 1234
550 Ga0587113_006877 3300059625 Unclassified 977
551 Ga0587113_008197 3300059625 Bacteria 924
552 Ga0587113_009036 3300059625 Bacteria 896
553 Ga0587115_003014 3300059626 Bacteria 1736
554 Ga0587115_009968 3300059626 Bacteria 1175
555 Ga0587115_012902 3300059626 Bacteria 1075
556 Ga0587115_015699 3300059626 Bacteria 1005
557 Ga0587115_021213 3300059626 Bacteria 907
558 Ga0587117_035707 3300059627 Bacteria 771
559 Ga0587128_016043 3300059630 Bacteria 1093
560 Ga0587128_018077 3300059630 Bacteria 1052
561 Ga0587128_026075 3300059630 Bacteria 935
562 Ga0587130_004606 3300059631 Bacteria 1210
563 Ga0587130_010392 3300059631 Unclassified 908
564 Ga0587067_013886 3300059640 Bacteria 1283
565 Ga0587067_027956 3300059640 Bacteria 1021
566 Ga0587067_032582 3300059640 Unclassified 970
567 Ga0587067_070598 3300059640 Bacteria 753
568 Ga0587067_075760 3300059640 Bacteria 735
569 Ga0587068_041702 3300059641 Bacteria 832
570 Ga0587069_007583 3300059642 Bacteria 1345
571 Ga0587072_008683 3300059643 Bacteria 1614
572 Ga0587072_020498 3300059643 Bacteria 1166
573 Ga0587075_002297 3300059644 Bacteria 2004
574 Ga0587075_006085 3300059644 Bacteria 1468
575 Ga0587075_006107 3300059644 Bacteria 1467
576 Ga0587075_010309 3300059644 Bacteria 1234
577 Ga0587075_019832 3300059644 Bacteria 988
578 Ga0587075_022363 3300059644 Bacteria 949
579 Ga0587076_014819 3300059645 Bacteria 1206
580 Ga0587076_037902 3300059645 Bacteria 888
581 Ga0587076_066934 3300059645 Bacteria 737
582 Ga0587079_076573 3300059647 Bacteria 757
583 Ga0587100_004938 3300059648 Bacteria 975
584 Ga0587104_005253 3300059650 Bacteria 848
585 Ga0587105_003346 3300059651 Bacteria 971
586 Ga0587107_007428 3300059652 Bacteria 1235
587 Ga0587107_013405 3300059652 Bacteria 1039
588 Ga0587107_021051 3300059652 Bacteria 910
589 Ga0587107_031584 3300059652 Bacteria 809
590 Ga0587107_038955 3300059652 Unclassified 759
591 Ga0587114_003064 3300059655 Bacteria 1624
592 Ga0587114_007853 3300059655 Bacteria 1235
593 Ga0587114_024768 3300059655 Bacteria 875
594 Ga0587114_026750 3300059655 Bacteria 855
595 Ga0587116_03386 3300059656 Bacteria 889
596 Ga0587120_002168 3300059659 Bacteria 1311
597 Ga0587120_005511 3300059659 Bacteria 974
598 Ga0587120_006742 3300059659 Bacteria 909
599 Ga0587120_010890 3300059659 Unclassified 775
600 Ga0587071_008937 3300060344 Bacteria 1637
601 Ga0587071_023948 3300060344 Bacteria 1136
602 Ga0587071_030361 3300060344 Bacteria 1038
603 Ga0587111_0014690 3300060346 Bacteria 1420
604 Ga0501082_0674644 3300060353 Bacteria 905
605 Ga0466962_0001120 3300061719 Bacteria 12353
606 Ga0466962_0037866 3300061719 Bacteria 2310
607 Ga0466962_0088056 3300061719 Bacteria 1487
608 Ga0395899_0006817
609 Ga0006778J45830_1046933
610 Ga0006777J48905_1034236
611 Ga0006777J48905_1054924
612 Ga0007429J51699_1033401
613 Ga0007429J51699_1035782
614 Ga0007429J51699_1037001
615 Ga0058863_10162758
616 Ga0058861_10061845
617 Ga0058861_10094513
618 Ga0058862_10258641
619 Ga0058862_12291324
620 Ga0070658_10017971
621 Ga0070658_10467579
622 Ga0070658_10576907
623 Ga0070683_100013353
624 Ga0070683_100021503
625 Ga0070683_100025113
626 Ga0070683_100054839
627 Ga0070683_100124246
628 Ga0070683_100207107
629 Ga0070680_100119998
630 Ga0070682_100014551
631 Ga0070682_100042489
632 Ga0070682_100072012
633 Ga0070682_100074011
634 Ga0068868_100102574
635 Ga0068868_100680054
636 Ga0070660_100024791
637 Ga0070660_100089471
638 Ga0070660_100842905
639 Ga0070691_10077027
640 Ga0070661_100515709
641 Ga0070659_100004986
642 Ga0070659_100650205
643 Ga0070709_10010616
644 Ga0070709_10406572
645 Ga0070714_100000004
646 Ga0070714_100008041
647 Ga0070714_100016585
648 Ga0070714_100034006
649 Ga0070714_100044409
650 Ga0070714_100118359
651 Ga0070714_100207153
652 Ga0070714_100232348
653 Ga0070714_100238314
654 Ga0070713_100057847
655 Ga0070713_100081529
656 Ga0070710_10007711
657 Ga0070711_100083617
658 Ga0070711_100330320
659 Ga0070705_100132116
660 Ga0070700_100152516
661 Ga0070708_100029860
662 Ga0070708_100440173
663 Ga0070708_100448277
664 Ga0070708_100601714
665 Ga0070663_100056557
666 Ga0070662_100053410
667 Ga0070681_10055588
668 Ga0068867_100588656
669 Ga0070706_100000171
670 Ga0070706_100004496
671 Ga0070706_100050569
672 Ga0070706_100271607
673 Ga0070706_100434089
674 Ga0070706_100470422
675 Ga0070707_100001413
676 Ga0070707_100103489
677 Ga0070707_100248921
678 Ga0070707_100479435
679 Ga0070698_100013485
680 Ga0070698_100078640
681 Ga0070699_100000071
682 Ga0070699_100000782
683 Ga0070699_100001466
684 Ga0070679_100163836
685 Ga0070679_100607814
686 Ga0070684_100081771
687 Ga0070684_100100128
688 Ga0070684_100128594
689 Ga0070684_100306533
690 Ga0070684_100692771
691 Ga0070697_100000064
692 Ga0070697_100004794
693 Ga0070697_100616170
694 Ga0068853_100375003
695 Ga0070686_100135754
696 Ga0070695_100198891
697 Ga0070693_100008935
698 Ga0070693_100080334
699 Ga0068855_100106950
700 Ga0068855_100109873
701 Ga0070664_100444863
702 Ga0068854_100027964
703 Ga0068854_100231037
704 Ga0068856_100017118
705 Ga0068856_100017942
706 Ga0068856_100048466
707 Ga0068856_100059315
708 Ga0068856_100114291
709 Ga0068856_100121310
710 Ga0070702_100161030
711 Ga0070702_100251141
712 Ga0068852_100215410
713 Ga0068866_10304762
714 Ga0068861_100331827
715 Ga0068870_10128262
716 Ga0081455_10016539
717 Ga0081455_10020921
718 Ga0081455_10068090
719 Ga0081539_10001238
720 Ga0070717_10000009
721 Ga0070717_10000234
722 Ga0070717_10000584
723 Ga0070717_10019874
724 Ga0070717_10021141
725 Ga0070717_10034549
726 Ga0070717_10066125
727 Ga0070717_10170326
728 Ga0070717_10481447
729 Ga0070717_10594292
730 Ga0070715_10003708
731 Ga0070716_100079995
732 Ga0070716_100116921
733 Ga0070716_100160889
734 Ga0097621_100399327
735 Ga0068871_100006687
736 Ga0068871_100378766
737 Ga0075428_100336479
738 Ga0075431_100562742
739 Ga0075433_10023169
740 Ga0075434_100006283
741 Ga0075434_100334360
742 Ga0075434_100735860
743 Ga0075429_100100089
744 Ga0075436_100062988
745 Ga0075436_100093250
746 Ga0075435_100053835
747 Ga0075435_100225690
748 Ga0105240_10008131
749 Ga0105240_10647585
750 Ga0105240_10689739
751 Ga0105240_10927869
752 Ga0105245_10039503
753 Ga0105245_10049721
754 Ga0105245_10128847
755 Ga0105245_10442478
756 Ga0114129_10259849
757 Ga0105243_10239091
758 Ga0105241_10057676
759 Ga0105238_10048038
760 Ga0105238_10937233
761 Ga0105239_10095076
762 Ga0105239_10424501
763 Ga0105239_10591577
764 Ga0154016_140780
765 Ga0154012_112501
766 Ga0154012_122835
767 Ga0157373_10207814
768 Ga0157371_10460881
769 Ga0157370_10392488
770 Ga0157369_10039129
771 Ga0157369_10053567
772 Ga0157369_10192377
773 Ga0157369_10219882
774 Ga0157374_10220186
775 Ga0157378_10336120
776 Ga0157372_10570121
777 Ga0157376_10041715
778 Ga0182005_1069699
779 Ga0197907_10199073
780 Ga0197907_10288058
781 Ga0197907_10353616
782 Ga0197907_10411427
783 Ga0197907_10956749
784 Ga0197907_11511263
785 Ga0206356_10031978
786 Ga0206356_10979336
787 Ga0206356_11808036
788 Ga0206349_1157557
789 Ga0206349_1454904
790 Ga0206349_1458029
791 Ga0206349_1541529
792 Ga0206355_1181590
793 Ga0206355_1440801
794 Ga0206355_1588096
795 Ga0206351_10401032
796 Ga0206351_10437600
797 Ga0206352_10390842
798 Ga0206352_10398134
799 Ga0206350_10062944
800 Ga0206350_10094212
801 Ga0206350_10250503
802 Ga0206350_10458458
803 Ga0206350_10582101
804 Ga0206354_10786195
805 Ga0206353_10056259
806 Ga0206353_10080838
807 Ga0206353_10691849
808 Ga0206353_10723633
809 Ga0154015_1033170
810 Ga0154015_1083977
811 Ga0154015_1610023
812 Ga0224712_10007955
813 Ga0224712_10008611
814 Ga0224712_10027064
815 Ga0224712_10027191
816 Ga0224712_10032242
817 Ga0224712_10035631
818 Ga0207692_10008882
819 Ga0207692_10022511
820 Ga0207688_10260750
821 Ga0207680_10244059
822 Ga0207685_10003839
823 Ga0207699_10023261
824 Ga0207699_10037660
825 Ga0207705_10010732
826 Ga0207684_10000003
827 Ga0207684_10000012
828 Ga0207684_10000485
829 Ga0207684_10087834
830 Ga0207684_10235317
831 Ga0207654_10081824
832 Ga0207707_10100311
833 Ga0207695_10032725
834 Ga0207693_10006545
835 Ga0207663_10024769
836 Ga0207663_10422041
837 Ga0207660_10381309
838 Ga0207657_10008296
839 Ga0207657_10051327
840 Ga0207649_10028768
841 Ga0207649_10057187
842 Ga0207652_10172995
843 Ga0207646_10000779
844 Ga0207646_10001583
845 Ga0207646_10003154
846 Ga0207646_10010089
847 Ga0207646_10309501
848 Ga0207646_10429443
849 Ga0207694_10282743
850 Ga0207659_11061631
851 Ga0207687_10024956
852 Ga0207687_10071237
853 Ga0207687_10136943
854 Ga0207687_10713576
855 Ga0207700_10000021
856 Ga0207700_10055175
857 Ga0207700_10087738
858 Ga0207700_10338776
859 Ga0207664_10000018
860 Ga0207664_10012279
861 Ga0207664_10031861
862 Ga0207664_10040478
863 Ga0207664_10044215
864 Ga0207664_10051387
865 Ga0207664_10066059
866 Ga0207664_10284610
867 Ga0207664_10291240
868 Ga0207690_10887786
869 Ga0207706_10068259
870 Ga0207669_10547678
871 Ga0207665_10002447
872 Ga0207665_10015388
873 Ga0207665_10244008
874 Ga0207665_10827800
875 Ga0207661_10086197
876 Ga0207661_10222825
877 Ga0207661_10300352
878 Ga0207661_10577332
879 Ga0207667_10051598
880 Ga0207667_10052247
881 Ga0207667_10214127
882 Ga0207677_10075698
883 Ga0207639_10309193
884 Ga0207678_10046705
885 Ga0207708_10312095
886 Ga0207708_10541757
887 Ga0207702_10003936
888 Ga0207702_10009634
889 Ga0207702_10182059
890 Ga0207702_10213897
891 Ga0207702_10253977
892 Ga0207702_10318094
893 Ga0207702_10388526
894 Ga0207648_10536467
895 Ga0207648_10890226
896 Ga0207675_100309614
897 Ga0207683_10001031
898 Ga0207698_10178339
899 Ga0265322_10020648
900 Ga0265338_10010639
901 Ga0265338_10307668
902 Ga0307415_100149097
903 Ga0373958_0043867
904 Ga0373928_0106423
905 Ga0373949_0037597
906 Ga0373952_0043224
907 Ga0373936_0083502
908 Ga0373945_0029460
909 Ga0373960_0065789
910 Ga0373943_0003105
911 Ga0373946_0022399
912 Ga0373942_0108689
913 Ga0373931_0028284
914 Ga0373947_0004365
915 Ga0373947_0137048
916 Ga0373937_0267283
917 Ga0373925_0060860
918 Ga0395899_0028998
919 Ga0395899_0187012
920 Ga0395900_0004133
921 Ga0395900_0006485
922 Ga0395900_0060366
923 Ga0395900_0132483
924 Ga0395900_0324255
925 Ga0395898_0002328
926 Ga0395898_0032494
927 Ga0395898_0246186
928 Ga0395898_0610659
929 Ga0395905_0002088
930 Ga0395905_0002224
931 Ga0395905_0124484
932 Ga0395905_0246190
933 Ga0395901_0004925
934 Ga0395901_0017072
935 Ga0395901_0050877
936 Ga0395901_0134000
937 Ga0395901_0380508
938 Ga0436363_1489138
939 Ga0436362_0657798
940 Ga0451804_0656621
941 Ga0451849_0020420
942 Ga0451853_0440107
943 Ga0451853_3025537
944 Ga0439448_0067685
945 Ga0466972_0212606
946 Ga0466966_0017608
947 Ga0466966_0042409
948 Ga0466966_0144073
949 Ga0466961_0029169
950 Ga0466961_0242918
951 Ga0466963_0013532
952 Ga0466963_0048693
953 Ga0466963_0089458
954 Ga0466963_0118312
955 Ga0466963_0234784
956 Ga0466964_0001921
957 Ga0466964_0006965
958 Ga0466964_0012845
959 Ga0466964_0017348
960 Ga0466964_0060192
961 Ga0466964_0063938
962 Ga0466971_0001404
963 Ga0466968_0038545
964 Ga0466970_0086106
965 Ga0466970_0107221
966 Ga0466957_0026133
967 Ga0466960_0074108
968 Ga0466960_0083080
969 Ga0466960_0139911
970 Ga0466959_0008546
971 Ga0466958_0010225
972 Ga0466958_0032175
973 Ga0466958_0127277
974 Ga0466958_0259839
975 Ga0466967_0002953
976 Ga0466967_0023142
977 Ga0466967_0023418
978 Ga0466967_0026193
979 Ga0466967_0040748
980 Ga0466967_0079370
981 Ga0466967_0096369
982 Ga0466967_0202919
983 Ga0466967_0282033
984 Ga0466967_0343650
985 Ga0466967_0621466
986 Ga0495592_0002297
987 Ga0495592_0141858
988 Ga0495603_0001374
989 Ga0495641_0001029
990 Ga0495651_0063055
991 Ga0495651_0067201
992 Ga0495653_0085487
993 Ga0495653_0458011
994 Ga0495580_0058991
995 Ga0495582_0062823
996 Ga0495582_0063070
997 Ga0495582_0120801
998 Ga0495639_0046160
999 Ga0495639_0081940
1000 Ga0495594_0010001
1001 Ga0495608_0109497
1002 Ga0495618_0066905
1003 Ga0495628_0025903
1004 Ga0495630_0002755
1005 Ga0495666_0006362
1006 Ga0495652_0060674
1007 Ga0495652_0125760
1008 Ga0495587_0032660
1009 Ga0495645_0033507
1010 Ga0495667_0150623
1011 Ga0495667_0245668
1012 Ga0495635_0134043
1013 Ga0495588_0001380
1014 Ga0495599_0013577
1015 Ga0495646_0052426
1016 Ga0495674_0428072
1017 Ga0495676_0021605
1018 Ga0495676_0033643
1019 Ga0495676_0302963
1020 Ga0495675_0033522
1021 Ga0495602_0060717
1022 Ga0495602_0362884
1023 Ga0496100_0100341
1024 Ga0496101_0037427
1025 Ga0496101_0043081
1026 Ga0496101_0119683
1027 Ga0496102_0033720
1028 Ga0496102_0160067
1029 Ga0496103_0023143
1030 Ga0496103_0125428
1031 Ga0496104_0012149
1032 Ga0496104_0012510
1033 Ga0496104_0515054
1034 Ga0496105_0017035
1035 Ga0496105_0057721
1036 Ga0496105_0192672
1037 Ga0496108_0147565
1038 Ga0496108_0233677
1039 Ga0496109_0040723
1040 Ga0496109_0121328
1041 Ga0496109_0179473
1042 Ga0496110_0045368
1043 Ga0496110_0296935
1044 Ga0496111_0022989
1045 Ga0496111_0143037
1046 Ga0496111_0150434
1047 Ga0496111_0331435
1048 Ga0496112_0057801
1049 Ga0496112_0100595
1050 Ga0496112_0275798
1051 Ga0496113_0074599
1052 Ga0496113_0088291
1053 Ga0496113_0717135
1054 Ga0496114_0003589
1055 Ga0496114_0012957
1056 Ga0496115_0059987
1057 Ga0496115_0262940
1058 Ga0496115_0627860
1059 Ga0501047_0044250
1060 Ga0501047_0180715
1061 Ga0501067_0003757
1062 Ga0501069_0057664
1063 Ga0501070_0023174
1064 Ga0501035_0307703
1065 Ga0501044_0222524
1066 nmdc:mga05p37_222731_c1
1067 nmdc:mga0n895_180276_c1
1068 nmdc:mga0n895_367662_c1
1069 nmdc:mga0n895_579136_c1
1070 nmdc:mga0n895_89520_c1
1071 nmdc:mga0rr50_113657_c1
1072 nmdc:mga0rr50_98071_c1
1073 nmdc:mga08x19_16014_c1
1074 nmdc:mga08x19_61370_c1
1075 Ga0495601_0043963
1076 Ga0495601_0079885
1077 Ga0495601_0403268
1078 Ga0495612_0037476
1079 Ga0495595_0022685
1080 Ga0495595_0054577
1081 Ga0495595_0174930
1082 Ga0587084_007130
1083 Ga0587093_024421
1084 Ga0587066_016909
1085 Ga0587066_020250
1086 Ga0587066_025380
1087 Ga0587066_049865
1088 Ga0587070_023862
1089 Ga0587070_026890
1090 Ga0587070_034292
1091 Ga0587070_047803
1092 Ga0587073_0005728
1093 Ga0587073_0011475
1094 Ga0587073_0015227
1095 Ga0587073_0022631
1096 Ga0587073_0025007
1097 Ga0587073_0030655
1098 Ga0587073_0045831
1099 Ga0587073_0079124
1100 Ga0587073_0103526
1101 Ga0587077_007338
1102 Ga0587080_001371
1103 Ga0587080_004796
1104 Ga0587080_020936
1105 Ga0587080_039551
1106 Ga0587082_001746
1107 Ga0587082_013030
1108 Ga0587082_022875
1109 Ga0587082_034728
1110 Ga0587082_046650
1111 Ga0587083_0003155
1112 Ga0587083_0004990
1113 Ga0587083_0016287
1114 Ga0587083_0019765
1115 Ga0587083_0033981
1116 Ga0587083_0082325
1117 Ga0587085_024971
1118 Ga0587086_004538
1119 Ga0587086_023087
1120 Ga0587088_005801
1121 Ga0587088_027099
1122 Ga0587088_027976
1123 Ga0587088_028753
1124 Ga0587089_004085
1125 Ga0587089_021482
1126 Ga0587089_035952
1127 Ga0587090_007336
1128 Ga0587090_018402
1129 Ga0587090_019651
1130 Ga0587090_036698
1131 Ga0587090_037863
1132 Ga0587091_010343
1133 Ga0587091_021919
1134 Ga0587091_031929
1135 Ga0587091_037176
1136 Ga0587092_020687
1137 Ga0587094_014717
1138 Ga0587095_001180
1139 Ga0587098_005611
1140 Ga0587106_000914
1141 Ga0587106_012082
1142 Ga0587106_016955
1143 Ga0587106_019733
1144 Ga0587106_037563
1145 Ga0587125_007673
1146 Ga0587125_022763
1147 Ga0587129_000372
1148 Ga0587129_008139
1149 Ga0587099_004479
1150 Ga0587099_008800
1151 Ga0587099_010201
1152 Ga0587099_012061
1153 Ga0587099_019333
1154 Ga0587101_013962
1155 Ga0587113_000759
1156 Ga0587113_003209
1157 Ga0587113_006877
1158 Ga0587113_008197
1159 Ga0587113_009036
1160 Ga0587115_003014
1161 Ga0587115_009968
1162 Ga0587115_012902
1163 Ga0587115_015699
1164 Ga0587115_021213
1165 Ga0587117_035707
1166 Ga0587128_016043
1167 Ga0587128_018077
1168 Ga0587128_026075
1169 Ga0587130_004606
1170 Ga0587130_010392
1171 Ga0587067_013886
1172 Ga0587067_027956
1173 Ga0587067_032582
1174 Ga0587067_070598
1175 Ga0587067_075760
1176 Ga0587068_041702
1177 Ga0587069_007583
1178 Ga0587072_008683
1179 Ga0587072_020498
1180 Ga0587075_002297
1181 Ga0587075_006085
1182 Ga0587075_006107
1183 Ga0587075_010309
1184 Ga0587075_019832
1185 Ga0587075_022363
1186 Ga0587076_014819
1187 Ga0587076_037902
1188 Ga0587076_066934
1189 Ga0587079_076573
1190 Ga0587100_004938
1191 Ga0587104_005253
1192 Ga0587105_003346
1193 Ga0587107_007428
1194 Ga0587107_013405
1195 Ga0587107_021051
1196 Ga0587107_031584
1197 Ga0587107_038955
1198 Ga0587114_003064
1199 Ga0587114_007853
1200 Ga0587114_024768
1201 Ga0587114_026750
1202 Ga0587116_03386
1203 Ga0587120_002168
1204 Ga0587120_005511
1205 Ga0587120_006742
1206 Ga0587120_010890
1207 Ga0587071_008937
1208 Ga0587071_023948
1209 Ga0587071_030361
1210 Ga0587111_0014690
1211 Ga0501082_0674644
1212 Ga0466962_0001120
1213 Ga0466962_0037866
1214 Ga0466962_0088056

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01184

Gpr1_Fun34_YaaH

GPR1/FUN34/yaaH family

17

219

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zug-assembly1.cif.gz_F structure of the bacterial acetate channel satp 0.9453 20 208
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.9344 20 209
5zug-assembly1.cif.gz_F structure of the bacterial acetate channel satp 0.9301 20 208
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.8912 20 209
5z62-assembly1.cif.gz_C structure of human cytochrome c oxidase 0.4684 24 197
ID Description Score Start End Superfamily
6humE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4584 109 198 1.10.287.3510
af_A4I3V6_8_216_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.4576 26 188 1.20.1420.10
af_G2J646_1_138_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4512 19 171 1.20.140.150
af_Q10346_7_181_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.4326 24 185 1.20.1420.10
af_Q9XW96_22_330_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.427 20 195 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A4U8YUC0-F1-model_v4 Acetate transporter gpr1/fun34/satp family 0.953 20 208 GO:0005886
GO:0015360
GO:0071422
AF-A0A7S4PB93-F1-model_v4 Acetate transporter 0.9485 20 213 GO:0005886
GO:0015123
AF-A0A1C3YZH6-F1-model_v4 Succinate-acetate transporter protein 0.9473 16 209 GO:0005886
GO:0015360
GO:0071422
AF-A0A7U4FRT1-F1-model_v4 deleted 0.9472 16 209
AF-A0A523ARE2-F1-model_v4 Acetate uptake transporter 0.9468 20 198 GO:0005886
GO:0015360
GO:0071422

Map