F468712
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 607 | 268 | 1214 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0006817|Ga0395899_0006817_3614_4333 |
| Length | 239 |
| Sequence | LAAGEPATKEVVMAVFAEERPRPTLVELAPVADPAPLGLAAFALTTFMLSGHNATFIPDVLWVGLALFYGGVAQLLAGMWEFRNRNVFGATAFSTYGGFWLALGVSIVLIETTSLGSALKGPDIDNGLAWFLLAFAIFNTYMLFGSLRVNMAVFGVFLTLEITEILLAIGFFRLAHDGTPWILHAGGWAGIATAVVAWYASAAGVINGMSTDPVLPVGRPLWNRLPIISHLGTPMPRGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 85 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 135 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 136 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 137 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 151 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 152 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 154 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 155 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 156 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 161 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 162 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 163 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 164 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 165 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 205 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 206 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 207 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.02 |
| Metatranscriptomes | 29.98 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.1 |
| Rhizosphere | 93.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0006817 | 3300037312 | Bacteria | 8845 |
| 2 | Ga0006778J45830_1046933 | 3300003162 | Bacteria | 1219 |
| 3 | Ga0006777J48905_1034236 | 3300003308 | Bacteria | 1328 |
| 4 | Ga0006777J48905_1054924 | 3300003308 | Unclassified | 753 |
| 5 | Ga0007429J51699_1033401 | 3300003579 | Bacteria | 1307 |
| 6 | Ga0007429J51699_1035782 | 3300003579 | Bacteria | 1321 |
| 7 | Ga0007429J51699_1037001 | 3300003579 | Bacteria | 1081 |
| 8 | Ga0058863_10162758 | 3300004799 | Unclassified | 935 |
| 9 | Ga0058861_10061845 | 3300004800 | Bacteria | 1364 |
| 10 | Ga0058861_10094513 | 3300004800 | Bacteria | 1390 |
| 11 | Ga0058862_10258641 | 3300004803 | Unclassified | 936 |
| 12 | Ga0058862_12291324 | 3300004803 | Bacteria | 832 |
| 13 | Ga0070658_10017971 | 3300005327 | Bacteria | 5656 |
| 14 | Ga0070658_10467579 | 3300005327 | Bacteria | 1088 |
| 15 | Ga0070658_10576907 | 3300005327 | Bacteria | 974 |
| 16 | Ga0070683_100013353 | 3300005329 | Bacteria | 7159 |
| 17 | Ga0070683_100021503 | 3300005329 | Bacteria | 5759 |
| 18 | Ga0070683_100025113 | 3300005329 | Bacteria | 5347 |
| 19 | Ga0070683_100054839 | 3300005329 | Bacteria | 3697 |
| 20 | Ga0070683_100124246 | 3300005329 | Bacteria | 2439 |
| 21 | Ga0070683_100207107 | 3300005329 | Archaea | 1863 |
| 22 | Ga0070680_100119998 | 3300005336 | Bacteria | 2194 |
| 23 | Ga0070682_100014551 | 3300005337 | Bacteria | 4549 |
| 24 | Ga0070682_100042489 | 3300005337 | Bacteria | 2806 |
| 25 | Ga0070682_100072012 | 3300005337 | Bacteria | 2214 |
| 26 | Ga0070682_100074011 | 3300005337 | Bacteria | 2187 |
| 27 | Ga0068868_100102574 | 3300005338 | Bacteria | 2317 |
| 28 | Ga0068868_100680054 | 3300005338 | Bacteria | 919 |
| 29 | Ga0070660_100024791 | 3300005339 | Bacteria | 4454 |
| 30 | Ga0070660_100089471 | 3300005339 | Bacteria | 2425 |
| 31 | Ga0070660_100842905 | 3300005339 | Bacteria | 772 |
| 32 | Ga0070691_10077027 | 3300005341 | Bacteria | 1627 |
| 33 | Ga0070661_100515709 | 3300005344 | Unclassified | 958 |
| 34 | Ga0070659_100004986 | 3300005366 | Bacteria | 9507 |
| 35 | Ga0070659_100650205 | 3300005366 | Bacteria | 909 |
| 36 | Ga0070709_10010616 | 3300005434 | Bacteria | 5106 |
| 37 | Ga0070709_10406572 | 3300005434 | Bacteria | 1017 |
| 38 | Ga0070714_100000004 | 3300005435 | Bacteria | 310983 |
| 39 | Ga0070714_100008041 | 3300005435 | Bacteria | 8219 |
| 40 | Ga0070714_100016585 | 3300005435 | Bacteria | 5953 |
| 41 | Ga0070714_100034006 | 3300005435 | Bacteria | 4267 |
| 42 | Ga0070714_100044409 | 3300005435 | Bacteria | 3762 |
| 43 | Ga0070714_100118359 | 3300005435 | Bacteria | 2354 |
| 44 | Ga0070714_100207153 | 3300005435 | Bacteria | 1796 |
| 45 | Ga0070714_100232348 | 3300005435 | Bacteria | 1699 |
| 46 | Ga0070714_100238314 | 3300005435 | Unclassified | 1678 |
| 47 | Ga0070713_100057847 | 3300005436 | Bacteria | 3230 |
| 48 | Ga0070713_100081529 | 3300005436 | Bacteria | 2761 |
| 49 | Ga0070710_10007711 | 3300005437 | Bacteria | 5219 |
| 50 | Ga0070711_100083617 | 3300005439 | Bacteria | 2281 |
| 51 | Ga0070711_100330320 | 3300005439 | Bacteria | 1220 |
| 52 | Ga0070705_100132116 | 3300005440 | Bacteria | 1630 |
| 53 | Ga0070700_100152516 | 3300005441 | Bacteria | 1582 |
| 54 | Ga0070708_100029860 | 3300005445 | Bacteria | 4706 |
| 55 | Ga0070708_100440173 | 3300005445 | Bacteria | 1229 |
| 56 | Ga0070708_100448277 | 3300005445 | Bacteria | 1217 |
| 57 | Ga0070708_100601714 | 3300005445 | Bacteria | 1036 |
| 58 | Ga0070663_100056557 | 3300005455 | Bacteria | 2811 |
| 59 | Ga0070662_100053410 | 3300005457 | Bacteria | 2925 |
| 60 | Ga0070681_10055588 | 3300005458 | Unclassified | 3940 |
| 61 | Ga0068867_100588656 | 3300005459 | Bacteria | 969 |
| 62 | Ga0070706_100000171 | 3300005467 | Bacteria | 82241 |
| 63 | Ga0070706_100004496 | 3300005467 | Bacteria | 13449 |
| 64 | Ga0070706_100050569 | 3300005467 | Bacteria | 3835 |
| 65 | Ga0070706_100271607 | 3300005467 | Bacteria | 1582 |
| 66 | Ga0070706_100434089 | 3300005467 | Bacteria | 1222 |
| 67 | Ga0070706_100470422 | 3300005467 | Bacteria | 1169 |
| 68 | Ga0070707_100001413 | 3300005468 | Bacteria | 23545 |
| 69 | Ga0070707_100103489 | 3300005468 | Bacteria | 2759 |
| 70 | Ga0070707_100248921 | 3300005468 | Bacteria | 1729 |
| 71 | Ga0070707_100479435 | 3300005468 | Bacteria | 1205 |
| 72 | Ga0070698_100013485 | 3300005471 | Bacteria | 8652 |
| 73 | Ga0070698_100078640 | 3300005471 | Bacteria | 3296 |
| 74 | Ga0070699_100000071 | 3300005518 | Bacteria | 96895 |
| 75 | Ga0070699_100000782 | 3300005518 | Bacteria | 29356 |
| 76 | Ga0070699_100001466 | 3300005518 | Bacteria | 21605 |
| 77 | Ga0070679_100163836 | 3300005530 | Bacteria | 2197 |
| 78 | Ga0070679_100607814 | 3300005530 | Bacteria | 1036 |
| 79 | Ga0070684_100081771 | 3300005535 | Bacteria | 2859 |
| 80 | Ga0070684_100100128 | 3300005535 | Bacteria | 2587 |
| 81 | Ga0070684_100128594 | 3300005535 | Bacteria | 2284 |
| 82 | Ga0070684_100306533 | 3300005535 | Bacteria | 1458 |
| 83 | Ga0070684_100692771 | 3300005535 | Unclassified | 950 |
| 84 | Ga0070697_100000064 | 3300005536 | Bacteria | 84569 |
| 85 | Ga0070697_100004794 | 3300005536 | Bacteria | 10359 |
| 86 | Ga0070697_100616170 | 3300005536 | Bacteria | 954 |
| 87 | Ga0068853_100375003 | 3300005539 | Unclassified | 1328 |
| 88 | Ga0070686_100135754 | 3300005544 | Bacteria | 1707 |
| 89 | Ga0070695_100198891 | 3300005545 | Unclassified | 1431 |
| 90 | Ga0070693_100008935 | 3300005547 | Bacteria | 4969 |
| 91 | Ga0070693_100080334 | 3300005547 | Bacteria | 1942 |
| 92 | Ga0068855_100106950 | 3300005563 | Bacteria | 3214 |
| 93 | Ga0068855_100109873 | 3300005563 | Bacteria | 3165 |
| 94 | Ga0070664_100444863 | 3300005564 | Bacteria | 1189 |
| 95 | Ga0068854_100027964 | 3300005578 | Bacteria | 3892 |
| 96 | Ga0068854_100231037 | 3300005578 | Bacteria | 1468 |
| 97 | Ga0068856_100017118 | 3300005614 | Bacteria | 7027 |
| 98 | Ga0068856_100017942 | 3300005614 | Bacteria | 6861 |
| 99 | Ga0068856_100048466 | 3300005614 | Bacteria | 4187 |
| 100 | Ga0068856_100059315 | 3300005614 | Bacteria | 3780 |
| 101 | Ga0068856_100114291 | 3300005614 | Bacteria | 2698 |
| 102 | Ga0068856_100121310 | 3300005614 | Bacteria | 2616 |
| 103 | Ga0070702_100161030 | 3300005615 | Bacteria | 1451 |
| 104 | Ga0070702_100251141 | 3300005615 | Bacteria | 1199 |
| 105 | Ga0068852_100215410 | 3300005616 | Bacteria | 1824 |
| 106 | Ga0068866_10304762 | 3300005718 | Bacteria | 996 |
| 107 | Ga0068861_100331827 | 3300005719 | Bacteria | 1328 |
| 108 | Ga0068870_10128262 | 3300005840 | Bacteria | 1470 |
| 109 | Ga0081455_10016539 | 3300005937 | Bacteria | 7117 |
| 110 | Ga0081455_10020921 | 3300005937 | Bacteria | 6148 |
| 111 | Ga0081455_10068090 | 3300005937 | Unclassified | 2965 |
| 112 | Ga0081539_10001238 | 3300005985 | Bacteria | 45456 |
| 113 | Ga0070717_10000009 | 3300006028 | Bacteria | 297183 |
| 114 | Ga0070717_10000234 | 3300006028 | Bacteria | 38382 |
| 115 | Ga0070717_10000584 | 3300006028 | Bacteria | 23267 |
| 116 | Ga0070717_10019874 | 3300006028 | Bacteria | 5274 |
| 117 | Ga0070717_10021141 | 3300006028 | Bacteria | 5127 |
| 118 | Ga0070717_10034549 | 3300006028 | Bacteria | 4088 |
| 119 | Ga0070717_10066125 | 3300006028 | Bacteria | 3006 |
| 120 | Ga0070717_10170326 | 3300006028 | Bacteria | 1893 |
| 121 | Ga0070717_10481447 | 3300006028 | Bacteria | 1121 |
| 122 | Ga0070717_10594292 | 3300006028 | Bacteria | 1004 |
| 123 | Ga0070715_10003708 | 3300006163 | Bacteria | 4908 |
| 124 | Ga0070716_100079995 | 3300006173 | Bacteria | 1947 |
| 125 | Ga0070716_100116921 | 3300006173 | Bacteria | 1663 |
| 126 | Ga0070716_100160889 | 3300006173 | Bacteria | 1455 |
| 127 | Ga0097621_100399327 | 3300006237 | Bacteria | 1230 |
| 128 | Ga0068871_100006687 | 3300006358 | Bacteria | 8181 |
| 129 | Ga0068871_100378766 | 3300006358 | Bacteria | 1257 |
| 130 | Ga0075428_100336479 | 3300006844 | Bacteria | 1621 |
| 131 | Ga0075431_100562742 | 3300006847 | Unclassified | 1127 |
| 132 | Ga0075433_10023169 | 3300006852 | Bacteria | 5222 |
| 133 | Ga0075434_100006283 | 3300006871 | Bacteria | 10885 |
| 134 | Ga0075434_100334360 | 3300006871 | Bacteria | 1535 |
| 135 | Ga0075434_100735860 | 3300006871 | Unclassified | 1003 |
| 136 | Ga0075429_100100089 | 3300006880 | Bacteria | 2530 |
| 137 | Ga0075436_100062988 | 3300006914 | Bacteria | 2563 |
| 138 | Ga0075436_100093250 | 3300006914 | Bacteria | 2093 |
| 139 | Ga0075435_100053835 | 3300007076 | Bacteria | 3247 |
| 140 | Ga0075435_100225690 | 3300007076 | Bacteria | 1591 |
| 141 | Ga0105240_10008131 | 3300009093 | Bacteria | 15049 |
| 142 | Ga0105240_10647585 | 3300009093 | Bacteria | 1158 |
| 143 | Ga0105240_10689739 | 3300009093 | Bacteria | 1116 |
| 144 | Ga0105240_10927869 | 3300009093 | Bacteria | 935 |
| 145 | Ga0105245_10039503 | 3300009098 | Bacteria | 4200 |
| 146 | Ga0105245_10049721 | 3300009098 | Bacteria | 3755 |
| 147 | Ga0105245_10128847 | 3300009098 | Bacteria | 2371 |
| 148 | Ga0105245_10442478 | 3300009098 | Bacteria | 1307 |
| 149 | Ga0114129_10259849 | 3300009147 | Bacteria | 2328 |
| 150 | Ga0105243_10239091 | 3300009148 | Bacteria | 1615 |
| 151 | Ga0105241_10057676 | 3300009174 | Bacteria | 2980 |
| 152 | Ga0105238_10048038 | 3300009551 | Bacteria | 4302 |
| 153 | Ga0105238_10937233 | 3300009551 | Bacteria | 885 |
| 154 | Ga0105239_10095076 | 3300010375 | Bacteria | 3292 |
| 155 | Ga0105239_10424501 | 3300010375 | Bacteria | 1506 |
| 156 | Ga0105239_10591577 | 3300010375 | Bacteria | 1265 |
| 157 | Ga0154016_140780 | 3300013045 | Bacteria | 1050 |
| 158 | Ga0154012_112501 | 3300013059 | Unclassified | 753 |
| 159 | Ga0154012_122835 | 3300013059 | Bacteria | 1150 |
| 160 | Ga0157373_10207814 | 3300013100 | Bacteria | 1380 |
| 161 | Ga0157371_10460881 | 3300013102 | Bacteria | 935 |
| 162 | Ga0157370_10392488 | 3300013104 | Bacteria | 1278 |
| 163 | Ga0157369_10039129 | 3300013105 | Bacteria | 5184 |
| 164 | Ga0157369_10053567 | 3300013105 | Bacteria | 4359 |
| 165 | Ga0157369_10192377 | 3300013105 | Bacteria | 2143 |
| 166 | Ga0157369_10219882 | 3300013105 | Bacteria | 1988 |
| 167 | Ga0157374_10220186 | 3300013296 | Bacteria | 1862 |
| 168 | Ga0157378_10336120 | 3300013297 | Bacteria | 1471 |
| 169 | Ga0157372_10570121 | 3300013307 | Bacteria | 1319 |
| 170 | Ga0157376_10041715 | 3300014969 | Bacteria | 3759 |
| 171 | Ga0182005_1069699 | 3300015265 | Bacteria | 965 |
| 172 | Ga0197907_10199073 | 3300020069 | Unclassified | 1169 |
| 173 | Ga0197907_10288058 | 3300020069 | Bacteria | 1128 |
| 174 | Ga0197907_10353616 | 3300020069 | Unclassified | 871 |
| 175 | Ga0197907_10411427 | 3300020069 | Bacteria | 2138 |
| 176 | Ga0197907_10956749 | 3300020069 | Bacteria | 2467 |
| 177 | Ga0197907_11511263 | 3300020069 | Bacteria | 2116 |
| 178 | Ga0206356_10031978 | 3300020070 | Bacteria | 2772 |
| 179 | Ga0206356_10979336 | 3300020070 | Bacteria | 938 |
| 180 | Ga0206356_11808036 | 3300020070 | Bacteria | 1604 |
| 181 | Ga0206349_1157557 | 3300020075 | Bacteria | 2843 |
| 182 | Ga0206349_1454904 | 3300020075 | Bacteria | 1141 |
| 183 | Ga0206349_1458029 | 3300020075 | Bacteria | 2424 |
| 184 | Ga0206349_1541529 | 3300020075 | Bacteria | 787 |
| 185 | Ga0206355_1181590 | 3300020076 | Bacteria | 760 |
| 186 | Ga0206355_1440801 | 3300020076 | Unclassified | 828 |
| 187 | Ga0206355_1588096 | 3300020076 | Bacteria | 1209 |
| 188 | Ga0206351_10401032 | 3300020077 | Bacteria | 1437 |
| 189 | Ga0206351_10437600 | 3300020077 | Bacteria | 920 |
| 190 | Ga0206352_10390842 | 3300020078 | Bacteria | 1177 |
| 191 | Ga0206352_10398134 | 3300020078 | Bacteria | 2737 |
| 192 | Ga0206350_10062944 | 3300020080 | Bacteria | 821 |
| 193 | Ga0206350_10094212 | 3300020080 | Bacteria | 849 |
| 194 | Ga0206350_10250503 | 3300020080 | Bacteria | 757 |
| 195 | Ga0206350_10458458 | 3300020080 | Bacteria | 1134 |
| 196 | Ga0206350_10582101 | 3300020080 | Bacteria | 3112 |
| 197 | Ga0206354_10786195 | 3300020081 | Bacteria | 2127 |
| 198 | Ga0206353_10056259 | 3300020082 | Bacteria | 4127 |
| 199 | Ga0206353_10080838 | 3300020082 | Bacteria | 1358 |
| 200 | Ga0206353_10691849 | 3300020082 | Bacteria | 1438 |
| 201 | Ga0206353_10723633 | 3300020082 | Bacteria | 959 |
| 202 | Ga0154015_1033170 | 3300020610 | Bacteria | 1409 |
| 203 | Ga0154015_1083977 | 3300020610 | Bacteria | 1399 |
| 204 | Ga0154015_1610023 | 3300020610 | Bacteria | 1422 |
| 205 | Ga0224712_10007955 | 3300022467 | Bacteria | 3111 |
| 206 | Ga0224712_10008611 | 3300022467 | Bacteria | 3033 |
| 207 | Ga0224712_10027064 | 3300022467 | Bacteria | 2036 |
| 208 | Ga0224712_10027191 | 3300022467 | Bacteria | 2032 |
| 209 | Ga0224712_10032242 | 3300022467 | Bacteria | 1908 |
| 210 | Ga0224712_10035631 | 3300022467 | Bacteria | 1838 |
| 211 | Ga0207692_10008882 | 3300025898 | Bacteria | 4176 |
| 212 | Ga0207692_10022511 | 3300025898 | Bacteria | 2900 |
| 213 | Ga0207688_10260750 | 3300025901 | Bacteria | 1052 |
| 214 | Ga0207680_10244059 | 3300025903 | Bacteria | 1239 |
| 215 | Ga0207685_10003839 | 3300025905 | Bacteria | 3720 |
| 216 | Ga0207699_10023261 | 3300025906 | Bacteria | 3370 |
| 217 | Ga0207699_10037660 | 3300025906 | Bacteria | 2766 |
| 218 | Ga0207705_10010732 | 3300025909 | Bacteria | 6650 |
| 219 | Ga0207684_10000003 | 3300025910 | Bacteria | 766933 |
| 220 | Ga0207684_10000012 | 3300025910 | Bacteria | 478666 |
| 221 | Ga0207684_10000485 | 3300025910 | Bacteria | 51125 |
| 222 | Ga0207684_10087834 | 3300025910 | Bacteria | 2649 |
| 223 | Ga0207684_10235317 | 3300025910 | Bacteria | 1580 |
| 224 | Ga0207654_10081824 | 3300025911 | Bacteria | 1946 |
| 225 | Ga0207707_10100311 | 3300025912 | Bacteria | 2530 |
| 226 | Ga0207695_10032725 | 3300025913 | Bacteria | 5686 |
| 227 | Ga0207693_10006545 | 3300025915 | Bacteria | 9643 |
| 228 | Ga0207663_10024769 | 3300025916 | Bacteria | 3460 |
| 229 | Ga0207663_10422041 | 3300025916 | Bacteria | 1024 |
| 230 | Ga0207660_10381309 | 3300025917 | Unclassified | 1133 |
| 231 | Ga0207657_10008296 | 3300025919 | Bacteria | 10568 |
| 232 | Ga0207657_10051327 | 3300025919 | Bacteria | 3585 |
| 233 | Ga0207649_10028768 | 3300025920 | Bacteria | 3275 |
| 234 | Ga0207649_10057187 | 3300025920 | Bacteria | 2438 |
| 235 | Ga0207652_10172995 | 3300025921 | Bacteria | 1938 |
| 236 | Ga0207646_10000779 | 3300025922 | Bacteria | 41345 |
| 237 | Ga0207646_10001583 | 3300025922 | Bacteria | 27794 |
| 238 | Ga0207646_10003154 | 3300025922 | Bacteria | 18881 |
| 239 | Ga0207646_10010089 | 3300025922 | Bacteria | 9260 |
| 240 | Ga0207646_10309501 | 3300025922 | Bacteria | 1427 |
| 241 | Ga0207646_10429443 | 3300025922 | Bacteria | 1192 |
| 242 | Ga0207694_10282743 | 3300025924 | Bacteria | 1363 |
| 243 | Ga0207659_11061631 | 3300025926 | Bacteria | 697 |
| 244 | Ga0207687_10024956 | 3300025927 | Bacteria | 3998 |
| 245 | Ga0207687_10071237 | 3300025927 | Bacteria | 2483 |
| 246 | Ga0207687_10136943 | 3300025927 | Archaea | 1853 |
| 247 | Ga0207687_10713576 | 3300025927 | Bacteria | 852 |
| 248 | Ga0207700_10000021 | 3300025928 | Bacteria | 168335 |
| 249 | Ga0207700_10055175 | 3300025928 | Bacteria | 2986 |
| 250 | Ga0207700_10087738 | 3300025928 | Bacteria | 2447 |
| 251 | Ga0207700_10338776 | 3300025928 | Bacteria | 1307 |
| 252 | Ga0207664_10000018 | 3300025929 | Bacteria | 222788 |
| 253 | Ga0207664_10012279 | 3300025929 | Bacteria | 6122 |
| 254 | Ga0207664_10031861 | 3300025929 | Bacteria | 4037 |
| 255 | Ga0207664_10040478 | 3300025929 | Bacteria | 3624 |
| 256 | Ga0207664_10044215 | 3300025929 | Bacteria | 3487 |
| 257 | Ga0207664_10051387 | 3300025929 | Bacteria | 3254 |
| 258 | Ga0207664_10066059 | 3300025929 | Bacteria | 2898 |
| 259 | Ga0207664_10284610 | 3300025929 | Unclassified | 1451 |
| 260 | Ga0207664_10291240 | 3300025929 | Bacteria | 1435 |
| 261 | Ga0207690_10887786 | 3300025932 | Bacteria | 739 |
| 262 | Ga0207706_10068259 | 3300025933 | Bacteria | 3129 |
| 263 | Ga0207669_10547678 | 3300025937 | Bacteria | 933 |
| 264 | Ga0207665_10002447 | 3300025939 | Bacteria | 12534 |
| 265 | Ga0207665_10015388 | 3300025939 | Bacteria | 5023 |
| 266 | Ga0207665_10244008 | 3300025939 | Bacteria | 1325 |
| 267 | Ga0207665_10827800 | 3300025939 | Bacteria | 732 |
| 268 | Ga0207661_10086197 | 3300025944 | Bacteria | 2606 |
| 269 | Ga0207661_10222825 | 3300025944 | Archaea | 1667 |
| 270 | Ga0207661_10300352 | 3300025944 | Bacteria | 1439 |
| 271 | Ga0207661_10577332 | 3300025944 | Bacteria | 1031 |
| 272 | Ga0207667_10051598 | 3300025949 | Bacteria | 4335 |
| 273 | Ga0207667_10052247 | 3300025949 | Bacteria | 4305 |
| 274 | Ga0207667_10214127 | 3300025949 | Bacteria | 1974 |
| 275 | Ga0207677_10075698 | 3300026023 | Bacteria | 2393 |
| 276 | Ga0207639_10309193 | 3300026041 | Bacteria | 1400 |
| 277 | Ga0207678_10046705 | 3300026067 | Bacteria | 3745 |
| 278 | Ga0207708_10312095 | 3300026075 | Bacteria | 1281 |
| 279 | Ga0207708_10541757 | 3300026075 | Bacteria | 980 |
| 280 | Ga0207702_10003936 | 3300026078 | Bacteria | 13350 |
| 281 | Ga0207702_10009634 | 3300026078 | Bacteria | 8109 |
| 282 | Ga0207702_10182059 | 3300026078 | Bacteria | 1936 |
| 283 | Ga0207702_10213897 | 3300026078 | Bacteria | 1793 |
| 284 | Ga0207702_10253977 | 3300026078 | Bacteria | 1652 |
| 285 | Ga0207702_10318094 | 3300026078 | Bacteria | 1481 |
| 286 | Ga0207702_10388526 | 3300026078 | Bacteria | 1343 |
| 287 | Ga0207648_10536467 | 3300026089 | Bacteria | 1073 |
| 288 | Ga0207648_10890226 | 3300026089 | Bacteria | 831 |
| 289 | Ga0207675_100309614 | 3300026118 | Bacteria | 1540 |
| 290 | Ga0207683_10001031 | 3300026121 | Bacteria | 25414 |
| 291 | Ga0207698_10178339 | 3300026142 | Bacteria | 1879 |
| 292 | Ga0265322_10020648 | 3300028654 | Bacteria | 1887 |
| 293 | Ga0265338_10010639 | 3300028800 | Bacteria | 10751 |
| 294 | Ga0265338_10307668 | 3300028800 | Bacteria | 1150 |
| 295 | Ga0307415_100149097 | 3300032126 | Bacteria | 1798 |
| 296 | Ga0373958_0043867 | 3300034819 | Bacteria | 924 |
| 297 | Ga0373928_0106423 | 3300035084 | Bacteria | 737 |
| 298 | Ga0373949_0037597 | 3300035090 | Bacteria | 1178 |
| 299 | Ga0373952_0043224 | 3300035092 | Bacteria | 1049 |
| 300 | Ga0373936_0083502 | 3300035113 | Bacteria | 1332 |
| 301 | Ga0373945_0029460 | 3300035116 | Bacteria | 1929 |
| 302 | Ga0373960_0065789 | 3300035121 | Bacteria | 1109 |
| 303 | Ga0373943_0003105 | 3300035170 | Bacteria | 7543 |
| 304 | Ga0373946_0022399 | 3300035171 | Bacteria | 2459 |
| 305 | Ga0373942_0108689 | 3300035207 | Bacteria | 855 |
| 306 | Ga0373931_0028284 | 3300035691 | Bacteria | 2868 |
| 307 | Ga0373947_0004365 | 3300035725 | Bacteria | 8294 |
| 308 | Ga0373947_0137048 | 3300035725 | Bacteria | 1567 |
| 309 | Ga0373937_0267283 | 3300036401 | Bacteria | 1614 |
| 310 | Ga0373925_0060860 | 3300037068 | Bacteria | 2835 |
| 311 | Ga0395899_0028998 | 3300037312 | Bacteria | 4163 |
| 312 | Ga0395899_0187012 | 3300037312 | Unclassified | 1451 |
| 313 | Ga0395900_0004133 | 3300037418 | Bacteria | 15453 |
| 314 | Ga0395900_0006485 | 3300037418 | Bacteria | 12203 |
| 315 | Ga0395900_0060366 | 3300037418 | Unclassified | 3902 |
| 316 | Ga0395900_0132483 | 3300037418 | Bacteria | 2554 |
| 317 | Ga0395900_0324255 | 3300037418 | Unclassified | 1520 |
| 318 | Ga0395898_0002328 | 3300037466 | Bacteria | 22664 |
| 319 | Ga0395898_0032494 | 3300037466 | Bacteria | 5209 |
| 320 | Ga0395898_0246186 | 3300037466 | Bacteria | 1705 |
| 321 | Ga0395898_0610659 | 3300037466 | Unclassified | 1033 |
| 322 | Ga0395905_0002088 | 3300037471 | Bacteria | 22707 |
| 323 | Ga0395905_0002224 | 3300037471 | Bacteria | 21889 |
| 324 | Ga0395905_0124484 | 3300037471 | Bacteria | 2424 |
| 325 | Ga0395905_0246190 | 3300037471 | Unclassified | 1670 |
| 326 | Ga0395901_0004925 | 3300038443 | Bacteria | 13477 |
| 327 | Ga0395901_0017072 | 3300038443 | Bacteria | 7399 |
| 328 | Ga0395901_0050877 | 3300038443 | Bacteria | 4305 |
| 329 | Ga0395901_0134000 | 3300038443 | Bacteria | 2603 |
| 330 | Ga0395901_0380508 | 3300038443 | Bacteria | 1453 |
| 331 | Ga0436363_1489138 | 3300039450 | Bacteria | 4868 |
| 332 | Ga0436362_0657798 | 3300039453 | Bacteria | 1512 |
| 333 | Ga0451804_0656621 | 3300041463 | Bacteria | 1020 |
| 334 | Ga0451849_0020420 | 3300041505 | Unclassified | 940 |
| 335 | Ga0451853_0440107 | 3300041512 | Bacteria | 2624 |
| 336 | Ga0451853_3025537 | 3300041512 | Bacteria | 4298 |
| 337 | Ga0439448_0067685 | 3300042005 | Bacteria | 1186 |
| 338 | Ga0466972_0212606 | 3300044658 | Unclassified | 905 |
| 339 | Ga0466966_0017608 | 3300044684 | Bacteria | 4720 |
| 340 | Ga0466966_0042409 | 3300044684 | Bacteria | 2920 |
| 341 | Ga0466966_0144073 | 3300044684 | Bacteria | 1455 |
| 342 | Ga0466961_0029169 | 3300044693 | Bacteria | 3547 |
| 343 | Ga0466961_0242918 | 3300044693 | Bacteria | 1106 |
| 344 | Ga0466963_0013532 | 3300044694 | Bacteria | 5010 |
| 345 | Ga0466963_0048693 | 3300044694 | Bacteria | 2801 |
| 346 | Ga0466963_0089458 | 3300044694 | Bacteria | 2094 |
| 347 | Ga0466963_0118312 | 3300044694 | Bacteria | 1822 |
| 348 | Ga0466963_0234784 | 3300044694 | Bacteria | 1285 |
| 349 | Ga0466964_0001921 | 3300044706 | Bacteria | 7270 |
| 350 | Ga0466964_0006965 | 3300044706 | Bacteria | 4226 |
| 351 | Ga0466964_0012845 | 3300044706 | Bacteria | 3172 |
| 352 | Ga0466964_0017348 | 3300044706 | Bacteria | 2754 |
| 353 | Ga0466964_0060192 | 3300044706 | Bacteria | 1579 |
| 354 | Ga0466964_0063938 | 3300044706 | Bacteria | 1538 |
| 355 | Ga0466971_0001404 | 3300044719 | Bacteria | 10116 |
| 356 | Ga0466968_0038545 | 3300044735 | Bacteria | 2008 |
| 357 | Ga0466970_0086106 | 3300044765 | Bacteria | 1703 |
| 358 | Ga0466970_0107221 | 3300044765 | Bacteria | 1524 |
| 359 | Ga0466957_0026133 | 3300044842 | Bacteria | 3462 |
| 360 | Ga0466960_0074108 | 3300044901 | Bacteria | 1700 |
| 361 | Ga0466960_0083080 | 3300044901 | Bacteria | 1618 |
| 362 | Ga0466960_0139911 | 3300044901 | Bacteria | 1285 |
| 363 | Ga0466959_0008546 | 3300045049 | Bacteria | 7245 |
| 364 | Ga0466958_0010225 | 3300045836 | Bacteria | 5248 |
| 365 | Ga0466958_0032175 | 3300045836 | Bacteria | 3119 |
| 366 | Ga0466958_0127277 | 3300045836 | Bacteria | 1597 |
| 367 | Ga0466958_0259839 | 3300045836 | Bacteria | 1111 |
| 368 | Ga0466967_0002953 | 3300045976 | Bacteria | 10866 |
| 369 | Ga0466967_0023142 | 3300045976 | Bacteria | 5087 |
| 370 | Ga0466967_0023418 | 3300045976 | Bacteria | 5059 |
| 371 | Ga0466967_0026193 | 3300045976 | Bacteria | 4825 |
| 372 | Ga0466967_0040748 | 3300045976 | Bacteria | 4000 |
| 373 | Ga0466967_0079370 | 3300045976 | Bacteria | 2958 |
| 374 | Ga0466967_0096369 | 3300045976 | Bacteria | 2698 |
| 375 | Ga0466967_0202919 | 3300045976 | Bacteria | 1878 |
| 376 | Ga0466967_0282033 | 3300045976 | Bacteria | 1594 |
| 377 | Ga0466967_0343650 | 3300045976 | Bacteria | 1443 |
| 378 | Ga0466967_0621466 | 3300045976 | Bacteria | 1067 |
| 379 | Ga0495592_0002297 | 3300046454 | Bacteria | 13484 |
| 380 | Ga0495592_0141858 | 3300046454 | Bacteria | 1670 |
| 381 | Ga0495603_0001374 | 3300046455 | Bacteria | 14134 |
| 382 | Ga0495641_0001029 | 3300046461 | Bacteria | 23958 |
| 383 | Ga0495651_0063055 | 3300046462 | Bacteria | 2834 |
| 384 | Ga0495651_0067201 | 3300046462 | Bacteria | 2735 |
| 385 | Ga0495653_0085487 | 3300046463 | Bacteria | 2320 |
| 386 | Ga0495653_0458011 | 3300046463 | Unclassified | 801 |
| 387 | Ga0495580_0058991 | 3300046472 | Bacteria | 2697 |
| 388 | Ga0495582_0062823 | 3300046473 | Bacteria | 2051 |
| 389 | Ga0495582_0063070 | 3300046473 | Bacteria | 2047 |
| 390 | Ga0495582_0120801 | 3300046473 | Unclassified | 1476 |
| 391 | Ga0495639_0046160 | 3300046475 | Bacteria | 1972 |
| 392 | Ga0495639_0081940 | 3300046475 | Bacteria | 1504 |
| 393 | Ga0495594_0010001 | 3300046499 | Bacteria | 4914 |
| 394 | Ga0495608_0109497 | 3300046511 | Bacteria | 1776 |
| 395 | Ga0495618_0066905 | 3300046514 | Bacteria | 2284 |
| 396 | Ga0495628_0025903 | 3300046516 | Bacteria | 4789 |
| 397 | Ga0495630_0002755 | 3300046517 | Bacteria | 12186 |
| 398 | Ga0495666_0006362 | 3300046526 | Bacteria | 5946 |
| 399 | Ga0495652_0060674 | 3300046529 | Bacteria | 3195 |
| 400 | Ga0495652_0125760 | 3300046529 | Bacteria | 2037 |
| 401 | Ga0495587_0032660 | 3300046536 | Bacteria | 3145 |
| 402 | Ga0495645_0033507 | 3300046543 | Bacteria | 3747 |
| 403 | Ga0495667_0150623 | 3300046559 | Bacteria | 1498 |
| 404 | Ga0495667_0245668 | 3300046559 | Unclassified | 1139 |
| 405 | Ga0495635_0134043 | 3300046663 | Bacteria | 1688 |
| 406 | Ga0495588_0001380 | 3300046674 | Bacteria | 10369 |
| 407 | Ga0495599_0013577 | 3300046678 | Bacteria | 5033 |
| 408 | Ga0495646_0052426 | 3300046680 | Bacteria | 2464 |
| 409 | Ga0495674_0428072 | 3300047319 | Bacteria | 1066 |
| 410 | Ga0495676_0021605 | 3300047321 | Bacteria | 5616 |
| 411 | Ga0495676_0033643 | 3300047321 | Bacteria | 4313 |
| 412 | Ga0495676_0302963 | 3300047321 | Unclassified | 1077 |
| 413 | Ga0495675_0033522 | 3300047444 | Bacteria | 3278 |
| 414 | Ga0495602_0060717 | 3300048088 | Bacteria | 3292 |
| 415 | Ga0495602_0362884 | 3300048088 | Bacteria | 1042 |
| 416 | Ga0496100_0100341 | 3300048903 | Bacteria | 1994 |
| 417 | Ga0496101_0037427 | 3300048904 | Bacteria | 3441 |
| 418 | Ga0496101_0043081 | 3300048904 | Bacteria | 3224 |
| 419 | Ga0496101_0119683 | 3300048904 | Bacteria | 1990 |
| 420 | Ga0496102_0033720 | 3300048905 | Bacteria | 4603 |
| 421 | Ga0496102_0160067 | 3300048905 | Bacteria | 2117 |
| 422 | Ga0496103_0023143 | 3300048906 | Bacteria | 3745 |
| 423 | Ga0496103_0125428 | 3300048906 | Bacteria | 1637 |
| 424 | Ga0496104_0012149 | 3300048907 | Bacteria | 7734 |
| 425 | Ga0496104_0012510 | 3300048907 | Bacteria | 7630 |
| 426 | Ga0496104_0515054 | 3300048907 | Bacteria | 1107 |
| 427 | Ga0496105_0017035 | 3300048908 | Bacteria | 5816 |
| 428 | Ga0496105_0057721 | 3300048908 | Bacteria | 3204 |
| 429 | Ga0496105_0192672 | 3300048908 | Bacteria | 1666 |
| 430 | Ga0496108_0147565 | 3300048911 | Bacteria | 2028 |
| 431 | Ga0496108_0233677 | 3300048911 | Bacteria | 1599 |
| 432 | Ga0496109_0040723 | 3300048912 | Bacteria | 4208 |
| 433 | Ga0496109_0121328 | 3300048912 | Bacteria | 2435 |
| 434 | Ga0496109_0179473 | 3300048912 | Bacteria | 1988 |
| 435 | Ga0496110_0045368 | 3300048913 | Bacteria | 3842 |
| 436 | Ga0496110_0296935 | 3300048913 | Bacteria | 1472 |
| 437 | Ga0496111_0022989 | 3300048914 | Bacteria | 4372 |
| 438 | Ga0496111_0143037 | 3300048914 | Bacteria | 1773 |
| 439 | Ga0496111_0150434 | 3300048914 | Bacteria | 1726 |
| 440 | Ga0496111_0331435 | 3300048914 | Bacteria | 1127 |
| 441 | Ga0496112_0057801 | 3300048915 | Bacteria | 3820 |
| 442 | Ga0496112_0100595 | 3300048915 | Bacteria | 2860 |
| 443 | Ga0496112_0275798 | 3300048915 | Bacteria | 1629 |
| 444 | Ga0496113_0074599 | 3300048916 | Bacteria | 2586 |
| 445 | Ga0496113_0088291 | 3300048916 | Bacteria | 2385 |
| 446 | Ga0496113_0717135 | 3300048916 | Bacteria | 797 |
| 447 | Ga0496114_0003589 | 3300048917 | Bacteria | 11921 |
| 448 | Ga0496114_0012957 | 3300048917 | Bacteria | 6680 |
| 449 | Ga0496115_0059987 | 3300048918 | Bacteria | 3064 |
| 450 | Ga0496115_0262940 | 3300048918 | Bacteria | 1419 |
| 451 | Ga0496115_0627860 | 3300048918 | Bacteria | 851 |
| 452 | Ga0501047_0044250 | 3300049581 | Bacteria | 4301 |
| 453 | Ga0501047_0180715 | 3300049581 | Bacteria | 1976 |
| 454 | Ga0501067_0003757 | 3300049583 | Bacteria | 8366 |
| 455 | Ga0501069_0057664 | 3300049585 | Bacteria | 2165 |
| 456 | Ga0501070_0023174 | 3300049586 | Bacteria | 5201 |
| 457 | Ga0501035_0307703 | 3300049822 | Bacteria | 1334 |
| 458 | Ga0501044_0222524 | 3300049823 | Bacteria | 1838 |
| 459 | nmdc:mga05p37_222731_c1 | 3300050507 | Bacteria | 2276 |
| 460 | nmdc:mga0n895_180276_c1 | 3300050512 | Bacteria | 2144 |
| 461 | nmdc:mga0n895_367662_c1 | 3300050512 | Bacteria | 1456 |
| 462 | nmdc:mga0n895_579136_c1 | 3300050512 | Bacteria | 1126 |
| 463 | nmdc:mga0n895_89520_c1 | 3300050512 | Bacteria | 3079 |
| 464 | nmdc:mga0rr50_113657_c1 | 3300050513 | Bacteria | 2146 |
| 465 | nmdc:mga0rr50_98071_c1 | 3300050513 | Bacteria | 2296 |
| 466 | nmdc:mga08x19_16014_c1 | 3300050514 | Bacteria | 4568 |
| 467 | nmdc:mga08x19_61370_c1 | 3300050514 | Bacteria | 2436 |
| 468 | Ga0495601_0043963 | 3300053077 | Bacteria | 2807 |
| 469 | Ga0495601_0079885 | 3300053077 | Bacteria | 2097 |
| 470 | Ga0495601_0403268 | 3300053077 | Unclassified | 886 |
| 471 | Ga0495612_0037476 | 3300053078 | Bacteria | 1969 |
| 472 | Ga0495595_0022685 | 3300053084 | Bacteria | 2757 |
| 473 | Ga0495595_0054577 | 3300053084 | Bacteria | 1858 |
| 474 | Ga0495595_0174930 | 3300053084 | Bacteria | 1063 |
| 475 | Ga0587084_007130 | 3300059477 | Bacteria | 1379 |
| 476 | Ga0587093_024421 | 3300059478 | Unclassified | 832 |
| 477 | Ga0587066_016909 | 3300059490 | Bacteria | 1155 |
| 478 | Ga0587066_020250 | 3300059490 | Unclassified | 1091 |
| 479 | Ga0587066_025380 | 3300059490 | Bacteria | 1016 |
| 480 | Ga0587066_049865 | 3300059490 | Unclassified | 820 |
| 481 | Ga0587070_023862 | 3300059491 | Bacteria | 1054 |
| 482 | Ga0587070_026890 | 3300059491 | Bacteria | 1015 |
| 483 | Ga0587070_034292 | 3300059491 | Unclassified | 938 |
| 484 | Ga0587070_047803 | 3300059491 | Unclassified | 843 |
| 485 | Ga0587073_0005728 | 3300059492 | Bacteria | 1869 |
| 486 | Ga0587073_0011475 | 3300059492 | Bacteria | 1513 |
| 487 | Ga0587073_0015227 | 3300059492 | Bacteria | 1383 |
| 488 | Ga0587073_0022631 | 3300059492 | Bacteria | 1222 |
| 489 | Ga0587073_0025007 | 3300059492 | Bacteria | 1184 |
| 490 | Ga0587073_0030655 | 3300059492 | Bacteria | 1108 |
| 491 | Ga0587073_0045831 | 3300059492 | Bacteria | 972 |
| 492 | Ga0587073_0079124 | 3300059492 | Bacteria | 812 |
| 493 | Ga0587073_0103526 | 3300059492 | Bacteria | 743 |
| 494 | Ga0587077_007338 | 3300059493 | Bacteria | 1601 |
| 495 | Ga0587080_001371 | 3300059503 | Bacteria | 2617 |
| 496 | Ga0587080_004796 | 3300059503 | Bacteria | 1781 |
| 497 | Ga0587080_020936 | 3300059503 | Unclassified | 1072 |
| 498 | Ga0587080_039551 | 3300059503 | Bacteria | 854 |
| 499 | Ga0587082_001746 | 3300059504 | Bacteria | 2324 |
| 500 | Ga0587082_013030 | 3300059504 | Bacteria | 1246 |
| 501 | Ga0587082_022875 | 3300059504 | Unclassified | 1032 |
| 502 | Ga0587082_034728 | 3300059504 | Bacteria | 897 |
| 503 | Ga0587082_046650 | 3300059504 | Bacteria | 813 |
| 504 | Ga0587083_0003155 | 3300059505 | Bacteria | 2152 |
| 505 | Ga0587083_0004990 | 3300059505 | Bacteria | 1888 |
| 506 | Ga0587083_0016287 | 3300059505 | Bacteria | 1313 |
| 507 | Ga0587083_0019765 | 3300059505 | Bacteria | 1233 |
| 508 | Ga0587083_0033981 | 3300059505 | Unclassified | 1032 |
| 509 | Ga0587083_0082325 | 3300059505 | Bacteria | 769 |
| 510 | Ga0587085_024971 | 3300059506 | Bacteria | 941 |
| 511 | Ga0587086_004538 | 3300059507 | Bacteria | 1459 |
| 512 | Ga0587086_023087 | 3300059507 | Bacteria | 865 |
| 513 | Ga0587088_005801 | 3300059508 | Bacteria | 1640 |
| 514 | Ga0587088_027099 | 3300059508 | Bacteria | 999 |
| 515 | Ga0587088_027976 | 3300059508 | Bacteria | 989 |
| 516 | Ga0587088_028753 | 3300059508 | Bacteria | 980 |
| 517 | Ga0587089_004085 | 3300059509 | Bacteria | 1596 |
| 518 | Ga0587089_021482 | 3300059509 | Bacteria | 896 |
| 519 | Ga0587089_035952 | 3300059509 | Bacteria | 749 |
| 520 | Ga0587090_007336 | 3300059510 | Bacteria | 1445 |
| 521 | Ga0587090_018402 | 3300059510 | Bacteria | 1067 |
| 522 | Ga0587090_019651 | 3300059510 | Bacteria | 1044 |
| 523 | Ga0587090_036698 | 3300059510 | Bacteria | 845 |
| 524 | Ga0587090_037863 | 3300059510 | Unclassified | 836 |
| 525 | Ga0587091_010343 | 3300059511 | Bacteria | 1426 |
| 526 | Ga0587091_021919 | 3300059511 | Bacteria | 1124 |
| 527 | Ga0587091_031929 | 3300059511 | Unclassified | 993 |
| 528 | Ga0587091_037176 | 3300059511 | Unclassified | 944 |
| 529 | Ga0587092_020687 | 3300059512 | Bacteria | 1015 |
| 530 | Ga0587094_014717 | 3300059513 | Bacteria | 1073 |
| 531 | Ga0587095_001180 | 3300059514 | Bacteria | 1555 |
| 532 | Ga0587098_005611 | 3300059604 | Bacteria | 1239 |
| 533 | Ga0587106_000914 | 3300059605 | Bacteria | 2389 |
| 534 | Ga0587106_012082 | 3300059605 | Bacteria | 1152 |
| 535 | Ga0587106_016955 | 3300059605 | Bacteria | 1036 |
| 536 | Ga0587106_019733 | 3300059605 | Bacteria | 987 |
| 537 | Ga0587106_037563 | 3300059605 | Bacteria | 808 |
| 538 | Ga0587125_007673 | 3300059607 | Bacteria | 1052 |
| 539 | Ga0587125_022763 | 3300059607 | Unclassified | 751 |
| 540 | Ga0587129_000372 | 3300059608 | Bacteria | 1945 |
| 541 | Ga0587129_008139 | 3300059608 | Unclassified | 772 |
| 542 | Ga0587099_004479 | 3300059622 | Bacteria | 1214 |
| 543 | Ga0587099_008800 | 3300059622 | Bacteria | 981 |
| 544 | Ga0587099_010201 | 3300059622 | Bacteria | 934 |
| 545 | Ga0587099_012061 | 3300059622 | Unclassified | 884 |
| 546 | Ga0587099_019333 | 3300059622 | Bacteria | 758 |
| 547 | Ga0587101_013962 | 3300059623 | Bacteria | 1066 |
| 548 | Ga0587113_000759 | 3300059625 | Bacteria | 1874 |
| 549 | Ga0587113_003209 | 3300059625 | Bacteria | 1234 |
| 550 | Ga0587113_006877 | 3300059625 | Unclassified | 977 |
| 551 | Ga0587113_008197 | 3300059625 | Bacteria | 924 |
| 552 | Ga0587113_009036 | 3300059625 | Bacteria | 896 |
| 553 | Ga0587115_003014 | 3300059626 | Bacteria | 1736 |
| 554 | Ga0587115_009968 | 3300059626 | Bacteria | 1175 |
| 555 | Ga0587115_012902 | 3300059626 | Bacteria | 1075 |
| 556 | Ga0587115_015699 | 3300059626 | Bacteria | 1005 |
| 557 | Ga0587115_021213 | 3300059626 | Bacteria | 907 |
| 558 | Ga0587117_035707 | 3300059627 | Bacteria | 771 |
| 559 | Ga0587128_016043 | 3300059630 | Bacteria | 1093 |
| 560 | Ga0587128_018077 | 3300059630 | Bacteria | 1052 |
| 561 | Ga0587128_026075 | 3300059630 | Bacteria | 935 |
| 562 | Ga0587130_004606 | 3300059631 | Bacteria | 1210 |
| 563 | Ga0587130_010392 | 3300059631 | Unclassified | 908 |
| 564 | Ga0587067_013886 | 3300059640 | Bacteria | 1283 |
| 565 | Ga0587067_027956 | 3300059640 | Bacteria | 1021 |
| 566 | Ga0587067_032582 | 3300059640 | Unclassified | 970 |
| 567 | Ga0587067_070598 | 3300059640 | Bacteria | 753 |
| 568 | Ga0587067_075760 | 3300059640 | Bacteria | 735 |
| 569 | Ga0587068_041702 | 3300059641 | Bacteria | 832 |
| 570 | Ga0587069_007583 | 3300059642 | Bacteria | 1345 |
| 571 | Ga0587072_008683 | 3300059643 | Bacteria | 1614 |
| 572 | Ga0587072_020498 | 3300059643 | Bacteria | 1166 |
| 573 | Ga0587075_002297 | 3300059644 | Bacteria | 2004 |
| 574 | Ga0587075_006085 | 3300059644 | Bacteria | 1468 |
| 575 | Ga0587075_006107 | 3300059644 | Bacteria | 1467 |
| 576 | Ga0587075_010309 | 3300059644 | Bacteria | 1234 |
| 577 | Ga0587075_019832 | 3300059644 | Bacteria | 988 |
| 578 | Ga0587075_022363 | 3300059644 | Bacteria | 949 |
| 579 | Ga0587076_014819 | 3300059645 | Bacteria | 1206 |
| 580 | Ga0587076_037902 | 3300059645 | Bacteria | 888 |
| 581 | Ga0587076_066934 | 3300059645 | Bacteria | 737 |
| 582 | Ga0587079_076573 | 3300059647 | Bacteria | 757 |
| 583 | Ga0587100_004938 | 3300059648 | Bacteria | 975 |
| 584 | Ga0587104_005253 | 3300059650 | Bacteria | 848 |
| 585 | Ga0587105_003346 | 3300059651 | Bacteria | 971 |
| 586 | Ga0587107_007428 | 3300059652 | Bacteria | 1235 |
| 587 | Ga0587107_013405 | 3300059652 | Bacteria | 1039 |
| 588 | Ga0587107_021051 | 3300059652 | Bacteria | 910 |
| 589 | Ga0587107_031584 | 3300059652 | Bacteria | 809 |
| 590 | Ga0587107_038955 | 3300059652 | Unclassified | 759 |
| 591 | Ga0587114_003064 | 3300059655 | Bacteria | 1624 |
| 592 | Ga0587114_007853 | 3300059655 | Bacteria | 1235 |
| 593 | Ga0587114_024768 | 3300059655 | Bacteria | 875 |
| 594 | Ga0587114_026750 | 3300059655 | Bacteria | 855 |
| 595 | Ga0587116_03386 | 3300059656 | Bacteria | 889 |
| 596 | Ga0587120_002168 | 3300059659 | Bacteria | 1311 |
| 597 | Ga0587120_005511 | 3300059659 | Bacteria | 974 |
| 598 | Ga0587120_006742 | 3300059659 | Bacteria | 909 |
| 599 | Ga0587120_010890 | 3300059659 | Unclassified | 775 |
| 600 | Ga0587071_008937 | 3300060344 | Bacteria | 1637 |
| 601 | Ga0587071_023948 | 3300060344 | Bacteria | 1136 |
| 602 | Ga0587071_030361 | 3300060344 | Bacteria | 1038 |
| 603 | Ga0587111_0014690 | 3300060346 | Bacteria | 1420 |
| 604 | Ga0501082_0674644 | 3300060353 | Bacteria | 905 |
| 605 | Ga0466962_0001120 | 3300061719 | Bacteria | 12353 |
| 606 | Ga0466962_0037866 | 3300061719 | Bacteria | 2310 |
| 607 | Ga0466962_0088056 | 3300061719 | Bacteria | 1487 |
| 608 | Ga0395899_0006817 | |||
| 609 | Ga0006778J45830_1046933 | |||
| 610 | Ga0006777J48905_1034236 | |||
| 611 | Ga0006777J48905_1054924 | |||
| 612 | Ga0007429J51699_1033401 | |||
| 613 | Ga0007429J51699_1035782 | |||
| 614 | Ga0007429J51699_1037001 | |||
| 615 | Ga0058863_10162758 | |||
| 616 | Ga0058861_10061845 | |||
| 617 | Ga0058861_10094513 | |||
| 618 | Ga0058862_10258641 | |||
| 619 | Ga0058862_12291324 | |||
| 620 | Ga0070658_10017971 | |||
| 621 | Ga0070658_10467579 | |||
| 622 | Ga0070658_10576907 | |||
| 623 | Ga0070683_100013353 | |||
| 624 | Ga0070683_100021503 | |||
| 625 | Ga0070683_100025113 | |||
| 626 | Ga0070683_100054839 | |||
| 627 | Ga0070683_100124246 | |||
| 628 | Ga0070683_100207107 | |||
| 629 | Ga0070680_100119998 | |||
| 630 | Ga0070682_100014551 | |||
| 631 | Ga0070682_100042489 | |||
| 632 | Ga0070682_100072012 | |||
| 633 | Ga0070682_100074011 | |||
| 634 | Ga0068868_100102574 | |||
| 635 | Ga0068868_100680054 | |||
| 636 | Ga0070660_100024791 | |||
| 637 | Ga0070660_100089471 | |||
| 638 | Ga0070660_100842905 | |||
| 639 | Ga0070691_10077027 | |||
| 640 | Ga0070661_100515709 | |||
| 641 | Ga0070659_100004986 | |||
| 642 | Ga0070659_100650205 | |||
| 643 | Ga0070709_10010616 | |||
| 644 | Ga0070709_10406572 | |||
| 645 | Ga0070714_100000004 | |||
| 646 | Ga0070714_100008041 | |||
| 647 | Ga0070714_100016585 | |||
| 648 | Ga0070714_100034006 | |||
| 649 | Ga0070714_100044409 | |||
| 650 | Ga0070714_100118359 | |||
| 651 | Ga0070714_100207153 | |||
| 652 | Ga0070714_100232348 | |||
| 653 | Ga0070714_100238314 | |||
| 654 | Ga0070713_100057847 | |||
| 655 | Ga0070713_100081529 | |||
| 656 | Ga0070710_10007711 | |||
| 657 | Ga0070711_100083617 | |||
| 658 | Ga0070711_100330320 | |||
| 659 | Ga0070705_100132116 | |||
| 660 | Ga0070700_100152516 | |||
| 661 | Ga0070708_100029860 | |||
| 662 | Ga0070708_100440173 | |||
| 663 | Ga0070708_100448277 | |||
| 664 | Ga0070708_100601714 | |||
| 665 | Ga0070663_100056557 | |||
| 666 | Ga0070662_100053410 | |||
| 667 | Ga0070681_10055588 | |||
| 668 | Ga0068867_100588656 | |||
| 669 | Ga0070706_100000171 | |||
| 670 | Ga0070706_100004496 | |||
| 671 | Ga0070706_100050569 | |||
| 672 | Ga0070706_100271607 | |||
| 673 | Ga0070706_100434089 | |||
| 674 | Ga0070706_100470422 | |||
| 675 | Ga0070707_100001413 | |||
| 676 | Ga0070707_100103489 | |||
| 677 | Ga0070707_100248921 | |||
| 678 | Ga0070707_100479435 | |||
| 679 | Ga0070698_100013485 | |||
| 680 | Ga0070698_100078640 | |||
| 681 | Ga0070699_100000071 | |||
| 682 | Ga0070699_100000782 | |||
| 683 | Ga0070699_100001466 | |||
| 684 | Ga0070679_100163836 | |||
| 685 | Ga0070679_100607814 | |||
| 686 | Ga0070684_100081771 | |||
| 687 | Ga0070684_100100128 | |||
| 688 | Ga0070684_100128594 | |||
| 689 | Ga0070684_100306533 | |||
| 690 | Ga0070684_100692771 | |||
| 691 | Ga0070697_100000064 | |||
| 692 | Ga0070697_100004794 | |||
| 693 | Ga0070697_100616170 | |||
| 694 | Ga0068853_100375003 | |||
| 695 | Ga0070686_100135754 | |||
| 696 | Ga0070695_100198891 | |||
| 697 | Ga0070693_100008935 | |||
| 698 | Ga0070693_100080334 | |||
| 699 | Ga0068855_100106950 | |||
| 700 | Ga0068855_100109873 | |||
| 701 | Ga0070664_100444863 | |||
| 702 | Ga0068854_100027964 | |||
| 703 | Ga0068854_100231037 | |||
| 704 | Ga0068856_100017118 | |||
| 705 | Ga0068856_100017942 | |||
| 706 | Ga0068856_100048466 | |||
| 707 | Ga0068856_100059315 | |||
| 708 | Ga0068856_100114291 | |||
| 709 | Ga0068856_100121310 | |||
| 710 | Ga0070702_100161030 | |||
| 711 | Ga0070702_100251141 | |||
| 712 | Ga0068852_100215410 | |||
| 713 | Ga0068866_10304762 | |||
| 714 | Ga0068861_100331827 | |||
| 715 | Ga0068870_10128262 | |||
| 716 | Ga0081455_10016539 | |||
| 717 | Ga0081455_10020921 | |||
| 718 | Ga0081455_10068090 | |||
| 719 | Ga0081539_10001238 | |||
| 720 | Ga0070717_10000009 | |||
| 721 | Ga0070717_10000234 | |||
| 722 | Ga0070717_10000584 | |||
| 723 | Ga0070717_10019874 | |||
| 724 | Ga0070717_10021141 | |||
| 725 | Ga0070717_10034549 | |||
| 726 | Ga0070717_10066125 | |||
| 727 | Ga0070717_10170326 | |||
| 728 | Ga0070717_10481447 | |||
| 729 | Ga0070717_10594292 | |||
| 730 | Ga0070715_10003708 | |||
| 731 | Ga0070716_100079995 | |||
| 732 | Ga0070716_100116921 | |||
| 733 | Ga0070716_100160889 | |||
| 734 | Ga0097621_100399327 | |||
| 735 | Ga0068871_100006687 | |||
| 736 | Ga0068871_100378766 | |||
| 737 | Ga0075428_100336479 | |||
| 738 | Ga0075431_100562742 | |||
| 739 | Ga0075433_10023169 | |||
| 740 | Ga0075434_100006283 | |||
| 741 | Ga0075434_100334360 | |||
| 742 | Ga0075434_100735860 | |||
| 743 | Ga0075429_100100089 | |||
| 744 | Ga0075436_100062988 | |||
| 745 | Ga0075436_100093250 | |||
| 746 | Ga0075435_100053835 | |||
| 747 | Ga0075435_100225690 | |||
| 748 | Ga0105240_10008131 | |||
| 749 | Ga0105240_10647585 | |||
| 750 | Ga0105240_10689739 | |||
| 751 | Ga0105240_10927869 | |||
| 752 | Ga0105245_10039503 | |||
| 753 | Ga0105245_10049721 | |||
| 754 | Ga0105245_10128847 | |||
| 755 | Ga0105245_10442478 | |||
| 756 | Ga0114129_10259849 | |||
| 757 | Ga0105243_10239091 | |||
| 758 | Ga0105241_10057676 | |||
| 759 | Ga0105238_10048038 | |||
| 760 | Ga0105238_10937233 | |||
| 761 | Ga0105239_10095076 | |||
| 762 | Ga0105239_10424501 | |||
| 763 | Ga0105239_10591577 | |||
| 764 | Ga0154016_140780 | |||
| 765 | Ga0154012_112501 | |||
| 766 | Ga0154012_122835 | |||
| 767 | Ga0157373_10207814 | |||
| 768 | Ga0157371_10460881 | |||
| 769 | Ga0157370_10392488 | |||
| 770 | Ga0157369_10039129 | |||
| 771 | Ga0157369_10053567 | |||
| 772 | Ga0157369_10192377 | |||
| 773 | Ga0157369_10219882 | |||
| 774 | Ga0157374_10220186 | |||
| 775 | Ga0157378_10336120 | |||
| 776 | Ga0157372_10570121 | |||
| 777 | Ga0157376_10041715 | |||
| 778 | Ga0182005_1069699 | |||
| 779 | Ga0197907_10199073 | |||
| 780 | Ga0197907_10288058 | |||
| 781 | Ga0197907_10353616 | |||
| 782 | Ga0197907_10411427 | |||
| 783 | Ga0197907_10956749 | |||
| 784 | Ga0197907_11511263 | |||
| 785 | Ga0206356_10031978 | |||
| 786 | Ga0206356_10979336 | |||
| 787 | Ga0206356_11808036 | |||
| 788 | Ga0206349_1157557 | |||
| 789 | Ga0206349_1454904 | |||
| 790 | Ga0206349_1458029 | |||
| 791 | Ga0206349_1541529 | |||
| 792 | Ga0206355_1181590 | |||
| 793 | Ga0206355_1440801 | |||
| 794 | Ga0206355_1588096 | |||
| 795 | Ga0206351_10401032 | |||
| 796 | Ga0206351_10437600 | |||
| 797 | Ga0206352_10390842 | |||
| 798 | Ga0206352_10398134 | |||
| 799 | Ga0206350_10062944 | |||
| 800 | Ga0206350_10094212 | |||
| 801 | Ga0206350_10250503 | |||
| 802 | Ga0206350_10458458 | |||
| 803 | Ga0206350_10582101 | |||
| 804 | Ga0206354_10786195 | |||
| 805 | Ga0206353_10056259 | |||
| 806 | Ga0206353_10080838 | |||
| 807 | Ga0206353_10691849 | |||
| 808 | Ga0206353_10723633 | |||
| 809 | Ga0154015_1033170 | |||
| 810 | Ga0154015_1083977 | |||
| 811 | Ga0154015_1610023 | |||
| 812 | Ga0224712_10007955 | |||
| 813 | Ga0224712_10008611 | |||
| 814 | Ga0224712_10027064 | |||
| 815 | Ga0224712_10027191 | |||
| 816 | Ga0224712_10032242 | |||
| 817 | Ga0224712_10035631 | |||
| 818 | Ga0207692_10008882 | |||
| 819 | Ga0207692_10022511 | |||
| 820 | Ga0207688_10260750 | |||
| 821 | Ga0207680_10244059 | |||
| 822 | Ga0207685_10003839 | |||
| 823 | Ga0207699_10023261 | |||
| 824 | Ga0207699_10037660 | |||
| 825 | Ga0207705_10010732 | |||
| 826 | Ga0207684_10000003 | |||
| 827 | Ga0207684_10000012 | |||
| 828 | Ga0207684_10000485 | |||
| 829 | Ga0207684_10087834 | |||
| 830 | Ga0207684_10235317 | |||
| 831 | Ga0207654_10081824 | |||
| 832 | Ga0207707_10100311 | |||
| 833 | Ga0207695_10032725 | |||
| 834 | Ga0207693_10006545 | |||
| 835 | Ga0207663_10024769 | |||
| 836 | Ga0207663_10422041 | |||
| 837 | Ga0207660_10381309 | |||
| 838 | Ga0207657_10008296 | |||
| 839 | Ga0207657_10051327 | |||
| 840 | Ga0207649_10028768 | |||
| 841 | Ga0207649_10057187 | |||
| 842 | Ga0207652_10172995 | |||
| 843 | Ga0207646_10000779 | |||
| 844 | Ga0207646_10001583 | |||
| 845 | Ga0207646_10003154 | |||
| 846 | Ga0207646_10010089 | |||
| 847 | Ga0207646_10309501 | |||
| 848 | Ga0207646_10429443 | |||
| 849 | Ga0207694_10282743 | |||
| 850 | Ga0207659_11061631 | |||
| 851 | Ga0207687_10024956 | |||
| 852 | Ga0207687_10071237 | |||
| 853 | Ga0207687_10136943 | |||
| 854 | Ga0207687_10713576 | |||
| 855 | Ga0207700_10000021 | |||
| 856 | Ga0207700_10055175 | |||
| 857 | Ga0207700_10087738 | |||
| 858 | Ga0207700_10338776 | |||
| 859 | Ga0207664_10000018 | |||
| 860 | Ga0207664_10012279 | |||
| 861 | Ga0207664_10031861 | |||
| 862 | Ga0207664_10040478 | |||
| 863 | Ga0207664_10044215 | |||
| 864 | Ga0207664_10051387 | |||
| 865 | Ga0207664_10066059 | |||
| 866 | Ga0207664_10284610 | |||
| 867 | Ga0207664_10291240 | |||
| 868 | Ga0207690_10887786 | |||
| 869 | Ga0207706_10068259 | |||
| 870 | Ga0207669_10547678 | |||
| 871 | Ga0207665_10002447 | |||
| 872 | Ga0207665_10015388 | |||
| 873 | Ga0207665_10244008 | |||
| 874 | Ga0207665_10827800 | |||
| 875 | Ga0207661_10086197 | |||
| 876 | Ga0207661_10222825 | |||
| 877 | Ga0207661_10300352 | |||
| 878 | Ga0207661_10577332 | |||
| 879 | Ga0207667_10051598 | |||
| 880 | Ga0207667_10052247 | |||
| 881 | Ga0207667_10214127 | |||
| 882 | Ga0207677_10075698 | |||
| 883 | Ga0207639_10309193 | |||
| 884 | Ga0207678_10046705 | |||
| 885 | Ga0207708_10312095 | |||
| 886 | Ga0207708_10541757 | |||
| 887 | Ga0207702_10003936 | |||
| 888 | Ga0207702_10009634 | |||
| 889 | Ga0207702_10182059 | |||
| 890 | Ga0207702_10213897 | |||
| 891 | Ga0207702_10253977 | |||
| 892 | Ga0207702_10318094 | |||
| 893 | Ga0207702_10388526 | |||
| 894 | Ga0207648_10536467 | |||
| 895 | Ga0207648_10890226 | |||
| 896 | Ga0207675_100309614 | |||
| 897 | Ga0207683_10001031 | |||
| 898 | Ga0207698_10178339 | |||
| 899 | Ga0265322_10020648 | |||
| 900 | Ga0265338_10010639 | |||
| 901 | Ga0265338_10307668 | |||
| 902 | Ga0307415_100149097 | |||
| 903 | Ga0373958_0043867 | |||
| 904 | Ga0373928_0106423 | |||
| 905 | Ga0373949_0037597 | |||
| 906 | Ga0373952_0043224 | |||
| 907 | Ga0373936_0083502 | |||
| 908 | Ga0373945_0029460 | |||
| 909 | Ga0373960_0065789 | |||
| 910 | Ga0373943_0003105 | |||
| 911 | Ga0373946_0022399 | |||
| 912 | Ga0373942_0108689 | |||
| 913 | Ga0373931_0028284 | |||
| 914 | Ga0373947_0004365 | |||
| 915 | Ga0373947_0137048 | |||
| 916 | Ga0373937_0267283 | |||
| 917 | Ga0373925_0060860 | |||
| 918 | Ga0395899_0028998 | |||
| 919 | Ga0395899_0187012 | |||
| 920 | Ga0395900_0004133 | |||
| 921 | Ga0395900_0006485 | |||
| 922 | Ga0395900_0060366 | |||
| 923 | Ga0395900_0132483 | |||
| 924 | Ga0395900_0324255 | |||
| 925 | Ga0395898_0002328 | |||
| 926 | Ga0395898_0032494 | |||
| 927 | Ga0395898_0246186 | |||
| 928 | Ga0395898_0610659 | |||
| 929 | Ga0395905_0002088 | |||
| 930 | Ga0395905_0002224 | |||
| 931 | Ga0395905_0124484 | |||
| 932 | Ga0395905_0246190 | |||
| 933 | Ga0395901_0004925 | |||
| 934 | Ga0395901_0017072 | |||
| 935 | Ga0395901_0050877 | |||
| 936 | Ga0395901_0134000 | |||
| 937 | Ga0395901_0380508 | |||
| 938 | Ga0436363_1489138 | |||
| 939 | Ga0436362_0657798 | |||
| 940 | Ga0451804_0656621 | |||
| 941 | Ga0451849_0020420 | |||
| 942 | Ga0451853_0440107 | |||
| 943 | Ga0451853_3025537 | |||
| 944 | Ga0439448_0067685 | |||
| 945 | Ga0466972_0212606 | |||
| 946 | Ga0466966_0017608 | |||
| 947 | Ga0466966_0042409 | |||
| 948 | Ga0466966_0144073 | |||
| 949 | Ga0466961_0029169 | |||
| 950 | Ga0466961_0242918 | |||
| 951 | Ga0466963_0013532 | |||
| 952 | Ga0466963_0048693 | |||
| 953 | Ga0466963_0089458 | |||
| 954 | Ga0466963_0118312 | |||
| 955 | Ga0466963_0234784 | |||
| 956 | Ga0466964_0001921 | |||
| 957 | Ga0466964_0006965 | |||
| 958 | Ga0466964_0012845 | |||
| 959 | Ga0466964_0017348 | |||
| 960 | Ga0466964_0060192 | |||
| 961 | Ga0466964_0063938 | |||
| 962 | Ga0466971_0001404 | |||
| 963 | Ga0466968_0038545 | |||
| 964 | Ga0466970_0086106 | |||
| 965 | Ga0466970_0107221 | |||
| 966 | Ga0466957_0026133 | |||
| 967 | Ga0466960_0074108 | |||
| 968 | Ga0466960_0083080 | |||
| 969 | Ga0466960_0139911 | |||
| 970 | Ga0466959_0008546 | |||
| 971 | Ga0466958_0010225 | |||
| 972 | Ga0466958_0032175 | |||
| 973 | Ga0466958_0127277 | |||
| 974 | Ga0466958_0259839 | |||
| 975 | Ga0466967_0002953 | |||
| 976 | Ga0466967_0023142 | |||
| 977 | Ga0466967_0023418 | |||
| 978 | Ga0466967_0026193 | |||
| 979 | Ga0466967_0040748 | |||
| 980 | Ga0466967_0079370 | |||
| 981 | Ga0466967_0096369 | |||
| 982 | Ga0466967_0202919 | |||
| 983 | Ga0466967_0282033 | |||
| 984 | Ga0466967_0343650 | |||
| 985 | Ga0466967_0621466 | |||
| 986 | Ga0495592_0002297 | |||
| 987 | Ga0495592_0141858 | |||
| 988 | Ga0495603_0001374 | |||
| 989 | Ga0495641_0001029 | |||
| 990 | Ga0495651_0063055 | |||
| 991 | Ga0495651_0067201 | |||
| 992 | Ga0495653_0085487 | |||
| 993 | Ga0495653_0458011 | |||
| 994 | Ga0495580_0058991 | |||
| 995 | Ga0495582_0062823 | |||
| 996 | Ga0495582_0063070 | |||
| 997 | Ga0495582_0120801 | |||
| 998 | Ga0495639_0046160 | |||
| 999 | Ga0495639_0081940 | |||
| 1000 | Ga0495594_0010001 | |||
| 1001 | Ga0495608_0109497 | |||
| 1002 | Ga0495618_0066905 | |||
| 1003 | Ga0495628_0025903 | |||
| 1004 | Ga0495630_0002755 | |||
| 1005 | Ga0495666_0006362 | |||
| 1006 | Ga0495652_0060674 | |||
| 1007 | Ga0495652_0125760 | |||
| 1008 | Ga0495587_0032660 | |||
| 1009 | Ga0495645_0033507 | |||
| 1010 | Ga0495667_0150623 | |||
| 1011 | Ga0495667_0245668 | |||
| 1012 | Ga0495635_0134043 | |||
| 1013 | Ga0495588_0001380 | |||
| 1014 | Ga0495599_0013577 | |||
| 1015 | Ga0495646_0052426 | |||
| 1016 | Ga0495674_0428072 | |||
| 1017 | Ga0495676_0021605 | |||
| 1018 | Ga0495676_0033643 | |||
| 1019 | Ga0495676_0302963 | |||
| 1020 | Ga0495675_0033522 | |||
| 1021 | Ga0495602_0060717 | |||
| 1022 | Ga0495602_0362884 | |||
| 1023 | Ga0496100_0100341 | |||
| 1024 | Ga0496101_0037427 | |||
| 1025 | Ga0496101_0043081 | |||
| 1026 | Ga0496101_0119683 | |||
| 1027 | Ga0496102_0033720 | |||
| 1028 | Ga0496102_0160067 | |||
| 1029 | Ga0496103_0023143 | |||
| 1030 | Ga0496103_0125428 | |||
| 1031 | Ga0496104_0012149 | |||
| 1032 | Ga0496104_0012510 | |||
| 1033 | Ga0496104_0515054 | |||
| 1034 | Ga0496105_0017035 | |||
| 1035 | Ga0496105_0057721 | |||
| 1036 | Ga0496105_0192672 | |||
| 1037 | Ga0496108_0147565 | |||
| 1038 | Ga0496108_0233677 | |||
| 1039 | Ga0496109_0040723 | |||
| 1040 | Ga0496109_0121328 | |||
| 1041 | Ga0496109_0179473 | |||
| 1042 | Ga0496110_0045368 | |||
| 1043 | Ga0496110_0296935 | |||
| 1044 | Ga0496111_0022989 | |||
| 1045 | Ga0496111_0143037 | |||
| 1046 | Ga0496111_0150434 | |||
| 1047 | Ga0496111_0331435 | |||
| 1048 | Ga0496112_0057801 | |||
| 1049 | Ga0496112_0100595 | |||
| 1050 | Ga0496112_0275798 | |||
| 1051 | Ga0496113_0074599 | |||
| 1052 | Ga0496113_0088291 | |||
| 1053 | Ga0496113_0717135 | |||
| 1054 | Ga0496114_0003589 | |||
| 1055 | Ga0496114_0012957 | |||
| 1056 | Ga0496115_0059987 | |||
| 1057 | Ga0496115_0262940 | |||
| 1058 | Ga0496115_0627860 | |||
| 1059 | Ga0501047_0044250 | |||
| 1060 | Ga0501047_0180715 | |||
| 1061 | Ga0501067_0003757 | |||
| 1062 | Ga0501069_0057664 | |||
| 1063 | Ga0501070_0023174 | |||
| 1064 | Ga0501035_0307703 | |||
| 1065 | Ga0501044_0222524 | |||
| 1066 | nmdc:mga05p37_222731_c1 | |||
| 1067 | nmdc:mga0n895_180276_c1 | |||
| 1068 | nmdc:mga0n895_367662_c1 | |||
| 1069 | nmdc:mga0n895_579136_c1 | |||
| 1070 | nmdc:mga0n895_89520_c1 | |||
| 1071 | nmdc:mga0rr50_113657_c1 | |||
| 1072 | nmdc:mga0rr50_98071_c1 | |||
| 1073 | nmdc:mga08x19_16014_c1 | |||
| 1074 | nmdc:mga08x19_61370_c1 | |||
| 1075 | Ga0495601_0043963 | |||
| 1076 | Ga0495601_0079885 | |||
| 1077 | Ga0495601_0403268 | |||
| 1078 | Ga0495612_0037476 | |||
| 1079 | Ga0495595_0022685 | |||
| 1080 | Ga0495595_0054577 | |||
| 1081 | Ga0495595_0174930 | |||
| 1082 | Ga0587084_007130 | |||
| 1083 | Ga0587093_024421 | |||
| 1084 | Ga0587066_016909 | |||
| 1085 | Ga0587066_020250 | |||
| 1086 | Ga0587066_025380 | |||
| 1087 | Ga0587066_049865 | |||
| 1088 | Ga0587070_023862 | |||
| 1089 | Ga0587070_026890 | |||
| 1090 | Ga0587070_034292 | |||
| 1091 | Ga0587070_047803 | |||
| 1092 | Ga0587073_0005728 | |||
| 1093 | Ga0587073_0011475 | |||
| 1094 | Ga0587073_0015227 | |||
| 1095 | Ga0587073_0022631 | |||
| 1096 | Ga0587073_0025007 | |||
| 1097 | Ga0587073_0030655 | |||
| 1098 | Ga0587073_0045831 | |||
| 1099 | Ga0587073_0079124 | |||
| 1100 | Ga0587073_0103526 | |||
| 1101 | Ga0587077_007338 | |||
| 1102 | Ga0587080_001371 | |||
| 1103 | Ga0587080_004796 | |||
| 1104 | Ga0587080_020936 | |||
| 1105 | Ga0587080_039551 | |||
| 1106 | Ga0587082_001746 | |||
| 1107 | Ga0587082_013030 | |||
| 1108 | Ga0587082_022875 | |||
| 1109 | Ga0587082_034728 | |||
| 1110 | Ga0587082_046650 | |||
| 1111 | Ga0587083_0003155 | |||
| 1112 | Ga0587083_0004990 | |||
| 1113 | Ga0587083_0016287 | |||
| 1114 | Ga0587083_0019765 | |||
| 1115 | Ga0587083_0033981 | |||
| 1116 | Ga0587083_0082325 | |||
| 1117 | Ga0587085_024971 | |||
| 1118 | Ga0587086_004538 | |||
| 1119 | Ga0587086_023087 | |||
| 1120 | Ga0587088_005801 | |||
| 1121 | Ga0587088_027099 | |||
| 1122 | Ga0587088_027976 | |||
| 1123 | Ga0587088_028753 | |||
| 1124 | Ga0587089_004085 | |||
| 1125 | Ga0587089_021482 | |||
| 1126 | Ga0587089_035952 | |||
| 1127 | Ga0587090_007336 | |||
| 1128 | Ga0587090_018402 | |||
| 1129 | Ga0587090_019651 | |||
| 1130 | Ga0587090_036698 | |||
| 1131 | Ga0587090_037863 | |||
| 1132 | Ga0587091_010343 | |||
| 1133 | Ga0587091_021919 | |||
| 1134 | Ga0587091_031929 | |||
| 1135 | Ga0587091_037176 | |||
| 1136 | Ga0587092_020687 | |||
| 1137 | Ga0587094_014717 | |||
| 1138 | Ga0587095_001180 | |||
| 1139 | Ga0587098_005611 | |||
| 1140 | Ga0587106_000914 | |||
| 1141 | Ga0587106_012082 | |||
| 1142 | Ga0587106_016955 | |||
| 1143 | Ga0587106_019733 | |||
| 1144 | Ga0587106_037563 | |||
| 1145 | Ga0587125_007673 | |||
| 1146 | Ga0587125_022763 | |||
| 1147 | Ga0587129_000372 | |||
| 1148 | Ga0587129_008139 | |||
| 1149 | Ga0587099_004479 | |||
| 1150 | Ga0587099_008800 | |||
| 1151 | Ga0587099_010201 | |||
| 1152 | Ga0587099_012061 | |||
| 1153 | Ga0587099_019333 | |||
| 1154 | Ga0587101_013962 | |||
| 1155 | Ga0587113_000759 | |||
| 1156 | Ga0587113_003209 | |||
| 1157 | Ga0587113_006877 | |||
| 1158 | Ga0587113_008197 | |||
| 1159 | Ga0587113_009036 | |||
| 1160 | Ga0587115_003014 | |||
| 1161 | Ga0587115_009968 | |||
| 1162 | Ga0587115_012902 | |||
| 1163 | Ga0587115_015699 | |||
| 1164 | Ga0587115_021213 | |||
| 1165 | Ga0587117_035707 | |||
| 1166 | Ga0587128_016043 | |||
| 1167 | Ga0587128_018077 | |||
| 1168 | Ga0587128_026075 | |||
| 1169 | Ga0587130_004606 | |||
| 1170 | Ga0587130_010392 | |||
| 1171 | Ga0587067_013886 | |||
| 1172 | Ga0587067_027956 | |||
| 1173 | Ga0587067_032582 | |||
| 1174 | Ga0587067_070598 | |||
| 1175 | Ga0587067_075760 | |||
| 1176 | Ga0587068_041702 | |||
| 1177 | Ga0587069_007583 | |||
| 1178 | Ga0587072_008683 | |||
| 1179 | Ga0587072_020498 | |||
| 1180 | Ga0587075_002297 | |||
| 1181 | Ga0587075_006085 | |||
| 1182 | Ga0587075_006107 | |||
| 1183 | Ga0587075_010309 | |||
| 1184 | Ga0587075_019832 | |||
| 1185 | Ga0587075_022363 | |||
| 1186 | Ga0587076_014819 | |||
| 1187 | Ga0587076_037902 | |||
| 1188 | Ga0587076_066934 | |||
| 1189 | Ga0587079_076573 | |||
| 1190 | Ga0587100_004938 | |||
| 1191 | Ga0587104_005253 | |||
| 1192 | Ga0587105_003346 | |||
| 1193 | Ga0587107_007428 | |||
| 1194 | Ga0587107_013405 | |||
| 1195 | Ga0587107_021051 | |||
| 1196 | Ga0587107_031584 | |||
| 1197 | Ga0587107_038955 | |||
| 1198 | Ga0587114_003064 | |||
| 1199 | Ga0587114_007853 | |||
| 1200 | Ga0587114_024768 | |||
| 1201 | Ga0587114_026750 | |||
| 1202 | Ga0587116_03386 | |||
| 1203 | Ga0587120_002168 | |||
| 1204 | Ga0587120_005511 | |||
| 1205 | Ga0587120_006742 | |||
| 1206 | Ga0587120_010890 | |||
| 1207 | Ga0587071_008937 | |||
| 1208 | Ga0587071_023948 | |||
| 1209 | Ga0587071_030361 | |||
| 1210 | Ga0587111_0014690 | |||
| 1211 | Ga0501082_0674644 | |||
| 1212 | Ga0466962_0001120 | |||
| 1213 | Ga0466962_0037866 | |||
| 1214 | Ga0466962_0088056 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zug-assembly1.cif.gz_F | structure of the bacterial acetate channel satp | 0.9453 | 20 | 208 |
| 5ys3-assembly1.cif.gz_A | 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri | 0.9344 | 20 | 209 |
| 5zug-assembly1.cif.gz_F | structure of the bacterial acetate channel satp | 0.9301 | 20 | 208 |
| 5ys3-assembly1.cif.gz_A | 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri | 0.8912 | 20 | 209 |
| 5z62-assembly1.cif.gz_C | structure of human cytochrome c oxidase | 0.4684 | 24 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6humE00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4584 | 109 | 198 | 1.10.287.3510 |
| af_A4I3V6_8_216_1.20.1420.10 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain | 0.4576 | 26 | 188 | 1.20.1420.10 |
| af_G2J646_1_138_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4512 | 19 | 171 | 1.20.140.150 |
| af_Q10346_7_181_1.20.1420.10 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain | 0.4326 | 24 | 185 | 1.20.1420.10 |
| af_Q9XW96_22_330_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.427 | 20 | 195 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U8YUC0-F1-model_v4 | Acetate transporter gpr1/fun34/satp family | 0.953 | 20 | 208 |
GO:0005886
GO:0015360 GO:0071422 |
| AF-A0A7S4PB93-F1-model_v4 | Acetate transporter | 0.9485 | 20 | 213 |
GO:0005886
GO:0015123 |
| AF-A0A1C3YZH6-F1-model_v4 | Succinate-acetate transporter protein | 0.9473 | 16 | 209 |
GO:0005886
GO:0015360 GO:0071422 |
| AF-A0A7U4FRT1-F1-model_v4 | deleted | 0.9472 | 16 | 209 |
|
| AF-A0A523ARE2-F1-model_v4 | Acetate uptake transporter | 0.9468 | 20 | 198 |
GO:0005886
GO:0015360 GO:0071422 |