F468707

General Info

Members Datasets Scaffolds Average Seq Length
607 232 1214 276

Family's Representative Sequence

Representative Sequence 3300031733|Ga0316577_10001199|Ga0316577_100011993
Length 270
Sequence MRDKYGILFLGDVIGRPGRRALRKFLPVLLEKYSPSLVVANGENAAGGIGITPDICRQLLAQVDVLTSGNHIWDKREAIEYLDVEPRLLRPANYPSPNPGKGVYAFETREGFQVAILNLQGRVFMEPIDCPFRAADKELALLEGKKTITLVDFHAEATSEKQAMGWYLDGRVSAVVGTHTHVPTADEKILPQGTAFITDVGMVGGYASVIGLKKEQALQRFLTSRPQRFEPGKQGLVSSSLFVDVDTQTGKAISIQRDMLYEDVKENEHL

Samples

Sample ID Description Type Environment
1 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.34
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316577_10001199 3300031733 Bacteria 11998
2 SwRhRL2b_contig_3495822 2162886007 Unclassified 1449
3 SwRhRL2b_contig_757619 2162886007 Bacteria 931
4 JGI24746J21847_1005383 3300001977 Bacteria 1997
5 JGI25406J46586_10000188 3300003203 Bacteria 27540
6 Ga0065714_10108694 3300005288 Bacteria 1511
7 Ga0065704_10242024 3300005289 Bacteria 1012
8 Ga0065712_10071830 3300005290 Bacteria 5038
9 Ga0065712_10093172 3300005290 Bacteria 2303
10 Ga0065712_10097785 3300005290 Bacteria 2139
11 Ga0065715_10009149 3300005293 Bacteria 3229
12 Ga0065715_10150770 3300005293 Bacteria 1732
13 Ga0065715_10198750 3300005293 Bacteria 1373
14 Ga0065707_10006880 3300005295 Bacteria 4371
15 Ga0065707_10095648 3300005295 Bacteria 3336
16 Ga0070658_10283380 3300005327 Bacteria 1411
17 Ga0070676_10018577 3300005328 Bacteria 3855
18 Ga0070676_10023781 3300005328 Bacteria 3445
19 Ga0070676_10046293 3300005328 Bacteria 2536
20 Ga0070683_100201078 3300005329 Bacteria 1892
21 Ga0070683_100440231 3300005329 Bacteria 1244
22 Ga0070690_100026105 3300005330 Bacteria 3600
23 Ga0070690_100033795 3300005330 Bacteria 3203
24 Ga0070690_100224517 3300005330 Bacteria 1318
25 Ga0070670_100002877 3300005331 Bacteria 14242
26 Ga0070670_100008188 3300005331 Bacteria 8902
27 Ga0070670_100039805 3300005331 Bacteria 4042
28 Ga0070670_100077047 3300005331 Bacteria 2865
29 Ga0070677_10021822 3300005333 Bacteria 2352
30 Ga0070677_10044875 3300005333 Bacteria 1761
31 Ga0068869_100003236 3300005334 Bacteria 9954
32 Ga0068869_100005463 3300005334 Bacteria 7997
33 Ga0070666_10115833 3300005335 Bacteria 1856
34 Ga0070680_100065511 3300005336 Bacteria 2977
35 Ga0070680_100323441 3300005336 Bacteria 1309
36 Ga0068868_100008101 3300005338 Bacteria 7516
37 Ga0068868_100202796 3300005338 Bacteria 1654
38 Ga0068868_100366735 3300005338 Bacteria 1237
39 Ga0070689_100014552 3300005340 Bacteria 5718
40 Ga0070689_100051308 3300005340 Bacteria 3189
41 Ga0070689_100062586 3300005340 Bacteria 2896
42 Ga0070689_100134546 3300005340 Bacteria 1984
43 Ga0070687_100013368 3300005343 Bacteria 3658
44 Ga0070687_100016036 3300005343 Bacteria 3404
45 Ga0070661_100037274 3300005344 Bacteria 3536
46 Ga0070661_100114605 3300005344 Bacteria 2015
47 Ga0070661_100215027 3300005344 Bacteria 1473
48 Ga0070692_10064233 3300005345 Bacteria 1941
49 Ga0070669_100002727 3300005353 Bacteria 12739
50 Ga0070669_100026198 3300005353 Bacteria 4195
51 Ga0070669_100075890 3300005353 Bacteria 2494
52 Ga0070669_100157077 3300005353 Bacteria 1765
53 Ga0070669_100164344 3300005353 Bacteria 1727
54 Ga0070675_100000537 3300005354 Bacteria 25951
55 Ga0070675_100003145 3300005354 Bacteria 12491
56 Ga0070675_100005576 3300005354 Bacteria 9637
57 Ga0070675_100027847 3300005354 Bacteria 4543
58 Ga0070675_100083050 3300005354 Bacteria 2673
59 Ga0070675_100118918 3300005354 Bacteria 2244
60 Ga0070675_100212814 3300005354 Bacteria 1681
61 Ga0070671_100029642 3300005355 Bacteria 4512
62 Ga0070671_100544321 3300005355 Bacteria 1001
63 Ga0070674_100001500 3300005356 Bacteria 12440
64 Ga0070674_100202005 3300005356 Bacteria 1535
65 Ga0070673_100011067 3300005364 Bacteria 6147
66 Ga0070673_100152749 3300005364 Bacteria 1956
67 Ga0070673_100173764 3300005364 Bacteria 1840
68 Ga0070673_100174804 3300005364 Bacteria 1835
69 Ga0070673_100178630 3300005364 Bacteria 1816
70 Ga0070673_100273664 3300005364 Bacteria 1479
71 Ga0070673_100330612 3300005364 Bacteria 1348
72 Ga0070688_100009604 3300005365 Bacteria 5301
73 Ga0070688_100056574 3300005365 Bacteria 2463
74 Ga0070688_100099110 3300005365 Bacteria 1918
75 Ga0070688_100157964 3300005365 Bacteria 1556
76 Ga0070659_100064075 3300005366 Bacteria 2909
77 Ga0070659_100146248 3300005366 Bacteria 1926
78 Ga0070667_100010567 3300005367 Bacteria 7620
79 Ga0070667_100484271 3300005367 Bacteria 1133
80 Ga0070701_10002485 3300005438 Bacteria 7123
81 Ga0070701_10021663 3300005438 Bacteria 3071
82 Ga0070705_100135440 3300005440 Bacteria 1613
83 Ga0070700_100015111 3300005441 Bacteria 4371
84 Ga0070700_100018991 3300005441 Bacteria 3962
85 Ga0070700_100094208 3300005441 Bacteria 1960
86 Ga0070700_100409431 3300005441 Bacteria 1022
87 Ga0070694_100300369 3300005444 Bacteria 1230
88 Ga0070678_100039934 3300005456 Bacteria 3316
89 Ga0070678_100142803 3300005456 Bacteria 1918
90 Ga0070678_100165541 3300005456 Bacteria 1796
91 Ga0070678_100168194 3300005456 Bacteria 1783
92 Ga0070678_100177709 3300005456 Bacteria 1740
93 Ga0070662_100085345 3300005457 Bacteria 2359
94 Ga0070662_100306350 3300005457 Bacteria 1292
95 Ga0070681_10025905 3300005458 Bacteria 5896
96 Ga0068867_100000147 3300005459 Bacteria 45184
97 Ga0068867_100003422 3300005459 Bacteria 11159
98 Ga0068867_100071966 3300005459 Bacteria 2587
99 Ga0068867_100089238 3300005459 Bacteria 2338
100 Ga0068867_100186096 3300005459 Bacteria 1654
101 Ga0070685_10017893 3300005466 Bacteria 3803
102 Ga0070685_10143686 3300005466 Bacteria 1505
103 Ga0070685_10180385 3300005466 Bacteria 1359
104 Ga0070707_100228446 3300005468 Bacteria 1812
105 Ga0070707_100283272 3300005468 Bacteria 1610
106 Ga0070698_100022784 3300005471 Bacteria 6549
107 Ga0070698_100049505 3300005471 Bacteria 4288
108 Ga0070698_100059186 3300005471 Bacteria 3870
109 Ga0070698_100420067 3300005471 Bacteria 1272
110 Ga0070699_100000339 3300005518 Bacteria 45340
111 Ga0070699_100024512 3300005518 Bacteria 5199
112 Ga0070699_100192061 3300005518 Bacteria 1814
113 Ga0070699_100214118 3300005518 Bacteria 1716
114 Ga0070699_100275613 3300005518 Bacteria 1506
115 Ga0070679_100054537 3300005530 Bacteria 3980
116 Ga0070697_100204128 3300005536 Bacteria 1680
117 Ga0070697_100269293 3300005536 Bacteria 1460
118 Ga0070672_100003678 3300005543 Bacteria 9967
119 Ga0070672_100020041 3300005543 Bacteria 4872
120 Ga0070672_100074274 3300005543 Bacteria 2712
121 Ga0070672_100097480 3300005543 Bacteria 2380
122 Ga0070686_100074620 3300005544 Bacteria 2229
123 Ga0070686_100104497 3300005544 Bacteria 1919
124 Ga0070695_100231791 3300005545 Bacteria 1335
125 Ga0070696_100062338 3300005546 Bacteria 2610
126 Ga0070696_100125184 3300005546 Bacteria 1864
127 Ga0070665_100012196 3300005548 Bacteria 8665
128 Ga0070665_100031333 3300005548 Bacteria 5351
129 Ga0070704_100028361 3300005549 Bacteria 3723
130 Ga0070704_100059667 3300005549 Bacteria 2723
131 Ga0070704_100116285 3300005549 Bacteria 2045
132 Ga0070664_100010031 3300005564 Bacteria 7676
133 Ga0070664_100011751 3300005564 Bacteria 7107
134 Ga0070664_100027774 3300005564 Bacteria 4705
135 Ga0070664_100130213 3300005564 Bacteria 2209
136 Ga0070664_100160666 3300005564 Bacteria 1988
137 Ga0068857_100033732 3300005577 Bacteria 4527
138 Ga0068857_100078821 3300005577 Bacteria 2940
139 Ga0068857_100181226 3300005577 Bacteria 1917
140 Ga0068857_100256147 3300005577 Bacteria 1605
141 Ga0068854_100055078 3300005578 Bacteria 2862
142 Ga0070702_100022601 3300005615 Bacteria 3328
143 Ga0068859_100002533 3300005617 Bacteria 18549
144 Ga0068859_100044995 3300005617 Bacteria 4435
145 Ga0068859_100046545 3300005617 Bacteria 4356
146 Ga0068859_100068989 3300005617 Bacteria 3570
147 Ga0068859_100080631 3300005617 Bacteria 3296
148 Ga0068859_100101945 3300005617 Bacteria 2928
149 Ga0068859_100258832 3300005617 Bacteria 1831
150 Ga0068864_100112652 3300005618 Bacteria 2425
151 Ga0068864_100223612 3300005618 Bacteria 1738
152 Ga0068866_10004135 3300005718 Bacteria 5950
153 Ga0068861_100001293 3300005719 Bacteria 15634
154 Ga0068861_100035291 3300005719 Bacteria 3703
155 Ga0068861_100060837 3300005719 Bacteria 2896
156 Ga0068861_100120742 3300005719 Bacteria 2114
157 Ga0068861_100288460 3300005719 Bacteria 1416
158 Ga0068870_10008632 3300005840 Bacteria 4593
159 Ga0068870_10033511 3300005840 Bacteria 2621
160 Ga0068870_10062119 3300005840 Bacteria 2011
161 Ga0068870_10131221 3300005840 Bacteria 1455
162 Ga0068863_100133676 3300005841 Bacteria 2369
163 Ga0068858_100066511 3300005842 Bacteria 3337
164 Ga0068858_100185150 3300005842 Bacteria 1967
165 Ga0068860_100082640 3300005843 Bacteria 3055
166 Ga0068860_100086446 3300005843 Bacteria 2984
167 Ga0068862_100001293 3300005844 Bacteria 23404
168 Ga0068862_100466306 3300005844 Bacteria 1193
169 Ga0081539_10000013 3300005985 Bacteria 432395
170 Ga0081539_10013539 3300005985 Bacteria 6136
171 Ga0070716_100262996 3300006173 Bacteria 1181
172 Ga0097621_100092943 3300006237 Bacteria 2527
173 Ga0097621_100190319 3300006237 Bacteria 1777
174 Ga0097621_100191446 3300006237 Bacteria 1771
175 Ga0068871_100167506 3300006358 Bacteria 1882
176 Ga0075428_100000869 3300006844 Bacteria 31758
177 Ga0075428_100008219 3300006844 Bacteria 11575
178 Ga0075428_100051934 3300006844 Bacteria 4495
179 Ga0075428_100119341 3300006844 Bacteria 2872
180 Ga0075428_100760395 3300006844 Bacteria 1031
181 Ga0075430_100022848 3300006846 Bacteria 5319
182 Ga0075430_100040989 3300006846 Bacteria 3918
183 Ga0075430_100492171 3300006846 Bacteria 1012
184 Ga0075431_100049128 3300006847 Bacteria 4351
185 Ga0075431_100090962 3300006847 Bacteria 3150
186 Ga0075431_100204632 3300006847 Bacteria 2018
187 Ga0075431_100329722 3300006847 Bacteria 1537
188 Ga0075433_10002009 3300006852 Bacteria 15330
189 Ga0075433_10013571 3300006852 Bacteria 6631
190 Ga0075433_10184104 3300006852 Bacteria 1858
191 Ga0075433_10202027 3300006852 Bacteria 1767
192 Ga0075433_10493710 3300006852 Bacteria 1078
193 Ga0075434_100005716 3300006871 Bacteria 11358
194 Ga0075434_100008044 3300006871 Bacteria 9777
195 Ga0075434_100008828 3300006871 Bacteria 9381
196 Ga0075434_100038568 3300006871 Bacteria 4731
197 Ga0075434_100078720 3300006871 Bacteria 3292
198 Ga0075434_100109915 3300006871 Bacteria 2767
199 Ga0075434_100255165 3300006871 Bacteria 1772
200 Ga0075429_100052468 3300006880 Bacteria 3548
201 Ga0075429_100079071 3300006880 Bacteria 2867
202 Ga0075429_100091302 3300006880 Bacteria 2657
203 Ga0075429_100096904 3300006880 Bacteria 2573
204 Ga0075429_100196292 3300006880 Bacteria 1768
205 Ga0075429_100393126 3300006880 Bacteria 1214
206 Ga0075429_100463729 3300006880 Bacteria 1110
207 Ga0068865_100005178 3300006881 Bacteria 7889
208 Ga0068865_100017474 3300006881 Bacteria 4613
209 Ga0068865_100077390 3300006881 Bacteria 2377
210 Ga0068865_100112314 3300006881 Bacteria 2012
211 Ga0068865_100241631 3300006881 Bacteria 1421
212 Ga0075436_100125073 3300006914 Bacteria 1801
213 Ga0097620_100002533 3300006931 Bacteria 18549
214 Ga0097620_100044994 3300006931 Bacteria 4435
215 Ga0097620_100046547 3300006931 Bacteria 4356
216 Ga0097620_100068989 3300006931 Bacteria 3570
217 Ga0097620_100080627 3300006931 Bacteria 3296
218 Ga0097620_100101943 3300006931 Bacteria 2928
219 Ga0097620_100258834 3300006931 Bacteria 1831
220 Ga0075435_100005714 3300007076 Bacteria 8719
221 Ga0075435_100010574 3300007076 Bacteria 6754
222 Ga0075435_100050563 3300007076 Bacteria 3345
223 Ga0075435_100065813 3300007076 Bacteria 2947
224 Ga0075435_100158714 3300007076 Bacteria 1904
225 Ga0111539_10000044 3300009094 Bacteria 125347
226 Ga0111539_10000769 3300009094 Bacteria 41797
227 Ga0111539_10001774 3300009094 Bacteria 28680
228 Ga0111539_10022455 3300009094 Bacteria 7752
229 Ga0111539_10055455 3300009094 Bacteria 4711
230 Ga0111539_10100266 3300009094 Bacteria 3401
231 Ga0111539_10242372 3300009094 Bacteria 2099
232 Ga0111539_10266868 3300009094 Bacteria 1992
233 Ga0111539_10324706 3300009094 Bacteria 1791
234 Ga0105245_10008629 3300009098 Bacteria 8891
235 Ga0105245_10459839 3300009098 Bacteria 1283
236 Ga0114129_10003198 3300009147 Bacteria 22984
237 Ga0114129_10003276 3300009147 Bacteria 22724
238 Ga0114129_10006054 3300009147 Bacteria 17152
239 Ga0114129_10009872 3300009147 Bacteria 13609
240 Ga0114129_10029480 3300009147 Bacteria 7773
241 Ga0114129_10096834 3300009147 Bacteria 4085
242 Ga0114129_10132600 3300009147 Bacteria 3421
243 Ga0114129_10160493 3300009147 Bacteria 3071
244 Ga0114129_10176742 3300009147 Bacteria 2908
245 Ga0114129_10846750 3300009147 Bacteria 1163
246 Ga0114129_11101553 3300009147 Bacteria 994
247 Ga0105243_10008157 3300009148 Bacteria 8043
248 Ga0105241_10568125 3300009174 Bacteria 1020
249 Ga0105242_10002921 3300009176 Bacteria 13348
250 Ga0105242_10290514 3300009176 Bacteria 1488
251 Ga0105242_10476981 3300009176 Bacteria 1181
252 Ga0105248_10241039 3300009177 Bacteria 2036
253 Ga0105248_10647238 3300009177 Bacteria 1192
254 Ga0105238_10043505 3300009551 Bacteria 4544
255 Ga0105249_10001334 3300009553 Bacteria 21606
256 Ga0105249_10043919 3300009553 Bacteria 4065
257 Ga0105249_10087301 3300009553 Bacteria 2910
258 Ga0105246_10021871 3300011119 Bacteria 4122
259 Ga0105246_10028237 3300011119 Bacteria 3684
260 Ga0157371_10043810 3300013102 Bacteria 3187
261 Ga0157374_10215050 3300013296 Bacteria 1885
262 Ga0157374_10264284 3300013296 Bacteria 1695
263 Ga0157378_10099238 3300013297 Bacteria 2656
264 Ga0157378_10216219 3300013297 Bacteria 1820
265 Ga0163162_10033186 3300013306 Bacteria 5128
266 Ga0163162_10168863 3300013306 Bacteria 2312
267 Ga0163162_10182938 3300013306 Bacteria 2222
268 Ga0157375_10018181 3300013308 Bacteria 6370
269 Ga0157375_10033798 3300013308 Bacteria 4864
270 Ga0157375_10062458 3300013308 Bacteria 3702
271 Ga0157375_10164865 3300013308 Bacteria 2360
272 Ga0157375_10209089 3300013308 Bacteria 2108
273 Ga0157375_10301418 3300013308 Bacteria 1766
274 Ga0157375_10348737 3300013308 Bacteria 1646
275 Ga0163163_10074895 3300014325 Bacteria 3378
276 Ga0163163_10140451 3300014325 Bacteria 2458
277 Ga0163163_10842994 3300014325 Bacteria 980
278 Ga0157380_10003886 3300014326 Bacteria 10304
279 Ga0157380_10007439 3300014326 Bacteria 7775
280 Ga0157380_10073267 3300014326 Bacteria 2776
281 Ga0157380_10158137 3300014326 Bacteria 1966
282 Ga0157380_10274561 3300014326 Unclassified 1539
283 Ga0157380_10278188 3300014326 Bacteria 1530
284 Ga0157380_10536658 3300014326 Bacteria 1144
285 Ga0157377_10002991 3300014745 Bacteria 7572
286 Ga0157377_10015219 3300014745 Bacteria 3929
287 Ga0157377_10093693 3300014745 Bacteria 1778
288 Ga0157379_10003739 3300014968 Bacteria 12939
289 Ga0157379_10328573 3300014968 Bacteria 1397
290 Ga0157376_10052484 3300014969 Bacteria 3390
291 Ga0157376_10057545 3300014969 Bacteria 3253
292 Ga0157376_10225378 3300014969 Bacteria 1738
293 Ga0157376_10234502 3300014969 Bacteria 1706
294 Ga0157376_10251963 3300014969 Unclassified 1649
295 Ga0163161_10023461 3300017792 Bacteria 4352
296 Ga0163161_10042869 3300017792 Bacteria 3256
297 Ga0207697_10001514 3300025315 Bacteria 12621
298 Ga0207697_10068491 3300025315 Bacteria 1485
299 Ga0207697_10091137 3300025315 Bacteria 1292
300 Ga0207682_10001841 3300025893 Bacteria 9661
301 Ga0207682_10003394 3300025893 Bacteria 6930
302 Ga0207682_10014594 3300025893 Bacteria 3062
303 Ga0207682_10042777 3300025893 Bacteria 1851
304 Ga0207682_10148890 3300025893 Bacteria 1055
305 Ga0207642_10016929 3300025899 Bacteria 2760
306 Ga0207642_10194784 3300025899 Bacteria 1115
307 Ga0207688_10001443 3300025901 Bacteria 12425
308 Ga0207680_10105873 3300025903 Bacteria 1815
309 Ga0207647_10098223 3300025904 Bacteria 1740
310 Ga0207699_10037961 3300025906 Bacteria 2757
311 Ga0207645_10001881 3300025907 Bacteria 16948
312 Ga0207645_10016937 3300025907 Bacteria 4815
313 Ga0207645_10027133 3300025907 Bacteria 3700
314 Ga0207645_10043765 3300025907 Bacteria 2866
315 Ga0207643_10005281 3300025908 Bacteria 6909
316 Ga0207643_10005748 3300025908 Bacteria 6631
317 Ga0207643_10015261 3300025908 Bacteria 4179
318 Ga0207643_10020319 3300025908 Bacteria 3644
319 Ga0207643_10027240 3300025908 Bacteria 3167
320 Ga0207643_10039643 3300025908 Bacteria 2650
321 Ga0207705_10482681 3300025909 Bacteria 962
322 Ga0207684_10568773 3300025910 Bacteria 969
323 Ga0207660_10280256 3300025917 Bacteria 1323
324 Ga0207662_10002054 3300025918 Bacteria 9973
325 Ga0207662_10020005 3300025918 Bacteria 3816
326 Ga0207649_10088325 3300025920 Bacteria 2024
327 Ga0207652_10085534 3300025921 Bacteria 2764
328 Ga0207646_10247413 3300025922 Bacteria 1610
329 Ga0207646_10332477 3300025922 Bacteria 1373
330 Ga0207681_10000566 3300025923 Bacteria 25276
331 Ga0207681_10020352 3300025923 Bacteria 4203
332 Ga0207681_10030926 3300025923 Bacteria 3494
333 Ga0207681_10074125 3300025923 Bacteria 2383
334 Ga0207681_10074279 3300025923 Bacteria 2381
335 Ga0207681_10081612 3300025923 Bacteria 2283
336 Ga0207681_10146939 3300025923 Bacteria 1762
337 Ga0207694_10024715 3300025924 Bacteria 4563
338 Ga0207650_10072055 3300025925 Bacteria 2600
339 Ga0207650_10083205 3300025925 Bacteria 2430
340 Ga0207650_10211843 3300025925 Bacteria 1556
341 Ga0207659_10001222 3300025926 Bacteria 15363
342 Ga0207659_10002242 3300025926 Bacteria 11514
343 Ga0207659_10002762 3300025926 Bacteria 10460
344 Ga0207659_10007569 3300025926 Bacteria 6690
345 Ga0207659_10014600 3300025926 Bacteria 5071
346 Ga0207659_10018603 3300025926 Bacteria 4558
347 Ga0207659_10027625 3300025926 Bacteria 3845
348 Ga0207659_10029682 3300025926 Bacteria 3729
349 Ga0207659_10147555 3300025926 Bacteria 1833
350 Ga0207659_10163944 3300025926 Bacteria 1748
351 Ga0207659_10231190 3300025926 Bacteria 1491
352 Ga0207659_10293757 3300025926 Bacteria 1332
353 Ga0207659_10353734 3300025926 Bacteria 1219
354 Ga0207687_10014295 3300025927 Bacteria 5193
355 Ga0207690_10199165 3300025932 Bacteria 1520
356 Ga0207706_10003425 3300025933 Bacteria 15142
357 Ga0207706_10105521 3300025933 Bacteria 2479
358 Ga0207706_10218302 3300025933 Bacteria 1670
359 Ga0207706_10292309 3300025933 Bacteria 1421
360 Ga0207686_10006753 3300025934 Bacteria 6180
361 Ga0207686_10034387 3300025934 Bacteria 3034
362 Ga0207709_10003920 3300025935 Bacteria 8690
363 Ga0207670_10014557 3300025936 Bacteria 4674
364 Ga0207670_10079787 3300025936 Bacteria 2286
365 Ga0207670_10108480 3300025936 Bacteria 1996
366 Ga0207670_10245445 3300025936 Bacteria 1381
367 Ga0207670_10309284 3300025936 Bacteria 1240
368 Ga0207669_10001529 3300025937 Bacteria 9860
369 Ga0207669_10307745 3300025937 Bacteria 1207
370 Ga0207704_10016569 3300025938 Bacteria 3790
371 Ga0207704_10038855 3300025938 Bacteria 2765
372 Ga0207691_10005705 3300025940 Bacteria 12037
373 Ga0207691_10008285 3300025940 Bacteria 9981
374 Ga0207691_10025779 3300025940 Bacteria 5518
375 Ga0207691_10027241 3300025940 Bacteria 5361
376 Ga0207691_10030625 3300025940 Bacteria 5026
377 Ga0207691_10049189 3300025940 Bacteria 3863
378 Ga0207691_10070544 3300025940 Bacteria 3155
379 Ga0207691_10216928 3300025940 Bacteria 1660
380 Ga0207691_10242069 3300025940 Bacteria 1559
381 Ga0207691_10318015 3300025940 Bacteria 1335
382 Ga0207711_10126377 3300025941 Bacteria 2288
383 Ga0207711_10452056 3300025941 Bacteria 1196
384 Ga0207689_10000831 3300025942 Bacteria 29759
385 Ga0207689_10005795 3300025942 Bacteria 10963
386 Ga0207689_10210793 3300025942 Bacteria 1605
387 Ga0207689_10395547 3300025942 Bacteria 1152
388 Ga0207689_10559836 3300025942 Bacteria 960
389 Ga0207661_10020477 3300025944 Bacteria 4945
390 Ga0207679_10026524 3300025945 Bacteria 3996
391 Ga0207679_10366979 3300025945 Bacteria 1259
392 Ga0207651_10015409 3300025960 Bacteria 4441
393 Ga0207651_10061581 3300025960 Bacteria 2611
394 Ga0207651_10118570 3300025960 Bacteria 2002
395 Ga0207651_10135856 3300025960 Bacteria 1891
396 Ga0207651_10217778 3300025960 Bacteria 1541
397 Ga0207651_10323620 3300025960 Bacteria 1289
398 Ga0207712_10002418 3300025961 Bacteria 12069
399 Ga0207712_10029712 3300025961 Bacteria 3669
400 Ga0207668_10050926 3300025972 Bacteria 2857
401 Ga0207668_10063916 3300025972 Bacteria 2599
402 Ga0207668_10294346 3300025972 Bacteria 1337
403 Ga0207640_10125688 3300025981 Bacteria 1846
404 Ga0207658_10281318 3300025986 Bacteria 1426
405 Ga0207677_10056451 3300026023 Bacteria 2691
406 Ga0207677_10074628 3300026023 Bacteria 2407
407 Ga0207677_10277135 3300026023 Bacteria 1375
408 Ga0207703_10033664 3300026035 Bacteria 4064
409 Ga0207703_10086035 3300026035 Bacteria 2632
410 Ga0207703_10103101 3300026035 Bacteria 2421
411 Ga0207639_10142279 3300026041 Bacteria 2000
412 Ga0207708_10003991 3300026075 Bacteria 10861
413 Ga0207708_10070416 3300026075 Bacteria 2678
414 Ga0207708_10089859 3300026075 Bacteria 2367
415 Ga0207708_10111947 3300026075 Bacteria 2120
416 Ga0207708_10198955 3300026075 Bacteria 1598
417 Ga0207708_10251301 3300026075 Bacteria 1425
418 Ga0207708_10348322 3300026075 Bacteria 1215
419 Ga0207641_10042542 3300026088 Bacteria 3811
420 Ga0207641_10093039 3300026088 Bacteria 2642
421 Ga0207648_10000093 3300026089 Bacteria 84666
422 Ga0207648_10000446 3300026089 Bacteria 45706
423 Ga0207648_10048633 3300026089 Bacteria 3712
424 Ga0207648_10087655 3300026089 Bacteria 2716
425 Ga0207648_10305841 3300026089 Bacteria 1427
426 Ga0207676_10120036 3300026095 Bacteria 2215
427 Ga0207674_10043449 3300026116 Bacteria 4633
428 Ga0207674_10057586 3300026116 Bacteria 3939
429 Ga0207674_10089328 3300026116 Bacteria 3074
430 Ga0207674_10095960 3300026116 Bacteria 2951
431 Ga0207675_100001058 3300026118 Bacteria 27297
432 Ga0207675_100004015 3300026118 Bacteria 14272
433 Ga0207675_100060737 3300026118 Bacteria 3529
434 Ga0207675_100093451 3300026118 Bacteria 2829
435 Ga0207675_100323156 3300026118 Bacteria 1507
436 Ga0207683_10021244 3300026121 Bacteria 5554
437 Ga0207683_10038673 3300026121 Bacteria 4160
438 Ga0207683_10045261 3300026121 Bacteria 3848
439 Ga0207683_10059137 3300026121 Bacteria 3366
440 Ga0207683_10093639 3300026121 Bacteria 2677
441 Ga0207683_10112388 3300026121 Bacteria 2439
442 Ga0207428_10000224 3300027907 Bacteria 78533
443 Ga0207428_10000353 3300027907 Bacteria 59325
444 Ga0207428_10002217 3300027907 Bacteria 19496
445 Ga0207428_10004706 3300027907 Bacteria 12908
446 Ga0207428_10069176 3300027907 Bacteria 2776
447 Ga0268266_10211239 3300028379 Bacteria 1780
448 Ga0268266_10336344 3300028379 Bacteria 1416
449 Ga0268266_10471370 3300028379 Bacteria 1196
450 Ga0268265_10000540 3300028380 Bacteria 38471
451 Ga0268265_10058496 3300028380 Bacteria 2944
452 Ga0268265_10062280 3300028380 Bacteria 2866
453 Ga0268265_10066118 3300028380 Bacteria 2793
454 Ga0268265_10196089 3300028380 Bacteria 1748
455 Ga0268264_10036528 3300028381 Bacteria 4048
456 Ga0268264_10071496 3300028381 Bacteria 2940
457 Ga0268264_10088574 3300028381 Bacteria 2664
458 Ga0265314_10084420 3300031711 Bacteria 2085
459 Ga0307405_10036021 3300031731 Bacteria 2961
460 Ga0307410_10009560 3300031852 Bacteria 5445
461 Ga0307407_10042811 3300031903 Bacteria 2542
462 Ga0307412_10010531 3300031911 Bacteria 5326
463 Ga0307409_100011842 3300031995 Bacteria 5524
464 Ga0307409_100670149 3300031995 Bacteria 1033
465 Ga0307416_100004482 3300032002 Bacteria 8423
466 Ga0307414_10044810 3300032004 Bacteria 3025
467 Ga0307411_10016639 3300032005 Bacteria 4166
468 Ga0307415_100053170 3300032126 Bacteria 2758
469 Ga0373928_0020210 3300035084 Bacteria 1395
470 Ga0373923_0040693 3300035111 Bacteria 1914
471 Ga0373953_0148642 3300035117 Bacteria 1004
472 Ga0373957_0135763 3300035120 Bacteria 1004
473 Ga0373943_0003682 3300035170 Bacteria 6969
474 Ga0373946_0009173 3300035171 Bacteria 3641
475 Ga0373955_0004579 3300035172 Bacteria 6129
476 Ga0373961_0006165 3300035241 Bacteria 2881
477 Ga0373924_0003631 3300035410 Bacteria 5322
478 Ga0373931_0022676 3300035691 Bacteria 3162
479 Ga0373935_0178182 3300035692 Bacteria 1458
480 Ga0373927_0371273 3300035695 Bacteria 943
481 Ga0373925_0148733 3300037068 Bacteria 1837
482 Ga0373925_0171535 3300037068 Bacteria 1713
483 Ga0373925_0219320 3300037068 Unclassified 1518
484 Ga0395900_0394320 3300037418 Bacteria 1350
485 Ga0451853_1517139 3300041512 Bacteria 3345
486 Ga0439441_015397 3300042001 Bacteria 1352
487 Ga0439446_0057618 3300042156 Bacteria 1170
488 Ga0439435_0060464 3300042436 Bacteria 1103
489 Ga0450916_000840 3300042530 Bacteria 2881
490 Ga0451577_0071562 3300042876 Bacteria 3092
491 Ga0451577_0125389 3300042876 Bacteria 2301
492 Ga0451577_0363512 3300042876 Unclassified 1313
493 Ga0453684_0059299 3300044712 Bacteria 4936
494 Ga0453684_0114534 3300044712 Bacteria 3268
495 Ga0451576_0013731 3300045051 Bacteria 9047
496 Ga0451576_0021675 3300045051 Bacteria 6980
497 Ga0451576_0052019 3300045051 Bacteria 4292
498 Ga0451576_0177479 3300045051 Bacteria 2224
499 Ga0451576_0717339 3300045051 Bacteria 1050
500 Ga0495580_0118487 3300046472 Bacteria 1838
501 Ga0495608_0003468 3300046511 Bacteria 11288
502 Ga0495628_0138285 3300046516 Bacteria 1860
503 Ga0495630_0016655 3300046517 Bacteria 5375
504 Ga0495663_0059105 3300046525 Bacteria 1202
505 Ga0495652_0164291 3300046529 Bacteria 1720
506 Ga0495587_0039508 3300046536 Bacteria 2823
507 Ga0495598_0016109 3300046537 Bacteria 1901
508 Ga0495621_0000539 3300046539 Bacteria 9397
509 Ga0495621_0012526 3300046539 Bacteria 2645
510 Ga0495633_0045317 3300046558 Bacteria 2083
511 Ga0495656_0033659 3300046615 Bacteria 2093
512 Ga0495656_0109244 3300046615 Bacteria 1291
513 Ga0495659_0016434 3300046664 Bacteria 2441
514 Ga0495659_0020455 3300046664 Bacteria 2223
515 Ga0495659_0035277 3300046664 Bacteria 1762
516 Ga0495647_0111633 3300046681 Bacteria 1142
517 Ga0495658_0059852 3300046683 Bacteria 2183
518 Ga0495658_0117678 3300046683 Bacteria 1604
519 Ga0495669_0001215 3300046684 Bacteria 10716
520 Ga0495669_0074664 3300046684 Bacteria 1550
521 Ga0495613_0003695 3300046689 Bacteria 11476
522 Ga0495604_0062959 3300047317 Bacteria 2832
523 Ga0495636_0072670 3300047318 Bacteria 1470
524 Ga0495674_0009481 3300047319 Bacteria 9249
525 Ga0495674_0179328 3300047319 Bacteria 1765
526 Ga0495677_0071882 3300047445 Bacteria 1290
527 Ga0495684_0000601 3300047471 Bacteria 28931
528 Ga0496104_0074080 3300048907 Bacteria 3241
529 Ga0496109_0055599 3300048912 Bacteria 3611
530 Ga0496113_0037187 3300048916 Bacteria 3570
531 Ga0501039_0074972 3300049575 Bacteria 2630
532 Ga0501039_0093895 3300049575 Bacteria 2338
533 Ga0501040_0033029 3300049576 Bacteria 3504
534 Ga0501041_0092802 3300049577 Bacteria 1864
535 Ga0501042_0003889 3300049578 Bacteria 9445
536 Ga0501042_0236178 3300049578 Bacteria 1319
537 Ga0501042_0342725 3300049578 Bacteria 1080
538 Ga0501046_0075810 3300049580 Bacteria 2607
539 Ga0501046_0348896 3300049580 Bacteria 1075
540 Ga0501071_0158449 3300049587 Bacteria 1691
541 Ga0501074_0330732 3300049590 Bacteria 1082
542 Ga0501075_0310479 3300049591 Bacteria 1202
543 Ga0501076_0190632 3300049592 Bacteria 1673
544 Ga0501077_0051690 3300049593 Bacteria 2611
545 Ga0501077_0132067 3300049593 Bacteria 1583
546 Ga0501079_0262337 3300049741 Bacteria 1350
547 Ga0501045_0089081 3300049824 Bacteria 2279
548 nmdc:mga05p37_136169_c1 3300050507 Bacteria 3012
549 nmdc:mga05p37_17011_c1 3300050507 Bacteria 8770
550 nmdc:mga05p37_282105_c1 3300050507 Bacteria 1981
551 nmdc:mga05p37_28799_c1 3300050507 Bacteria 6776
552 nmdc:mga05p37_35576_c1 3300050507 Bacteria 3243
553 nmdc:mga05p37_358361_c1 3300050507 Bacteria 1715
554 nmdc:mga05p37_429140_c1 3300050507 Bacteria 1536
555 nmdc:mga05p37_84584_c1 3300050507 Bacteria 3908
556 nmdc:mga05p37_92576_c1 3300050507 Bacteria 3725
557 nmdc:mga09592_106396_c1 3300050508 Bacteria 2406
558 nmdc:mga09592_135869_c1 3300050508 Bacteria 2118
559 nmdc:mga09592_164039_c1 3300050508 Bacteria 1920
560 nmdc:mga09592_18887_c1 3300050508 Bacteria 5655
561 nmdc:mga09592_274532_c1 3300050508 Bacteria 1462
562 nmdc:mga09592_316135_c1 3300050508 Bacteria 1353
563 nmdc:mga09592_393425_c1 3300050508 Bacteria 1198
564 nmdc:mga0qj67_4306_c2 3300050509 Bacteria 8212
565 nmdc:mga0qj67_66977_c1 3300050509 Bacteria 2861
566 nmdc:mga0qj67_93568_c1 3300050509 Bacteria 2417
567 nmdc:mga06r32_206675_c1 3300050510 Bacteria 1952
568 nmdc:mga06r32_209770_c1 3300050510 Bacteria 1936
569 nmdc:mga08y16_12914_c1 3300050511 Bacteria 8786
570 nmdc:mga08y16_15575_c1 3300050511 Bacteria 7995
571 nmdc:mga08y16_273023_c1 3300050511 Bacteria 1745
572 nmdc:mga08y16_32226_c1 3300050511 Bacteria 5511
573 nmdc:mga08y16_375226_c1 3300050511 Bacteria 1458
574 nmdc:mga08y16_40195_c1 3300050511 Bacteria 4903
575 nmdc:mga08y16_48255_c1 3300050511 Bacteria 4456
576 nmdc:mga08y16_50424_c1 3300050511 Bacteria 4355
577 nmdc:mga08y16_5828_c1 3300050511 Bacteria 12911
578 nmdc:mga08y16_945_c1 3300050511 Bacteria 28237
579 nmdc:mga0n895_10821_c1 3300050512 Bacteria 8096
580 nmdc:mga0n895_27620_c1 3300050512 Bacteria 5394
581 nmdc:mga0n895_39130_c1 3300050512 Bacteria 4599
582 nmdc:mga0n895_4485_c1 3300050512 Bacteria 11475
583 nmdc:mga0n895_467810_c1 3300050512 Bacteria 1272
584 nmdc:mga0n895_6752_c1 3300050512 Bacteria 9788
585 nmdc:mga0n895_802454_c1 3300050512 Bacteria 932
586 nmdc:mga0n895_81489_c1 3300050512 Bacteria 3225
587 nmdc:mga0n895_86092_c1 3300050512 Bacteria 3139
588 nmdc:mga0n895_98386_c1 3300050512 Bacteria 2932
589 nmdc:mga0rr50_108527_c1 3300050513 Bacteria 2193
590 nmdc:mga0rr50_119416_c1 3300050513 Bacteria 2096
591 nmdc:mga0rr50_190578_c1 3300050513 Bacteria 1680
592 nmdc:mga0rr50_21346_c1 3300050513 Bacteria 4419
593 nmdc:mga08x19_123848_c1 3300050514 Bacteria 1735
594 nmdc:mga0a205_129737_c1 3300050515 Bacteria 2422
595 nmdc:mga0a205_1497_c1 3300050515 Bacteria 19917
596 nmdc:mga0a205_210015_c1 3300050515 Bacteria 1835
597 nmdc:mga0a205_220729_c1 3300050515 Bacteria 1781
598 nmdc:mga0a205_44250_c1 3300050515 Bacteria 4291
599 nmdc:mga0a205_4601_c1 3300050515 Bacteria 12370
600 nmdc:mga0a205_71273_c1 3300050515 Bacteria 3356
601 nmdc:mga0a205_808_c1 3300050515 Bacteria 25457
602 Ga0495601_0055214 3300053077 Bacteria 2514
603 Ga0495601_0105419 3300053077 Bacteria 1823
604 Ga0495619_0000386 3300053085 Bacteria 30136
605 Ga0495619_0078744 3300053085 Bacteria 2216
606 Ga0501082_0006994 3300060353 Bacteria 9740
607 Ga0530510_0004934 3300061734 Bacteria 9214
608 Ga0316577_10001199
609 SwRhRL2b_contig_3495822
610 SwRhRL2b_contig_757619
611 JGI24746J21847_1005383
612 JGI25406J46586_10000188
613 Ga0065714_10108694
614 Ga0065704_10242024
615 Ga0065712_10071830
616 Ga0065712_10093172
617 Ga0065712_10097785
618 Ga0065715_10009149
619 Ga0065715_10150770
620 Ga0065715_10198750
621 Ga0065707_10006880
622 Ga0065707_10095648
623 Ga0070658_10283380
624 Ga0070676_10018577
625 Ga0070676_10023781
626 Ga0070676_10046293
627 Ga0070683_100201078
628 Ga0070683_100440231
629 Ga0070690_100026105
630 Ga0070690_100033795
631 Ga0070690_100224517
632 Ga0070670_100002877
633 Ga0070670_100008188
634 Ga0070670_100039805
635 Ga0070670_100077047
636 Ga0070677_10021822
637 Ga0070677_10044875
638 Ga0068869_100003236
639 Ga0068869_100005463
640 Ga0070666_10115833
641 Ga0070680_100065511
642 Ga0070680_100323441
643 Ga0068868_100008101
644 Ga0068868_100202796
645 Ga0068868_100366735
646 Ga0070689_100014552
647 Ga0070689_100051308
648 Ga0070689_100062586
649 Ga0070689_100134546
650 Ga0070687_100013368
651 Ga0070687_100016036
652 Ga0070661_100037274
653 Ga0070661_100114605
654 Ga0070661_100215027
655 Ga0070692_10064233
656 Ga0070669_100002727
657 Ga0070669_100026198
658 Ga0070669_100075890
659 Ga0070669_100157077
660 Ga0070669_100164344
661 Ga0070675_100000537
662 Ga0070675_100003145
663 Ga0070675_100005576
664 Ga0070675_100027847
665 Ga0070675_100083050
666 Ga0070675_100118918
667 Ga0070675_100212814
668 Ga0070671_100029642
669 Ga0070671_100544321
670 Ga0070674_100001500
671 Ga0070674_100202005
672 Ga0070673_100011067
673 Ga0070673_100152749
674 Ga0070673_100173764
675 Ga0070673_100174804
676 Ga0070673_100178630
677 Ga0070673_100273664
678 Ga0070673_100330612
679 Ga0070688_100009604
680 Ga0070688_100056574
681 Ga0070688_100099110
682 Ga0070688_100157964
683 Ga0070659_100064075
684 Ga0070659_100146248
685 Ga0070667_100010567
686 Ga0070667_100484271
687 Ga0070701_10002485
688 Ga0070701_10021663
689 Ga0070705_100135440
690 Ga0070700_100015111
691 Ga0070700_100018991
692 Ga0070700_100094208
693 Ga0070700_100409431
694 Ga0070694_100300369
695 Ga0070678_100039934
696 Ga0070678_100142803
697 Ga0070678_100165541
698 Ga0070678_100168194
699 Ga0070678_100177709
700 Ga0070662_100085345
701 Ga0070662_100306350
702 Ga0070681_10025905
703 Ga0068867_100000147
704 Ga0068867_100003422
705 Ga0068867_100071966
706 Ga0068867_100089238
707 Ga0068867_100186096
708 Ga0070685_10017893
709 Ga0070685_10143686
710 Ga0070685_10180385
711 Ga0070707_100228446
712 Ga0070707_100283272
713 Ga0070698_100022784
714 Ga0070698_100049505
715 Ga0070698_100059186
716 Ga0070698_100420067
717 Ga0070699_100000339
718 Ga0070699_100024512
719 Ga0070699_100192061
720 Ga0070699_100214118
721 Ga0070699_100275613
722 Ga0070679_100054537
723 Ga0070697_100204128
724 Ga0070697_100269293
725 Ga0070672_100003678
726 Ga0070672_100020041
727 Ga0070672_100074274
728 Ga0070672_100097480
729 Ga0070686_100074620
730 Ga0070686_100104497
731 Ga0070695_100231791
732 Ga0070696_100062338
733 Ga0070696_100125184
734 Ga0070665_100012196
735 Ga0070665_100031333
736 Ga0070704_100028361
737 Ga0070704_100059667
738 Ga0070704_100116285
739 Ga0070664_100010031
740 Ga0070664_100011751
741 Ga0070664_100027774
742 Ga0070664_100130213
743 Ga0070664_100160666
744 Ga0068857_100033732
745 Ga0068857_100078821
746 Ga0068857_100181226
747 Ga0068857_100256147
748 Ga0068854_100055078
749 Ga0070702_100022601
750 Ga0068859_100002533
751 Ga0068859_100044995
752 Ga0068859_100046545
753 Ga0068859_100068989
754 Ga0068859_100080631
755 Ga0068859_100101945
756 Ga0068859_100258832
757 Ga0068864_100112652
758 Ga0068864_100223612
759 Ga0068866_10004135
760 Ga0068861_100001293
761 Ga0068861_100035291
762 Ga0068861_100060837
763 Ga0068861_100120742
764 Ga0068861_100288460
765 Ga0068870_10008632
766 Ga0068870_10033511
767 Ga0068870_10062119
768 Ga0068870_10131221
769 Ga0068863_100133676
770 Ga0068858_100066511
771 Ga0068858_100185150
772 Ga0068860_100082640
773 Ga0068860_100086446
774 Ga0068862_100001293
775 Ga0068862_100466306
776 Ga0081539_10000013
777 Ga0081539_10013539
778 Ga0070716_100262996
779 Ga0097621_100092943
780 Ga0097621_100190319
781 Ga0097621_100191446
782 Ga0068871_100167506
783 Ga0075428_100000869
784 Ga0075428_100008219
785 Ga0075428_100051934
786 Ga0075428_100119341
787 Ga0075428_100760395
788 Ga0075430_100022848
789 Ga0075430_100040989
790 Ga0075430_100492171
791 Ga0075431_100049128
792 Ga0075431_100090962
793 Ga0075431_100204632
794 Ga0075431_100329722
795 Ga0075433_10002009
796 Ga0075433_10013571
797 Ga0075433_10184104
798 Ga0075433_10202027
799 Ga0075433_10493710
800 Ga0075434_100005716
801 Ga0075434_100008044
802 Ga0075434_100008828
803 Ga0075434_100038568
804 Ga0075434_100078720
805 Ga0075434_100109915
806 Ga0075434_100255165
807 Ga0075429_100052468
808 Ga0075429_100079071
809 Ga0075429_100091302
810 Ga0075429_100096904
811 Ga0075429_100196292
812 Ga0075429_100393126
813 Ga0075429_100463729
814 Ga0068865_100005178
815 Ga0068865_100017474
816 Ga0068865_100077390
817 Ga0068865_100112314
818 Ga0068865_100241631
819 Ga0075436_100125073
820 Ga0097620_100002533
821 Ga0097620_100044994
822 Ga0097620_100046547
823 Ga0097620_100068989
824 Ga0097620_100080627
825 Ga0097620_100101943
826 Ga0097620_100258834
827 Ga0075435_100005714
828 Ga0075435_100010574
829 Ga0075435_100050563
830 Ga0075435_100065813
831 Ga0075435_100158714
832 Ga0111539_10000044
833 Ga0111539_10000769
834 Ga0111539_10001774
835 Ga0111539_10022455
836 Ga0111539_10055455
837 Ga0111539_10100266
838 Ga0111539_10242372
839 Ga0111539_10266868
840 Ga0111539_10324706
841 Ga0105245_10008629
842 Ga0105245_10459839
843 Ga0114129_10003198
844 Ga0114129_10003276
845 Ga0114129_10006054
846 Ga0114129_10009872
847 Ga0114129_10029480
848 Ga0114129_10096834
849 Ga0114129_10132600
850 Ga0114129_10160493
851 Ga0114129_10176742
852 Ga0114129_10846750
853 Ga0114129_11101553
854 Ga0105243_10008157
855 Ga0105241_10568125
856 Ga0105242_10002921
857 Ga0105242_10290514
858 Ga0105242_10476981
859 Ga0105248_10241039
860 Ga0105248_10647238
861 Ga0105238_10043505
862 Ga0105249_10001334
863 Ga0105249_10043919
864 Ga0105249_10087301
865 Ga0105246_10021871
866 Ga0105246_10028237
867 Ga0157371_10043810
868 Ga0157374_10215050
869 Ga0157374_10264284
870 Ga0157378_10099238
871 Ga0157378_10216219
872 Ga0163162_10033186
873 Ga0163162_10168863
874 Ga0163162_10182938
875 Ga0157375_10018181
876 Ga0157375_10033798
877 Ga0157375_10062458
878 Ga0157375_10164865
879 Ga0157375_10209089
880 Ga0157375_10301418
881 Ga0157375_10348737
882 Ga0163163_10074895
883 Ga0163163_10140451
884 Ga0163163_10842994
885 Ga0157380_10003886
886 Ga0157380_10007439
887 Ga0157380_10073267
888 Ga0157380_10158137
889 Ga0157380_10274561
890 Ga0157380_10278188
891 Ga0157380_10536658
892 Ga0157377_10002991
893 Ga0157377_10015219
894 Ga0157377_10093693
895 Ga0157379_10003739
896 Ga0157379_10328573
897 Ga0157376_10052484
898 Ga0157376_10057545
899 Ga0157376_10225378
900 Ga0157376_10234502
901 Ga0157376_10251963
902 Ga0163161_10023461
903 Ga0163161_10042869
904 Ga0207697_10001514
905 Ga0207697_10068491
906 Ga0207697_10091137
907 Ga0207682_10001841
908 Ga0207682_10003394
909 Ga0207682_10014594
910 Ga0207682_10042777
911 Ga0207682_10148890
912 Ga0207642_10016929
913 Ga0207642_10194784
914 Ga0207688_10001443
915 Ga0207680_10105873
916 Ga0207647_10098223
917 Ga0207699_10037961
918 Ga0207645_10001881
919 Ga0207645_10016937
920 Ga0207645_10027133
921 Ga0207645_10043765
922 Ga0207643_10005281
923 Ga0207643_10005748
924 Ga0207643_10015261
925 Ga0207643_10020319
926 Ga0207643_10027240
927 Ga0207643_10039643
928 Ga0207705_10482681
929 Ga0207684_10568773
930 Ga0207660_10280256
931 Ga0207662_10002054
932 Ga0207662_10020005
933 Ga0207649_10088325
934 Ga0207652_10085534
935 Ga0207646_10247413
936 Ga0207646_10332477
937 Ga0207681_10000566
938 Ga0207681_10020352
939 Ga0207681_10030926
940 Ga0207681_10074125
941 Ga0207681_10074279
942 Ga0207681_10081612
943 Ga0207681_10146939
944 Ga0207694_10024715
945 Ga0207650_10072055
946 Ga0207650_10083205
947 Ga0207650_10211843
948 Ga0207659_10001222
949 Ga0207659_10002242
950 Ga0207659_10002762
951 Ga0207659_10007569
952 Ga0207659_10014600
953 Ga0207659_10018603
954 Ga0207659_10027625
955 Ga0207659_10029682
956 Ga0207659_10147555
957 Ga0207659_10163944
958 Ga0207659_10231190
959 Ga0207659_10293757
960 Ga0207659_10353734
961 Ga0207687_10014295
962 Ga0207690_10199165
963 Ga0207706_10003425
964 Ga0207706_10105521
965 Ga0207706_10218302
966 Ga0207706_10292309
967 Ga0207686_10006753
968 Ga0207686_10034387
969 Ga0207709_10003920
970 Ga0207670_10014557
971 Ga0207670_10079787
972 Ga0207670_10108480
973 Ga0207670_10245445
974 Ga0207670_10309284
975 Ga0207669_10001529
976 Ga0207669_10307745
977 Ga0207704_10016569
978 Ga0207704_10038855
979 Ga0207691_10005705
980 Ga0207691_10008285
981 Ga0207691_10025779
982 Ga0207691_10027241
983 Ga0207691_10030625
984 Ga0207691_10049189
985 Ga0207691_10070544
986 Ga0207691_10216928
987 Ga0207691_10242069
988 Ga0207691_10318015
989 Ga0207711_10126377
990 Ga0207711_10452056
991 Ga0207689_10000831
992 Ga0207689_10005795
993 Ga0207689_10210793
994 Ga0207689_10395547
995 Ga0207689_10559836
996 Ga0207661_10020477
997 Ga0207679_10026524
998 Ga0207679_10366979
999 Ga0207651_10015409
1000 Ga0207651_10061581
1001 Ga0207651_10118570
1002 Ga0207651_10135856
1003 Ga0207651_10217778
1004 Ga0207651_10323620
1005 Ga0207712_10002418
1006 Ga0207712_10029712
1007 Ga0207668_10050926
1008 Ga0207668_10063916
1009 Ga0207668_10294346
1010 Ga0207640_10125688
1011 Ga0207658_10281318
1012 Ga0207677_10056451
1013 Ga0207677_10074628
1014 Ga0207677_10277135
1015 Ga0207703_10033664
1016 Ga0207703_10086035
1017 Ga0207703_10103101
1018 Ga0207639_10142279
1019 Ga0207708_10003991
1020 Ga0207708_10070416
1021 Ga0207708_10089859
1022 Ga0207708_10111947
1023 Ga0207708_10198955
1024 Ga0207708_10251301
1025 Ga0207708_10348322
1026 Ga0207641_10042542
1027 Ga0207641_10093039
1028 Ga0207648_10000093
1029 Ga0207648_10000446
1030 Ga0207648_10048633
1031 Ga0207648_10087655
1032 Ga0207648_10305841
1033 Ga0207676_10120036
1034 Ga0207674_10043449
1035 Ga0207674_10057586
1036 Ga0207674_10089328
1037 Ga0207674_10095960
1038 Ga0207675_100001058
1039 Ga0207675_100004015
1040 Ga0207675_100060737
1041 Ga0207675_100093451
1042 Ga0207675_100323156
1043 Ga0207683_10021244
1044 Ga0207683_10038673
1045 Ga0207683_10045261
1046 Ga0207683_10059137
1047 Ga0207683_10093639
1048 Ga0207683_10112388
1049 Ga0207428_10000224
1050 Ga0207428_10000353
1051 Ga0207428_10002217
1052 Ga0207428_10004706
1053 Ga0207428_10069176
1054 Ga0268266_10211239
1055 Ga0268266_10336344
1056 Ga0268266_10471370
1057 Ga0268265_10000540
1058 Ga0268265_10058496
1059 Ga0268265_10062280
1060 Ga0268265_10066118
1061 Ga0268265_10196089
1062 Ga0268264_10036528
1063 Ga0268264_10071496
1064 Ga0268264_10088574
1065 Ga0265314_10084420
1066 Ga0307405_10036021
1067 Ga0307410_10009560
1068 Ga0307407_10042811
1069 Ga0307412_10010531
1070 Ga0307409_100011842
1071 Ga0307409_100670149
1072 Ga0307416_100004482
1073 Ga0307414_10044810
1074 Ga0307411_10016639
1075 Ga0307415_100053170
1076 Ga0373928_0020210
1077 Ga0373923_0040693
1078 Ga0373953_0148642
1079 Ga0373957_0135763
1080 Ga0373943_0003682
1081 Ga0373946_0009173
1082 Ga0373955_0004579
1083 Ga0373961_0006165
1084 Ga0373924_0003631
1085 Ga0373931_0022676
1086 Ga0373935_0178182
1087 Ga0373927_0371273
1088 Ga0373925_0148733
1089 Ga0373925_0171535
1090 Ga0373925_0219320
1091 Ga0395900_0394320
1092 Ga0451853_1517139
1093 Ga0439441_015397
1094 Ga0439446_0057618
1095 Ga0439435_0060464
1096 Ga0450916_000840
1097 Ga0451577_0071562
1098 Ga0451577_0125389
1099 Ga0451577_0363512
1100 Ga0453684_0059299
1101 Ga0453684_0114534
1102 Ga0451576_0013731
1103 Ga0451576_0021675
1104 Ga0451576_0052019
1105 Ga0451576_0177479
1106 Ga0451576_0717339
1107 Ga0495580_0118487
1108 Ga0495608_0003468
1109 Ga0495628_0138285
1110 Ga0495630_0016655
1111 Ga0495663_0059105
1112 Ga0495652_0164291
1113 Ga0495587_0039508
1114 Ga0495598_0016109
1115 Ga0495621_0000539
1116 Ga0495621_0012526
1117 Ga0495633_0045317
1118 Ga0495656_0033659
1119 Ga0495656_0109244
1120 Ga0495659_0016434
1121 Ga0495659_0020455
1122 Ga0495659_0035277
1123 Ga0495647_0111633
1124 Ga0495658_0059852
1125 Ga0495658_0117678
1126 Ga0495669_0001215
1127 Ga0495669_0074664
1128 Ga0495613_0003695
1129 Ga0495604_0062959
1130 Ga0495636_0072670
1131 Ga0495674_0009481
1132 Ga0495674_0179328
1133 Ga0495677_0071882
1134 Ga0495684_0000601
1135 Ga0496104_0074080
1136 Ga0496109_0055599
1137 Ga0496113_0037187
1138 Ga0501039_0074972
1139 Ga0501039_0093895
1140 Ga0501040_0033029
1141 Ga0501041_0092802
1142 Ga0501042_0003889
1143 Ga0501042_0236178
1144 Ga0501042_0342725
1145 Ga0501046_0075810
1146 Ga0501046_0348896
1147 Ga0501071_0158449
1148 Ga0501074_0330732
1149 Ga0501075_0310479
1150 Ga0501076_0190632
1151 Ga0501077_0051690
1152 Ga0501077_0132067
1153 Ga0501079_0262337
1154 Ga0501045_0089081
1155 nmdc:mga05p37_136169_c1
1156 nmdc:mga05p37_17011_c1
1157 nmdc:mga05p37_282105_c1
1158 nmdc:mga05p37_28799_c1
1159 nmdc:mga05p37_35576_c1
1160 nmdc:mga05p37_358361_c1
1161 nmdc:mga05p37_429140_c1
1162 nmdc:mga05p37_84584_c1
1163 nmdc:mga05p37_92576_c1
1164 nmdc:mga09592_106396_c1
1165 nmdc:mga09592_135869_c1
1166 nmdc:mga09592_164039_c1
1167 nmdc:mga09592_18887_c1
1168 nmdc:mga09592_274532_c1
1169 nmdc:mga09592_316135_c1
1170 nmdc:mga09592_393425_c1
1171 nmdc:mga0qj67_4306_c2
1172 nmdc:mga0qj67_66977_c1
1173 nmdc:mga0qj67_93568_c1
1174 nmdc:mga06r32_206675_c1
1175 nmdc:mga06r32_209770_c1
1176 nmdc:mga08y16_12914_c1
1177 nmdc:mga08y16_15575_c1
1178 nmdc:mga08y16_273023_c1
1179 nmdc:mga08y16_32226_c1
1180 nmdc:mga08y16_375226_c1
1181 nmdc:mga08y16_40195_c1
1182 nmdc:mga08y16_48255_c1
1183 nmdc:mga08y16_50424_c1
1184 nmdc:mga08y16_5828_c1
1185 nmdc:mga08y16_945_c1
1186 nmdc:mga0n895_10821_c1
1187 nmdc:mga0n895_27620_c1
1188 nmdc:mga0n895_39130_c1
1189 nmdc:mga0n895_4485_c1
1190 nmdc:mga0n895_467810_c1
1191 nmdc:mga0n895_6752_c1
1192 nmdc:mga0n895_802454_c1
1193 nmdc:mga0n895_81489_c1
1194 nmdc:mga0n895_86092_c1
1195 nmdc:mga0n895_98386_c1
1196 nmdc:mga0rr50_108527_c1
1197 nmdc:mga0rr50_119416_c1
1198 nmdc:mga0rr50_190578_c1
1199 nmdc:mga0rr50_21346_c1
1200 nmdc:mga08x19_123848_c1
1201 nmdc:mga0a205_129737_c1
1202 nmdc:mga0a205_1497_c1
1203 nmdc:mga0a205_210015_c1
1204 nmdc:mga0a205_220729_c1
1205 nmdc:mga0a205_44250_c1
1206 nmdc:mga0a205_4601_c1
1207 nmdc:mga0a205_71273_c1
1208 nmdc:mga0a205_808_c1
1209 Ga0495601_0055214
1210 Ga0495601_0105419
1211 Ga0495619_0000386
1212 Ga0495619_0078744
1213 Ga0501082_0006994
1214 Ga0530510_0004934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

8

257

0.98

PF00149

Metallophos

Calcineurin-like phosphoesterase

5

183

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.902 1 261
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.8858 1 261
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.8755 1 258
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.8668 1 258
1t71-assembly1.cif.gz_A crystal structure of a novel phosphatase mycoplasma pneumoniaefrom 0.8605 1 258
ID Description Score Start End Superfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.902 1 261 3.60.21.10
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8858 1 261 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8605 1 258 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8563 1 258 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8467 1 258 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A383ALH3-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 1.002 1 79 GO:0004113
AF-A0A3B0PD68-F1-model_v4 Metallophosphoesterase YmdB 0.9972 1 70 GO:0004113
AF-A0A2V6E159-F1-model_v4 Metallophosphoesterase 0.996 1 102 GO:0004113
AF-A0A538H8X2-F1-model_v4 YmdB family metallophosphoesterase 0.9951 1 99 GO:0004113
AF-A0A7Y2JDI4-F1-model_v4 Metallophosphoesterase 0.9942 1 61 GO:0004113

Map