F468700
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 607 | 332 | 607 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300031090|Ga0265760_10038395|Ga0265760_100383952 |
| Length | 266 |
| Sequence | MIEIGNAGTLACIPPSKGVESPQAHARWRELSGEDIMAKYLLVSFKTCPWVQRAAIVLREKNIDFEFRHIEPDNRPDWFLAISPHKKVPVLRVDDKVSLFESNAINEYLDETIAPRLHPDDPVLRAINRAWTDYVPTFADSVTGTAYADDEAAYKAAAAKIPVAFERLERALEKQGAGPFFNGAKYSLVDAAYAPFLQRYFFLDRIRPLGVIEKFPRLKAWADALMKRASTHSFPEAEFETLYRTNVRRRNKWVSQFIADVAVAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 100 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 187 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 323 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 324 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 326 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 327 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 1.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.29 |
| Nodule | 0 |
| Rhizoplane | 7.58 |
| Rhizosphere | 85.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10002741 | 3300003215 | Bacteria | 10031 |
| 2 | JGI25153J46596_10003269 | 3300003215 | Bacteria | 9110 |
| 3 | Ga0065707_10142897 | 3300005295 | Bacteria | 1749 |
| 4 | Ga0070683_100212096 | 3300005329 | Bacteria | 1840 |
| 5 | Ga0070683_100573869 | 3300005329 | Bacteria | 1079 |
| 6 | Ga0070680_100148352 | 3300005336 | Bacteria | 1968 |
| 7 | Ga0070682_100057326 | 3300005337 | Bacteria | 2454 |
| 8 | Ga0068868_100384805 | 3300005338 | Bacteria | 1208 |
| 9 | Ga0070660_100069799 | 3300005339 | Bacteria | 2741 |
| 10 | Ga0070660_100259150 | 3300005339 | Bacteria | 1420 |
| 11 | Ga0070689_100001797 | 3300005340 | Bacteria | 13779 |
| 12 | Ga0070687_100098622 | 3300005343 | Bacteria | 1631 |
| 13 | Ga0070668_100129084 | 3300005347 | Bacteria | 2027 |
| 14 | Ga0070668_100154075 | 3300005347 | Bacteria | 1861 |
| 15 | Ga0070668_100870852 | 3300005347 | Bacteria | 804 |
| 16 | Ga0070669_100076542 | 3300005353 | Bacteria | 2484 |
| 17 | Ga0070669_100168193 | 3300005353 | Bacteria | 1708 |
| 18 | Ga0070675_100182890 | 3300005354 | Bacteria | 1813 |
| 19 | Ga0070675_100243754 | 3300005354 | Bacteria | 1571 |
| 20 | Ga0070675_100438082 | 3300005354 | Bacteria | 1171 |
| 21 | Ga0070671_100495664 | 3300005355 | Unclassified | 1050 |
| 22 | Ga0070674_100008624 | 3300005356 | Bacteria | 6076 |
| 23 | Ga0070688_100251439 | 3300005365 | Unclassified | 1259 |
| 24 | Ga0070659_100031970 | 3300005366 | Bacteria | 4079 |
| 25 | Ga0070667_100216190 | 3300005367 | Bacteria | 1705 |
| 26 | Ga0070709_10065986 | 3300005434 | Bacteria | 2319 |
| 27 | Ga0070709_10095937 | 3300005434 | Bacteria | 1965 |
| 28 | Ga0070709_10390416 | 3300005434 | Bacteria | 1037 |
| 29 | Ga0070714_100003291 | 3300005435 | Bacteria | 12042 |
| 30 | Ga0070714_100028108 | 3300005435 | Bacteria | 4662 |
| 31 | Ga0070714_100102155 | 3300005435 | Bacteria | 2527 |
| 32 | Ga0070713_100037240 | 3300005436 | Unclassified | 3932 |
| 33 | Ga0070713_100049101 | 3300005436 | Bacteria | 3479 |
| 34 | Ga0070713_100116722 | 3300005436 | Bacteria | 2334 |
| 35 | Ga0070713_100660947 | 3300005436 | Bacteria | 996 |
| 36 | Ga0070710_10001459 | 3300005437 | Bacteria | 11139 |
| 37 | Ga0070710_10081702 | 3300005437 | Bacteria | 1888 |
| 38 | Ga0070711_100014338 | 3300005439 | Bacteria | 4993 |
| 39 | Ga0070711_100055931 | 3300005439 | Bacteria | 2727 |
| 40 | Ga0070711_100569167 | 3300005439 | Bacteria | 942 |
| 41 | Ga0070663_100121491 | 3300005455 | Bacteria | 1973 |
| 42 | Ga0070678_100004761 | 3300005456 | Bacteria | 7742 |
| 43 | Ga0070678_100399280 | 3300005456 | Bacteria | 1194 |
| 44 | Ga0070681_10062094 | 3300005458 | Bacteria | 3710 |
| 45 | Ga0070681_10063112 | 3300005458 | Bacteria | 3677 |
| 46 | Ga0070681_10088384 | 3300005458 | Bacteria | 3050 |
| 47 | Ga0070681_10102719 | 3300005458 | Bacteria | 2804 |
| 48 | Ga0070681_10222380 | 3300005458 | Unclassified | 1803 |
| 49 | Ga0068867_100184693 | 3300005459 | Bacteria | 1660 |
| 50 | Ga0070685_10079735 | 3300005466 | Bacteria | 1960 |
| 51 | Ga0070685_10142607 | 3300005466 | Bacteria | 1510 |
| 52 | Ga0070706_100078060 | 3300005467 | Bacteria | 3065 |
| 53 | Ga0070706_100242459 | 3300005467 | Bacteria | 1683 |
| 54 | Ga0070706_100616988 | 3300005467 | Unclassified | 1007 |
| 55 | Ga0070707_100021284 | 3300005468 | Bacteria | 6129 |
| 56 | Ga0070698_100016820 | 3300005471 | Bacteria | 7714 |
| 57 | Ga0070698_100045574 | 3300005471 | Bacteria | 4488 |
| 58 | Ga0070698_100141303 | 3300005471 | Bacteria | 2358 |
| 59 | Ga0070698_100219444 | 3300005471 | Unclassified | 1835 |
| 60 | Ga0070699_100184265 | 3300005518 | Bacteria | 1853 |
| 61 | Ga0070679_100042019 | 3300005530 | Bacteria | 4552 |
| 62 | Ga0070679_100104320 | 3300005530 | Bacteria | 2821 |
| 63 | Ga0070679_100130602 | 3300005530 | Bacteria | 2493 |
| 64 | Ga0070697_100063371 | 3300005536 | Bacteria | 3019 |
| 65 | Ga0070697_100246573 | 3300005536 | Unclassified | 1527 |
| 66 | Ga0070672_100253996 | 3300005543 | Bacteria | 1481 |
| 67 | Ga0070672_100264560 | 3300005543 | Bacteria | 1451 |
| 68 | Ga0070672_100397726 | 3300005543 | Bacteria | 1181 |
| 69 | Ga0070686_100069280 | 3300005544 | Bacteria | 2303 |
| 70 | Ga0070686_100316159 | 3300005544 | Bacteria | 1163 |
| 71 | Ga0070695_100525161 | 3300005545 | Bacteria | 919 |
| 72 | Ga0070665_100218448 | 3300005548 | Bacteria | 1906 |
| 73 | Ga0068857_100149519 | 3300005577 | Bacteria | 2115 |
| 74 | Ga0068854_100343370 | 3300005578 | Unclassified | 1220 |
| 75 | Ga0068856_100255748 | 3300005614 | Bacteria | 1766 |
| 76 | Ga0068852_100515909 | 3300005616 | Bacteria | 1192 |
| 77 | Ga0068859_100086931 | 3300005617 | Bacteria | 3173 |
| 78 | Ga0068864_100012195 | 3300005618 | Bacteria | 7104 |
| 79 | Ga0068866_10195202 | 3300005718 | Unclassified | 1205 |
| 80 | Ga0068870_10187119 | 3300005840 | Unclassified | 1247 |
| 81 | Ga0068870_10225182 | 3300005840 | Bacteria | 1150 |
| 82 | Ga0068858_100267609 | 3300005842 | Bacteria | 1625 |
| 83 | Ga0068858_100987683 | 3300005842 | Unclassified | 825 |
| 84 | Ga0068860_100139332 | 3300005843 | Bacteria | 2331 |
| 85 | Ga0081455_10006759 | 3300005937 | Bacteria | 12238 |
| 86 | Ga0081455_10300666 | 3300005937 | Bacteria | 1151 |
| 87 | Ga0081540_1050097 | 3300005983 | Unclassified | 2077 |
| 88 | Ga0081540_1162125 | 3300005983 | Bacteria | 866 |
| 89 | Ga0070717_10027202 | 3300006028 | Unclassified | 4570 |
| 90 | Ga0070717_10060234 | 3300006028 | Bacteria | 3143 |
| 91 | Ga0070717_10250017 | 3300006028 | Bacteria | 1566 |
| 92 | Ga0070717_10846068 | 3300006028 | Unclassified | 832 |
| 93 | Ga0075365_10234337 | 3300006038 | Bacteria | 1289 |
| 94 | Ga0075365_10582862 | 3300006038 | Bacteria | 791 |
| 95 | Ga0075364_10092115 | 3300006051 | Bacteria | 2012 |
| 96 | Ga0075364_10153470 | 3300006051 | Bacteria | 1552 |
| 97 | Ga0070716_100097360 | 3300006173 | Bacteria | 1795 |
| 98 | Ga0070716_100243469 | 3300006173 | Bacteria | 1221 |
| 99 | Ga0070712_100017585 | 3300006175 | Bacteria | 4631 |
| 100 | Ga0070712_100022645 | 3300006175 | Bacteria | 4140 |
| 101 | Ga0070712_100032258 | 3300006175 | Bacteria | 3536 |
| 102 | Ga0070712_100063239 | 3300006175 | Bacteria | 2620 |
| 103 | Ga0070712_100112306 | 3300006175 | Bacteria | 2035 |
| 104 | Ga0070712_100113030 | 3300006175 | Bacteria | 2030 |
| 105 | Ga0070712_100148770 | 3300006175 | Bacteria | 1795 |
| 106 | Ga0070712_100473919 | 3300006175 | Unclassified | 1046 |
| 107 | Ga0075366_10010050 | 3300006195 | Bacteria | 5304 |
| 108 | Ga0075366_10028122 | 3300006195 | Bacteria | 3299 |
| 109 | Ga0097621_100111027 | 3300006237 | Bacteria | 2317 |
| 110 | Ga0097621_100300723 | 3300006237 | Bacteria | 1417 |
| 111 | Ga0075370_10210826 | 3300006353 | Bacteria | 1147 |
| 112 | Ga0068871_100131839 | 3300006358 | Bacteria | 2120 |
| 113 | Ga0068871_100329314 | 3300006358 | Bacteria | 1347 |
| 114 | Ga0068871_100400749 | 3300006358 | Bacteria | 1222 |
| 115 | Ga0075428_100073107 | 3300006844 | Bacteria | 3744 |
| 116 | Ga0075430_100000311 | 3300006846 | Bacteria | 34566 |
| 117 | Ga0075431_100196082 | 3300006847 | Unclassified | 2067 |
| 118 | Ga0075434_100190454 | 3300006871 | Bacteria | 2071 |
| 119 | Ga0075434_100776665 | 3300006871 | Bacteria | 975 |
| 120 | Ga0075434_101120770 | 3300006871 | Bacteria | 800 |
| 121 | Ga0075429_100257534 | 3300006880 | Bacteria | 1528 |
| 122 | Ga0068865_100183851 | 3300006881 | Bacteria | 1611 |
| 123 | Ga0068865_100423815 | 3300006881 | Bacteria | 1095 |
| 124 | Ga0075436_100115320 | 3300006914 | Bacteria | 1876 |
| 125 | Ga0097620_100086930 | 3300006931 | Bacteria | 3173 |
| 126 | Ga0075435_100165663 | 3300007076 | Bacteria | 1863 |
| 127 | Ga0075435_100579291 | 3300007076 | Bacteria | 973 |
| 128 | Ga0099795_10148462 | 3300007788 | Bacteria | 958 |
| 129 | Ga0105251_10113130 | 3300009011 | Bacteria | 1236 |
| 130 | Ga0105240_10096152 | 3300009093 | Bacteria | 3610 |
| 131 | Ga0111539_10370439 | 3300009094 | Bacteria | 1667 |
| 132 | Ga0111539_10725908 | 3300009094 | Bacteria | 1157 |
| 133 | Ga0111539_10866943 | 3300009094 | Bacteria | 1050 |
| 134 | Ga0111539_10979917 | 3300009094 | Bacteria | 983 |
| 135 | Ga0105247_10045669 | 3300009101 | Bacteria | 2688 |
| 136 | Ga0114129_10219641 | 3300009147 | Bacteria | 2564 |
| 137 | Ga0114129_10351990 | 3300009147 | Bacteria | 1951 |
| 138 | Ga0114129_10935511 | 3300009147 | Bacteria | 1096 |
| 139 | Ga0105243_10048514 | 3300009148 | Bacteria | 3347 |
| 140 | Ga0105243_11012657 | 3300009148 | Bacteria | 834 |
| 141 | Ga0105243_11358179 | 3300009148 | Bacteria | 730 |
| 142 | Ga0105241_10266721 | 3300009174 | Bacteria | 1457 |
| 143 | Ga0105242_10576158 | 3300009176 | Unclassified | 1083 |
| 144 | Ga0105248_11239949 | 3300009177 | Bacteria | 843 |
| 145 | Ga0105238_10368154 | 3300009551 | Bacteria | 1427 |
| 146 | Ga0105249_10076826 | 3300009553 | Bacteria | 3096 |
| 147 | Ga0105249_10155222 | 3300009553 | Bacteria | 2207 |
| 148 | Ga0099796_10032463 | 3300010159 | Bacteria | 1711 |
| 149 | Ga0099796_10033213 | 3300010159 | Bacteria | 1696 |
| 150 | Ga0099796_10169199 | 3300010159 | Bacteria | 871 |
| 151 | Ga0105239_10173617 | 3300010375 | Bacteria | 2411 |
| 152 | Ga0105246_10414388 | 3300011119 | Bacteria | 1122 |
| 153 | Ga0157373_10080150 | 3300013100 | Bacteria | 2302 |
| 154 | Ga0157370_10020408 | 3300013104 | Bacteria | 6618 |
| 155 | Ga0157370_10121794 | 3300013104 | Bacteria | 2435 |
| 156 | Ga0157369_10018726 | 3300013105 | Bacteria | 7764 |
| 157 | Ga0157369_10472985 | 3300013105 | Bacteria | 1297 |
| 158 | Ga0157369_10723057 | 3300013105 | Bacteria | 1025 |
| 159 | Ga0157374_10306703 | 3300013296 | Unclassified | 1571 |
| 160 | Ga0157374_10316641 | 3300013296 | Bacteria | 1545 |
| 161 | Ga0157378_10048576 | 3300013297 | Bacteria | 3774 |
| 162 | Ga0157378_10421473 | 3300013297 | Bacteria | 1319 |
| 163 | Ga0157378_10581171 | 3300013297 | Bacteria | 1129 |
| 164 | Ga0157375_10096304 | 3300013308 | Bacteria | 3032 |
| 165 | Ga0163163_10073091 | 3300014325 | Bacteria | 3419 |
| 166 | Ga0163163_10132407 | 3300014325 | Bacteria | 2534 |
| 167 | Ga0163163_10198649 | 3300014325 | Bacteria | 2054 |
| 168 | Ga0157380_10373703 | 3300014326 | Unclassified | 1343 |
| 169 | Ga0157380_10399533 | 3300014326 | Bacteria | 1303 |
| 170 | Ga0157377_10221221 | 3300014745 | Bacteria | 1212 |
| 171 | Ga0157377_10269406 | 3300014745 | Unclassified | 1111 |
| 172 | Ga0157379_10189136 | 3300014968 | Bacteria | 1860 |
| 173 | Ga0157379_10343481 | 3300014968 | Bacteria | 1365 |
| 174 | Ga0157376_10832064 | 3300014969 | Bacteria | 937 |
| 175 | Ga0163161_10077851 | 3300017792 | Bacteria | 2436 |
| 176 | Ga0163161_10145509 | 3300017792 | Unclassified | 1797 |
| 177 | Ga0213873_10084673 | 3300021358 | Bacteria | 892 |
| 178 | Ga0213874_10059850 | 3300021377 | Unclassified | 1190 |
| 179 | Ga0213876_10019072 | 3300021384 | Bacteria | 3622 |
| 180 | Ga0213875_10000132 | 3300021388 | Bacteria | 82929 |
| 181 | Ga0213875_10000232 | 3300021388 | Bacteria | 56352 |
| 182 | Ga0213875_10003695 | 3300021388 | Bacteria | 8629 |
| 183 | Ga0213875_10133708 | 3300021388 | Bacteria | 1160 |
| 184 | Ga0224572_1023763 | 3300024225 | Bacteria | 1177 |
| 185 | Ga0228598_1013877 | 3300024227 | Bacteria | 1594 |
| 186 | Ga0209758_1000556 | 3300025297 | Bacteria | 59164 |
| 187 | Ga0207692_10032005 | 3300025898 | Unclassified | 2523 |
| 188 | Ga0207692_10102390 | 3300025898 | Bacteria | 1575 |
| 189 | Ga0207692_10193683 | 3300025898 | Bacteria | 1191 |
| 190 | Ga0207692_10282143 | 3300025898 | Bacteria | 1005 |
| 191 | Ga0207642_10236439 | 3300025899 | Bacteria | 1029 |
| 192 | Ga0207710_10156735 | 3300025900 | Bacteria | 1107 |
| 193 | Ga0207688_10153704 | 3300025901 | Bacteria | 1361 |
| 194 | Ga0207680_10293954 | 3300025903 | Bacteria | 1131 |
| 195 | Ga0207685_10046890 | 3300025905 | Bacteria | 1647 |
| 196 | Ga0207699_10015964 | 3300025906 | Unclassified | 3916 |
| 197 | Ga0207645_10124337 | 3300025907 | Bacteria | 1676 |
| 198 | Ga0207643_10129294 | 3300025908 | Bacteria | 1501 |
| 199 | Ga0207684_10037507 | 3300025910 | Bacteria | 4112 |
| 200 | Ga0207684_10100380 | 3300025910 | Unclassified | 2473 |
| 201 | Ga0207684_10169313 | 3300025910 | Bacteria | 1883 |
| 202 | Ga0207707_10012496 | 3300025912 | Bacteria | 7382 |
| 203 | Ga0207707_10164919 | 3300025912 | Bacteria | 1936 |
| 204 | Ga0207707_10507829 | 3300025912 | Bacteria | 1027 |
| 205 | Ga0207695_10085943 | 3300025913 | Bacteria | 3173 |
| 206 | Ga0207695_10165974 | 3300025913 | Bacteria | 2136 |
| 207 | Ga0207695_10511669 | 3300025913 | Bacteria | 1082 |
| 208 | Ga0207693_10000650 | 3300025915 | Bacteria | 31123 |
| 209 | Ga0207693_10011145 | 3300025915 | Bacteria | 7282 |
| 210 | Ga0207693_10064984 | 3300025915 | Bacteria | 2857 |
| 211 | Ga0207693_10077628 | 3300025915 | Bacteria | 2600 |
| 212 | Ga0207693_10080380 | 3300025915 | Bacteria | 2552 |
| 213 | Ga0207693_10100350 | 3300025915 | Bacteria | 2269 |
| 214 | Ga0207693_10425530 | 3300025915 | Unclassified | 1038 |
| 215 | Ga0207663_10050958 | 3300025916 | Unclassified | 2575 |
| 216 | Ga0207663_10224023 | 3300025916 | Bacteria | 1370 |
| 217 | Ga0207663_10495324 | 3300025916 | Bacteria | 949 |
| 218 | Ga0207663_10725607 | 3300025916 | Bacteria | 788 |
| 219 | Ga0207660_10122584 | 3300025917 | Bacteria | 1970 |
| 220 | Ga0207660_10192200 | 3300025917 | Bacteria | 1590 |
| 221 | Ga0207662_10041647 | 3300025918 | Bacteria | 2704 |
| 222 | Ga0207662_10066994 | 3300025918 | Bacteria | 2165 |
| 223 | Ga0207662_10134376 | 3300025918 | Bacteria | 1562 |
| 224 | Ga0207657_10108172 | 3300025919 | Bacteria | 2298 |
| 225 | Ga0207652_10022390 | 3300025921 | Bacteria | 5228 |
| 226 | Ga0207652_10062636 | 3300025921 | Bacteria | 3214 |
| 227 | Ga0207652_10636711 | 3300025921 | Bacteria | 954 |
| 228 | Ga0207652_10912107 | 3300025921 | Bacteria | 776 |
| 229 | Ga0207646_10180744 | 3300025922 | Unclassified | 1905 |
| 230 | Ga0207646_10753185 | 3300025922 | Bacteria | 869 |
| 231 | Ga0207681_10030702 | 3300025923 | Bacteria | 3505 |
| 232 | Ga0207694_10324279 | 3300025924 | Unclassified | 1271 |
| 233 | Ga0207659_10164711 | 3300025926 | Bacteria | 1744 |
| 234 | Ga0207659_10482953 | 3300025926 | Bacteria | 1047 |
| 235 | Ga0207659_10557529 | 3300025926 | Bacteria | 974 |
| 236 | Ga0207700_10224424 | 3300025928 | Bacteria | 1594 |
| 237 | Ga0207700_10305199 | 3300025928 | Bacteria | 1375 |
| 238 | Ga0207700_10309771 | 3300025928 | Bacteria | 1365 |
| 239 | Ga0207700_10492390 | 3300025928 | Bacteria | 1084 |
| 240 | Ga0207700_10604805 | 3300025928 | Unclassified | 976 |
| 241 | Ga0207664_10086600 | 3300025929 | Bacteria | 2559 |
| 242 | Ga0207644_10008375 | 3300025931 | Bacteria | 6768 |
| 243 | Ga0207690_10012115 | 3300025932 | Bacteria | 5158 |
| 244 | Ga0207690_10532684 | 3300025932 | Bacteria | 953 |
| 245 | Ga0207706_10178397 | 3300025933 | Unclassified | 1866 |
| 246 | Ga0207686_10122159 | 3300025934 | Bacteria | 1774 |
| 247 | Ga0207670_10000669 | 3300025936 | Bacteria | 18137 |
| 248 | Ga0207670_10222232 | 3300025936 | Bacteria | 1446 |
| 249 | Ga0207670_10336208 | 3300025936 | Bacteria | 1192 |
| 250 | Ga0207669_10015320 | 3300025937 | Bacteria | 3864 |
| 251 | Ga0207665_10052136 | 3300025939 | Bacteria | 2756 |
| 252 | Ga0207665_10055798 | 3300025939 | Bacteria | 2666 |
| 253 | Ga0207665_10243929 | 3300025939 | Unclassified | 1325 |
| 254 | Ga0207691_10423237 | 3300025940 | Bacteria | 1135 |
| 255 | Ga0207711_10004469 | 3300025941 | Bacteria | 11923 |
| 256 | Ga0207689_10262466 | 3300025942 | Bacteria | 1429 |
| 257 | Ga0207668_10254062 | 3300025972 | Bacteria | 1429 |
| 258 | Ga0207658_10813926 | 3300025986 | Bacteria | 848 |
| 259 | Ga0207677_10393946 | 3300026023 | Unclassified | 1172 |
| 260 | Ga0207703_10621284 | 3300026035 | Unclassified | 1023 |
| 261 | Ga0207678_10100313 | 3300026067 | Bacteria | 2473 |
| 262 | Ga0207708_10386691 | 3300026075 | Bacteria | 1155 |
| 263 | Ga0207702_10134182 | 3300026078 | Bacteria | 2231 |
| 264 | Ga0207641_10178641 | 3300026088 | Bacteria | 1943 |
| 265 | Ga0207648_10082991 | 3300026089 | Bacteria | 2795 |
| 266 | Ga0207676_10007140 | 3300026095 | Bacteria | 7912 |
| 267 | Ga0207674_10111848 | 3300026116 | Bacteria | 2705 |
| 268 | Ga0207675_100079206 | 3300026118 | Bacteria | 3079 |
| 269 | Ga0207683_10166657 | 3300026121 | Bacteria | 1994 |
| 270 | Ga0207698_10126601 | 3300026142 | Bacteria | 2174 |
| 271 | Ga0209179_1010139 | 3300027512 | Bacteria | 1635 |
| 272 | Ga0265357_1002577 | 3300028023 | Bacteria | 1495 |
| 273 | Ga0268266_10361034 | 3300028379 | Bacteria | 1367 |
| 274 | Ga0268264_10650440 | 3300028381 | Unclassified | 1043 |
| 275 | Ga0265763_1000146 | 3300030763 | Bacteria | 3547 |
| 276 | Ga0265773_1000199 | 3300031018 | Bacteria | 1983 |
| 277 | Ga0265760_10038395 | 3300031090 | Bacteria | 1424 |
| 278 | Ga0265760_10078908 | 3300031090 | Unclassified | 1018 |
| 279 | Ga0265332_10112509 | 3300031238 | Bacteria | 1146 |
| 280 | Ga0265325_10000835 | 3300031241 | Bacteria | 22287 |
| 281 | Ga0373928_0025554 | 3300035084 | Bacteria | 1274 |
| 282 | Ga0373940_0012575 | 3300035088 | Bacteria | 2030 |
| 283 | Ga0373923_0000166 | 3300035111 | Bacteria | 12998 |
| 284 | Ga0373923_0073368 | 3300035111 | Bacteria | 1473 |
| 285 | Ga0373923_0131367 | 3300035111 | Bacteria | 1126 |
| 286 | Ga0373936_0000299 | 3300035113 | Bacteria | 16644 |
| 287 | Ga0373941_0020266 | 3300035115 | Bacteria | 1862 |
| 288 | Ga0373945_0000925 | 3300035116 | Bacteria | 8724 |
| 289 | Ga0373945_0036573 | 3300035116 | Unclassified | 1759 |
| 290 | Ga0373953_0065036 | 3300035117 | Bacteria | 1497 |
| 291 | Ga0373953_0175719 | 3300035117 | Bacteria | 923 |
| 292 | Ga0373954_0023644 | 3300035118 | Bacteria | 2796 |
| 293 | Ga0373954_0053436 | 3300035118 | Bacteria | 1899 |
| 294 | Ga0373954_0119425 | 3300035118 | Bacteria | 1279 |
| 295 | Ga0373956_0008687 | 3300035119 | Bacteria | 4114 |
| 296 | Ga0373956_0032349 | 3300035119 | Bacteria | 2295 |
| 297 | Ga0373957_0011455 | 3300035120 | Bacteria | 2961 |
| 298 | Ga0373957_0029514 | 3300035120 | Bacteria | 2004 |
| 299 | Ga0373960_0008244 | 3300035121 | Bacteria | 2492 |
| 300 | Ga0373943_0003656 | 3300035170 | Bacteria | 6992 |
| 301 | Ga0373943_0095805 | 3300035170 | Bacteria | 1544 |
| 302 | Ga0373943_0261012 | 3300035170 | Unclassified | 975 |
| 303 | Ga0373946_0000961 | 3300035171 | Bacteria | 9877 |
| 304 | Ga0373955_0000088 | 3300035172 | Bacteria | 37233 |
| 305 | Ga0373942_0010665 | 3300035207 | Bacteria | 2164 |
| 306 | Ga0373961_0047144 | 3300035241 | Bacteria | 1265 |
| 307 | Ga0373961_0068248 | 3300035241 | Bacteria | 1094 |
| 308 | Ga0373924_0001183 | 3300035410 | Bacteria | 8392 |
| 309 | Ga0373924_0070500 | 3300035410 | Bacteria | 1474 |
| 310 | Ga0373924_0192356 | 3300035410 | Unclassified | 899 |
| 311 | Ga0373931_0000647 | 3300035691 | Bacteria | 14379 |
| 312 | Ga0373931_0024128 | 3300035691 | Bacteria | 3078 |
| 313 | Ga0373935_0000169 | 3300035692 | Bacteria | 30547 |
| 314 | Ga0373935_0060649 | 3300035692 | Bacteria | 2420 |
| 315 | Ga0373935_0115676 | 3300035692 | Bacteria | 1786 |
| 316 | Ga0373935_0217235 | 3300035692 | Bacteria | 1327 |
| 317 | Ga0373927_0007789 | 3300035695 | Bacteria | 7245 |
| 318 | Ga0373927_0064571 | 3300035695 | Bacteria | 2368 |
| 319 | Ga0373927_0249731 | 3300035695 | Bacteria | 1166 |
| 320 | Ga0373927_0266742 | 3300035695 | Bacteria | 1126 |
| 321 | Ga0373933_0010891 | 3300035724 | Bacteria | 4992 |
| 322 | Ga0373933_0033569 | 3300035724 | Bacteria | 2986 |
| 323 | Ga0373933_0057928 | 3300035724 | Bacteria | 2329 |
| 324 | Ga0373933_0146990 | 3300035724 | Bacteria | 1491 |
| 325 | Ga0373947_0000391 | 3300035725 | Bacteria | 24724 |
| 326 | Ga0373947_0016862 | 3300035725 | Bacteria | 4196 |
| 327 | Ga0373947_0023380 | 3300035725 | Bacteria | 3594 |
| 328 | Ga0373947_0146756 | 3300035725 | Bacteria | 1517 |
| 329 | Ga0373947_0169402 | 3300035725 | Bacteria | 1416 |
| 330 | Ga0373937_0018907 | 3300036401 | Bacteria | 6159 |
| 331 | Ga0373937_0021908 | 3300036401 | Bacteria | 5737 |
| 332 | Ga0373937_0035943 | 3300036401 | Bacteria | 4512 |
| 333 | Ga0373937_0036243 | 3300036401 | Bacteria | 4494 |
| 334 | Ga0373937_0091151 | 3300036401 | Bacteria | 2824 |
| 335 | Ga0373937_0406509 | 3300036401 | Bacteria | 1292 |
| 336 | Ga0373937_0511186 | 3300036401 | Bacteria | 1141 |
| 337 | Ga0373937_0594778 | 3300036401 | Bacteria | 1050 |
| 338 | Ga0373937_0757345 | 3300036401 | Bacteria | 919 |
| 339 | Ga0373925_0003861 | 3300037068 | Bacteria | 11472 |
| 340 | Ga0373925_0041055 | 3300037068 | Bacteria | 3428 |
| 341 | Ga0373925_0044133 | 3300037068 | Bacteria | 3310 |
| 342 | Ga0373925_0218021 | 3300037068 | Bacteria | 1522 |
| 343 | Ga0373925_0269468 | 3300037068 | Unclassified | 1369 |
| 344 | Ga0373925_0387349 | 3300037068 | Bacteria | 1139 |
| 345 | Ga0436364_0093920 | 3300037853 | Bacteria | 1061 |
| 346 | Ga0436364_0331243 | 3300037853 | Unclassified | 1871 |
| 347 | Ga0436364_0345360 | 3300037853 | Bacteria | 1926 |
| 348 | Ga0436364_0717863 | 3300037853 | Bacteria | 145182 |
| 349 | Ga0436364_0990344 | 3300037853 | Bacteria | 56392 |
| 350 | Ga0436364_1416468 | 3300037853 | Bacteria | 30239 |
| 351 | Ga0436364_1558104 | 3300037853 | Bacteria | 1361 |
| 352 | Ga0395901_0736636 | 3300038443 | Bacteria | 980 |
| 353 | Ga0436365_0571973 | 3300039437 | Bacteria | 1826 |
| 354 | Ga0436365_0687950 | 3300039437 | Bacteria | 9684 |
| 355 | Ga0436365_0731168 | 3300039437 | Bacteria | 5585 |
| 356 | Ga0436365_0815796 | 3300039437 | Bacteria | 1527 |
| 357 | Ga0436365_1176487 | 3300039437 | Bacteria | 14323 |
| 358 | Ga0436360_0127060 | 3300039438 | Bacteria | 1166 |
| 359 | Ga0436360_0282261 | 3300039438 | Bacteria | 1526 |
| 360 | Ga0436360_0545963 | 3300039438 | Bacteria | 3456 |
| 361 | Ga0436360_0714278 | 3300039438 | Bacteria | 1345 |
| 362 | Ga0436360_0735010 | 3300039438 | Bacteria | 2041 |
| 363 | Ga0436360_0931475 | 3300039438 | Bacteria | 1835 |
| 364 | Ga0436361_0348596 | 3300039447 | Bacteria | 1139 |
| 365 | Ga0436361_0447055 | 3300039447 | Unclassified | 1128 |
| 366 | Ga0436363_0132764 | 3300039450 | Bacteria | 873 |
| 367 | Ga0436363_0211088 | 3300039450 | Bacteria | 1215 |
| 368 | Ga0436363_1334541 | 3300039450 | Bacteria | 2039 |
| 369 | Ga0436363_1573494 | 3300039450 | Bacteria | 2810 |
| 370 | Ga0436363_1698147 | 3300039450 | Bacteria | 1299 |
| 371 | Ga0436362_0139666 | 3300039453 | Bacteria | 857 |
| 372 | Ga0436362_0334402 | 3300039453 | Bacteria | 1233 |
| 373 | Ga0436362_0512199 | 3300039453 | Bacteria | 970 |
| 374 | Ga0436362_1306221 | 3300039453 | Bacteria | 1006 |
| 375 | Ga0451853_1236102 | 3300041512 | Bacteria | 1086 |
| 376 | Ga0453683_0181713 | 3300044673 | Bacteria | 1334 |
| 377 | Ga0466966_0254124 | 3300044684 | Bacteria | 1058 |
| 378 | Ga0466963_0203905 | 3300044694 | Bacteria | 1383 |
| 379 | Ga0466957_0006539 | 3300044842 | Bacteria | 6584 |
| 380 | Ga0466959_0074041 | 3300045049 | Bacteria | 2463 |
| 381 | Ga0466958_0012851 | 3300045836 | Bacteria | 4751 |
| 382 | Ga0466967_0141067 | 3300045976 | Bacteria | 2244 |
| 383 | Ga0466967_0260574 | 3300045976 | Bacteria | 1659 |
| 384 | Ga0495627_038609 | 3300046453 | Bacteria | 1475 |
| 385 | Ga0495592_0000177 | 3300046454 | Bacteria | 56202 |
| 386 | Ga0495603_0040160 | 3300046455 | Bacteria | 2801 |
| 387 | Ga0495591_056807 | 3300046458 | Bacteria | 1051 |
| 388 | Ga0495629_0006492 | 3300046459 | Bacteria | 8669 |
| 389 | Ga0495629_0182340 | 3300046459 | Bacteria | 1455 |
| 390 | Ga0495629_0444331 | 3300046459 | Bacteria | 878 |
| 391 | Ga0495638_0259909 | 3300046460 | Bacteria | 953 |
| 392 | Ga0495651_0000979 | 3300046462 | Bacteria | 22156 |
| 393 | Ga0495651_0122649 | 3300046462 | Bacteria | 1907 |
| 394 | Ga0495653_0000054 | 3300046463 | Bacteria | 102885 |
| 395 | Ga0495580_0320523 | 3300046472 | Unclassified | 1053 |
| 396 | Ga0495580_0432690 | 3300046472 | Bacteria | 884 |
| 397 | Ga0495582_0050176 | 3300046473 | Bacteria | 2299 |
| 398 | Ga0495605_0066063 | 3300046474 | Bacteria | 1719 |
| 399 | Ga0495662_0000766 | 3300046476 | Bacteria | 15495 |
| 400 | Ga0495664_0000020 | 3300046477 | Bacteria | 150749 |
| 401 | Ga0495585_0043838 | 3300046492 | Unclassified | 2500 |
| 402 | Ga0495594_0292828 | 3300046499 | Unclassified | 927 |
| 403 | Ga0495596_0105358 | 3300046500 | Unclassified | 1095 |
| 404 | Ga0495583_0194265 | 3300046506 | Bacteria | 827 |
| 405 | Ga0495608_0000024 | 3300046511 | Bacteria | 159429 |
| 406 | Ga0495616_0046952 | 3300046513 | Bacteria | 2177 |
| 407 | Ga0495618_0000020 | 3300046514 | Bacteria | 130661 |
| 408 | Ga0495618_0078093 | 3300046514 | Bacteria | 2110 |
| 409 | Ga0495620_0166537 | 3300046515 | Unclassified | 855 |
| 410 | Ga0495628_0000015 | 3300046516 | Bacteria | 198912 |
| 411 | Ga0495628_0085802 | 3300046516 | Bacteria | 2442 |
| 412 | Ga0495628_0116727 | 3300046516 | Bacteria | 2050 |
| 413 | Ga0495630_0004598 | 3300046517 | Bacteria | 9673 |
| 414 | Ga0495630_0318570 | 3300046517 | Bacteria | 1189 |
| 415 | Ga0495631_0099698 | 3300046518 | Unclassified | 1250 |
| 416 | Ga0495637_0128284 | 3300046520 | Unclassified | 970 |
| 417 | Ga0495644_0170185 | 3300046523 | Unclassified | 836 |
| 418 | Ga0495663_0004714 | 3300046525 | Bacteria | 3816 |
| 419 | Ga0495666_0239641 | 3300046526 | Bacteria | 828 |
| 420 | Ga0495642_0089840 | 3300046528 | Bacteria | 1300 |
| 421 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 422 | Ga0495652_0107508 | 3300046529 | Bacteria | 2251 |
| 423 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 424 | Ga0495640_0379750 | 3300046533 | Bacteria | 869 |
| 425 | Ga0495586_0304689 | 3300046535 | Bacteria | 913 |
| 426 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 427 | Ga0495598_0064323 | 3300046537 | Unclassified | 1139 |
| 428 | Ga0495609_0032708 | 3300046538 | Bacteria | 2362 |
| 429 | Ga0495621_0121861 | 3300046539 | Bacteria | 1008 |
| 430 | Ga0495645_0000013 | 3300046543 | Bacteria | 186399 |
| 431 | Ga0495645_0577842 | 3300046543 | Bacteria | 694 |
| 432 | Ga0495667_0000030 | 3300046559 | Bacteria | 147898 |
| 433 | Ga0495667_0014820 | 3300046559 | Bacteria | 5268 |
| 434 | Ga0495667_0182406 | 3300046559 | Bacteria | 1347 |
| 435 | Ga0495656_0053523 | 3300046615 | Bacteria | 1734 |
| 436 | Ga0495668_0192400 | 3300046616 | Bacteria | 1117 |
| 437 | Ga0495634_0000117 | 3300046642 | Bacteria | 67216 |
| 438 | Ga0495634_0079685 | 3300046642 | Bacteria | 2144 |
| 439 | Ga0495634_0205963 | 3300046642 | Bacteria | 1220 |
| 440 | Ga0495625_0270366 | 3300046660 | Bacteria | 1097 |
| 441 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 442 | Ga0495635_0500905 | 3300046663 | Unclassified | 800 |
| 443 | Ga0495659_0013021 | 3300046664 | Bacteria | 2704 |
| 444 | Ga0495659_0121018 | 3300046664 | Unclassified | 1030 |
| 445 | Ga0495661_0199633 | 3300046665 | Bacteria | 1048 |
| 446 | Ga0495588_0239895 | 3300046674 | Unclassified | 956 |
| 447 | Ga0495657_0000028 | 3300046675 | Bacteria | 131008 |
| 448 | Ga0495599_0000050 | 3300046678 | Bacteria | 82601 |
| 449 | Ga0495623_0000013 | 3300046679 | Bacteria | 119870 |
| 450 | Ga0495646_0000003 | 3300046680 | Bacteria | 287773 |
| 451 | Ga0495647_0100191 | 3300046681 | Bacteria | 1199 |
| 452 | Ga0495658_0493479 | 3300046683 | Unclassified | 783 |
| 453 | Ga0495669_0024477 | 3300046684 | Bacteria | 2629 |
| 454 | Ga0495613_0021178 | 3300046689 | Bacteria | 4849 |
| 455 | Ga0495613_0078965 | 3300046689 | Bacteria | 2393 |
| 456 | Ga0495613_0154197 | 3300046689 | Bacteria | 1637 |
| 457 | Ga0495613_0328083 | 3300046689 | Bacteria | 1055 |
| 458 | Ga0495624_0056500 | 3300046690 | Bacteria | 2470 |
| 459 | Ga0495624_0343232 | 3300046690 | Bacteria | 898 |
| 460 | Ga0495624_0553812 | 3300046690 | Unclassified | 687 |
| 461 | Ga0495670_0147332 | 3300046691 | Bacteria | 1233 |
| 462 | Ga0495671_0047371 | 3300046692 | Bacteria | 2148 |
| 463 | Ga0495649_0197992 | 3300046694 | Unclassified | 1044 |
| 464 | Ga0495589_0035637 | 3300046794 | Unclassified | 2494 |
| 465 | Ga0495600_0000002 | 3300046809 | Bacteria | 186597 |
| 466 | Ga0495581_0470488 | 3300047315 | Bacteria | 731 |
| 467 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 468 | Ga0495674_0000018 | 3300047319 | Bacteria | 204024 |
| 469 | Ga0495674_0395811 | 3300047319 | Bacteria | 1116 |
| 470 | Ga0495676_0152296 | 3300047321 | Bacteria | 1644 |
| 471 | Ga0495680_0000159 | 3300047322 | Bacteria | 68873 |
| 472 | Ga0495680_0319768 | 3300047322 | Bacteria | 1086 |
| 473 | Ga0495680_0539763 | 3300047322 | Bacteria | 787 |
| 474 | Ga0495675_0000238 | 3300047444 | Bacteria | 39857 |
| 475 | Ga0495677_0105890 | 3300047445 | Bacteria | 1067 |
| 476 | Ga0495679_036712 | 3300047446 | Bacteria | 1546 |
| 477 | Ga0495673_0137378 | 3300047469 | Bacteria | 956 |
| 478 | Ga0495681_0062829 | 3300047470 | Bacteria | 1706 |
| 479 | Ga0495684_0000010 | 3300047471 | Bacteria | 198915 |
| 480 | Ga0495684_0179653 | 3300047471 | Bacteria | 1569 |
| 481 | Ga0495593_0002061 | 3300047673 | Bacteria | 12004 |
| 482 | Ga0495602_0000016 | 3300048088 | Bacteria | 190311 |
| 483 | Ga0495602_0255476 | 3300048088 | Bacteria | 1303 |
| 484 | Ga0495602_0291571 | 3300048088 | Bacteria | 1198 |
| 485 | Ga0495615_0011448 | 3300048090 | Bacteria | 1803 |
| 486 | Ga0496100_0005934 | 3300048903 | Bacteria | 6621 |
| 487 | Ga0496100_0451663 | 3300048903 | Bacteria | 985 |
| 488 | Ga0496101_0030655 | 3300048904 | Bacteria | 3773 |
| 489 | Ga0496101_0077699 | 3300048904 | Bacteria | 2447 |
| 490 | Ga0496102_0127417 | 3300048905 | Bacteria | 2380 |
| 491 | Ga0496102_0197822 | 3300048905 | Bacteria | 1894 |
| 492 | Ga0496102_0201613 | 3300048905 | Bacteria | 1875 |
| 493 | Ga0496103_0139777 | 3300048906 | Unclassified | 1548 |
| 494 | Ga0496104_0001464 | 3300048907 | Bacteria | 20379 |
| 495 | Ga0496104_0008482 | 3300048907 | Bacteria | 9138 |
| 496 | Ga0496104_0027574 | 3300048907 | Bacteria | 5257 |
| 497 | Ga0496104_0063381 | 3300048907 | Bacteria | 3505 |
| 498 | Ga0496104_0120841 | 3300048907 | Bacteria | 2515 |
| 499 | Ga0496104_0252843 | 3300048907 | Bacteria | 1675 |
| 500 | Ga0496105_0008536 | 3300048908 | Bacteria | 7958 |
| 501 | Ga0496105_0050654 | 3300048908 | Bacteria | 3430 |
| 502 | Ga0496106_0004688 | 3300048909 | Bacteria | 10131 |
| 503 | Ga0496106_0157028 | 3300048909 | Bacteria | 1797 |
| 504 | Ga0496106_0438514 | 3300048909 | Unclassified | 1049 |
| 505 | Ga0496107_0022592 | 3300048910 | Bacteria | 4444 |
| 506 | Ga0496107_0044462 | 3300048910 | Bacteria | 3192 |
| 507 | Ga0496108_0020417 | 3300048911 | Bacteria | 5446 |
| 508 | Ga0496108_0098848 | 3300048911 | Bacteria | 2487 |
| 509 | Ga0496108_0137242 | 3300048911 | Bacteria | 2105 |
| 510 | Ga0496108_0677655 | 3300048911 | Bacteria | 895 |
| 511 | Ga0496109_0023504 | 3300048912 | Bacteria | 5473 |
| 512 | Ga0496109_0113071 | 3300048912 | Bacteria | 2525 |
| 513 | Ga0496109_0225585 | 3300048912 | Bacteria | 1762 |
| 514 | Ga0496110_0080249 | 3300048913 | Bacteria | 2907 |
| 515 | Ga0496110_0275036 | 3300048913 | Unclassified | 1533 |
| 516 | Ga0496110_0648710 | 3300048913 | Unclassified | 955 |
| 517 | Ga0496110_0904948 | 3300048913 | Bacteria | 788 |
| 518 | Ga0496111_0117835 | 3300048914 | Bacteria | 1960 |
| 519 | Ga0496111_0421819 | 3300048914 | Unclassified | 985 |
| 520 | Ga0496112_0061461 | 3300048915 | Bacteria | 3703 |
| 521 | Ga0496112_0137720 | 3300048915 | Bacteria | 2411 |
| 522 | Ga0496112_0145391 | 3300048915 | Bacteria | 2339 |
| 523 | Ga0496113_0088413 | 3300048916 | Bacteria | 2383 |
| 524 | Ga0496113_0225347 | 3300048916 | Bacteria | 1494 |
| 525 | Ga0496114_0002311 | 3300048917 | Bacteria | 14515 |
| 526 | Ga0496114_0221558 | 3300048917 | Bacteria | 1661 |
| 527 | Ga0496114_0462138 | 3300048917 | Unclassified | 1123 |
| 528 | Ga0496115_0004279 | 3300048918 | Bacteria | 10334 |
| 529 | Ga0496115_0085789 | 3300048918 | Bacteria | 2568 |
| 530 | Ga0496115_0095979 | 3300048918 | Bacteria | 2427 |
| 531 | Ga0496115_0299156 | 3300048918 | Bacteria | 1319 |
| 532 | Ga0501034_0673294 | 3300049571 | Bacteria | 935 |
| 533 | Ga0501038_0588284 | 3300049574 | Bacteria | 843 |
| 534 | Ga0501039_0209692 | 3300049575 | Bacteria | 1532 |
| 535 | Ga0501040_0042041 | 3300049576 | Bacteria | 3113 |
| 536 | Ga0501041_0279026 | 3300049577 | Bacteria | 1051 |
| 537 | Ga0501048_0231165 | 3300049582 | Bacteria | 1312 |
| 538 | Ga0501068_0026678 | 3300049584 | Bacteria | 3406 |
| 539 | Ga0501068_0236662 | 3300049584 | Bacteria | 1162 |
| 540 | Ga0501069_0123758 | 3300049585 | Bacteria | 1478 |
| 541 | Ga0501070_0083902 | 3300049586 | Bacteria | 2638 |
| 542 | Ga0501071_0374381 | 3300049587 | Bacteria | 1085 |
| 543 | Ga0501072_0012735 | 3300049588 | Bacteria | 6431 |
| 544 | Ga0501072_0189789 | 3300049588 | Bacteria | 1639 |
| 545 | Ga0501072_0217010 | 3300049588 | Bacteria | 1524 |
| 546 | Ga0501075_0007759 | 3300049591 | Bacteria | 7447 |
| 547 | Ga0501075_0158315 | 3300049591 | Bacteria | 1727 |
| 548 | Ga0501076_0060503 | 3300049592 | Bacteria | 3013 |
| 549 | Ga0501076_0170406 | 3300049592 | Bacteria | 1774 |
| 550 | Ga0501076_0398333 | 3300049592 | Bacteria | 1132 |
| 551 | Ga0501077_0091358 | 3300049593 | Bacteria | 1929 |
| 552 | Ga0501079_0093542 | 3300049741 | Bacteria | 2329 |
| 553 | Ga0501080_0429539 | 3300049742 | Bacteria | 1186 |
| 554 | Ga0501081_0101820 | 3300049743 | Bacteria | 2031 |
| 555 | Ga0501081_0206157 | 3300049743 | Bacteria | 1427 |
| 556 | Ga0501083_0324863 | 3300049744 | Bacteria | 1000 |
| 557 | nmdc:mga00v17_634073_c1 | 3300050491 | Bacteria | 688 |
| 558 | nmdc:mga0yw44_541195_c1 | 3300050492 | Bacteria | 791 |
| 559 | nmdc:mga0k408_18038_c1 | 3300050493 | Bacteria | 3935 |
| 560 | nmdc:mga0k408_66438_c1 | 3300050493 | Bacteria | 2101 |
| 561 | nmdc:mga07m45_163672_c1 | 3300050496 | Bacteria | 1292 |
| 562 | nmdc:mga05p37_23571_c1 | 3300050507 | Bacteria | 7469 |
| 563 | nmdc:mga05p37_432074_c1 | 3300050507 | Unclassified | 1529 |
| 564 | nmdc:mga0qj67_111_c1 | 3300050509 | Bacteria | 53806 |
| 565 | nmdc:mga06r32_74968_c1 | 3300050510 | Bacteria | 3281 |
| 566 | nmdc:mga08y16_487764_c1 | 3300050511 | Unclassified | 1253 |
| 567 | nmdc:mga08y16_719570_c1 | 3300050511 | Bacteria | 996 |
| 568 | nmdc:mga08y16_739669_c1 | 3300050511 | Bacteria | 980 |
| 569 | nmdc:mga0n895_1207205_c1 | 3300050512 | Bacteria | 730 |
| 570 | nmdc:mga0n895_21602_c1 | 3300050512 | Bacteria | 6023 |
| 571 | nmdc:mga0n895_283683_c1 | 3300050512 | Bacteria | 1679 |
| 572 | nmdc:mga0n895_454163_c1 | 3300050512 | Unclassified | 1293 |
| 573 | nmdc:mga0n895_899869_c1 | 3300050512 | Bacteria | 870 |
| 574 | nmdc:mga0n895_939816_c1 | 3300050512 | Bacteria | 848 |
| 575 | nmdc:mga0rr50_131909_c1 | 3300050513 | Bacteria | 2001 |
| 576 | nmdc:mga0rr50_206620_c1 | 3300050513 | Bacteria | 1616 |
| 577 | nmdc:mga08x19_16623_c1 | 3300050514 | Bacteria | 4490 |
| 578 | nmdc:mga08x19_48164_c1 | 3300050514 | Bacteria | 2730 |
| 579 | Ga0495601_0000021 | 3300053077 | Bacteria | 159355 |
| 580 | Ga0495601_0013904 | 3300053077 | Bacteria | 4846 |
| 581 | Ga0495601_0066819 | 3300053077 | Bacteria | 2289 |
| 582 | Ga0495601_0304376 | 3300053077 | Bacteria | 1038 |
| 583 | Ga0495612_0000018 | 3300053078 | Bacteria | 150870 |
| 584 | Ga0495612_0046107 | 3300053078 | Bacteria | 1785 |
| 585 | Ga0495655_0005056 | 3300053083 | Bacteria | 2302 |
| 586 | Ga0495595_0000028 | 3300053084 | Bacteria | 97682 |
| 587 | Ga0495595_0016963 | 3300053084 | Bacteria | 3125 |
| 588 | Ga0495595_0074225 | 3300053084 | Bacteria | 1612 |
| 589 | Ga0495595_0139064 | 3300053084 | Bacteria | 1191 |
| 590 | Ga0495619_0000006 | 3300053085 | Bacteria | 384835 |
| 591 | Ga0495619_0003473 | 3300053085 | Bacteria | 10170 |
| 592 | Ga0495619_0043003 | 3300053085 | Bacteria | 2960 |
| 593 | Ga0495619_0072766 | 3300053085 | Bacteria | 2302 |
| 594 | Ga0500643_000447 | 3300053087 | Bacteria | 30610 |
| 595 | Ga0500593_027298 | 3300053117 | Bacteria | 2547 |
| 596 | Ga0500616_0069291 | 3300053153 | Bacteria | 1804 |
| 597 | Ga0500622_0215441 | 3300053156 | Bacteria | 864 |
| 598 | Ga0500645_054975 | 3300053730 | Bacteria | 1157 |
| 599 | Ga0501084_0063617 | 3300054114 | Bacteria | 3089 |
| 600 | Ga0501084_0096416 | 3300054114 | Bacteria | 2484 |
| 601 | Ga0501084_0387278 | 3300054114 | Bacteria | 1181 |
| 602 | Ga0587109_055080 | 3300059624 | Unclassified | 824 |
| 603 | Ga0587068_042159 | 3300059641 | Bacteria | 829 |
| 604 | Ga0587071_032368 | 3300060344 | Bacteria | 1013 |
| 605 | Ga0501082_0139236 | 3300060353 | Bacteria | 2106 |
| 606 | Ga0530510_0011205 | 3300061734 | Bacteria | 6291 |
| 607 | Ga0530510_0468425 | 3300061734 | Bacteria | 953 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0035943 | Ga0373937_0035943_510_1226 | 211 |
| 2 | 3300005434 | Ga0070709_10065986 | Ga0070709_100659862 | 215 |
| 3 | 3300005435 | Ga0070714_100003291 | Ga0070714_1000032913 | 215 |
| 4 | 3300005436 | Ga0070713_100037240 | Ga0070713_1000372403 | 215 |
| 5 | 3300005437 | Ga0070710_10001459 | Ga0070710_1000145911 | 215 |
| 6 | 3300005439 | Ga0070711_100055931 | Ga0070711_1000559314 | 215 |
| 7 | 3300006028 | Ga0070717_10027202 | Ga0070717_100272024 | 215 |
| 8 | 3300006175 | Ga0070712_100022645 | Ga0070712_1000226452 | 215 |
| 9 | 3300025898 | Ga0207692_10032005 | Ga0207692_100320052 | 215 |
| 10 | 3300025906 | Ga0207699_10015964 | Ga0207699_100159642 | 215 |
| 11 | 3300025915 | Ga0207693_10000650 | Ga0207693_1000065023 | 215 |
| 12 | 3300025916 | Ga0207663_10050958 | Ga0207663_100509583 | 215 |
| 13 | 3300025928 | Ga0207700_10224424 | Ga0207700_102244242 | 215 |
| 14 | 3300025929 | Ga0207664_10086600 | Ga0207664_100866002 | 215 |
| 15 | 3300025939 | Ga0207665_10243929 | Ga0207665_102439291 | 215 |
| 16 | 3300035117 | Ga0373953_0175719 | Ga0373953_0175719_17_667 | 216 |
| 17 | 3300035120 | Ga0373957_0029514 | Ga0373957_0029514_1338_1988 | 216 |
| 18 | 3300035724 | Ga0373933_0146990 | Ga0373933_0146990_41_691 | 216 |
| 19 | 3300036401 | Ga0373937_0757345 | Ga0373937_0757345_248_898 | 216 |
| 20 | 3300046459 | Ga0495629_0444331 | Ga0495629_0444331_218_868 | 216 |
| 21 | 3300046543 | Ga0495645_0577842 | Ga0495645_0577842_24_674 | 216 |
| 22 | 3300046683 | Ga0495658_0493479 | Ga0495658_0493479_20_670 | 216 |
| 23 | 3300046690 | Ga0495624_0553812 | Ga0495624_0553812_10_660 | 216 |
| 24 | 3300047315 | Ga0495581_0470488 | Ga0495581_0470488_21_671 | 216 |
| 25 | 3300047322 | Ga0495680_0539763 | Ga0495680_0539763_125_775 | 216 |
| 26 | 3300050512 | nmdc:mga0n895_1207205_c1 | nmdc:mga0n895_1207205_c1_61_711 | 216 |
| 27 | 3300050512 | nmdc:mga0n895_899869_c1 | nmdc:mga0n895_899869_c1_194_844 | 216 |
| 28 | 3300054114 | Ga0501084_0387278 | Ga0501084_0387278_10_660 | 216 |
| 29 | 3300035111 | Ga0373923_0131367 | Ga0373923_0131367_458_1111 | 217 |
| 30 | 3300035241 | Ga0373961_0047144 | Ga0373961_0047144_16_669 | 217 |
| 31 | 3300050491 | nmdc:mga00v17_634073_c1 | nmdc:mga00v17_634073_c1_20_673 | 217 |
| 32 | 3300039438 | Ga0436360_0127060 | Ga0436360_0127060_249_941 | 220 |
| 33 | 3300025898 | Ga0207692_10193683 | Ga0207692_101936831 | 221 |
| 34 | 3300005937 | Ga0081455_10006759 | Ga0081455_100067598 | 224 |
| 35 | 3300053087 | Ga0500643_000447 | Ga0500643_000447_25946_26623 | 225 |
| 36 | 3300039453 | Ga0436362_0512199 | Ga0436362_0512199_121_801 | 226 |
| 37 | 3300039453 | Ga0436362_1306221 | Ga0436362_1306221_127_807 | 226 |
| 38 | 3300046535 | Ga0495586_0304689 | Ga0495586_0304689_40_720 | 226 |
| 39 | 3300005329 | Ga0070683_100573869 | Ga0070683_1005738691 | 229 |
| 40 | 3300005354 | Ga0070675_100182890 | Ga0070675_1001828902 | 229 |
| 41 | 3300005356 | Ga0070674_100008624 | Ga0070674_1000086244 | 229 |
| 42 | 3300005543 | Ga0070672_100264560 | Ga0070672_1002645601 | 229 |
| 43 | 3300006237 | Ga0097621_100300723 | Ga0097621_1003007232 | 229 |
| 44 | 3300006358 | Ga0068871_100329314 | Ga0068871_1003293142 | 229 |
| 45 | 3300011119 | Ga0105246_10414388 | Ga0105246_104143881 | 229 |
| 46 | 3300013308 | Ga0157375_10096304 | Ga0157375_100963043 | 229 |
| 47 | 3300014325 | Ga0163163_10073091 | Ga0163163_100730914 | 229 |
| 48 | 3300014326 | Ga0157380_10399533 | Ga0157380_103995331 | 229 |
| 49 | 3300014745 | Ga0157377_10221221 | Ga0157377_102212211 | 229 |
| 50 | 3300017792 | Ga0163161_10077851 | Ga0163161_100778512 | 229 |
| 51 | 3300025913 | Ga0207695_10511669 | Ga0207695_105116692 | 229 |
| 52 | 3300025918 | Ga0207662_10066994 | Ga0207662_100669942 | 229 |
| 53 | 3300025926 | Ga0207659_10557529 | Ga0207659_105575291 | 229 |
| 54 | 3300025937 | Ga0207669_10015320 | Ga0207669_100153204 | 229 |
| 55 | 3300026089 | Ga0207648_10082991 | Ga0207648_100829912 | 229 |
| 56 | 3300031238 | Ga0265332_10112509 | Ga0265332_101125092 | 229 |
| 57 | 3300053117 | Ga0500593_027298 | Ga0500593_027298_1586_2335 | 229 |
| 58 | 3300053156 | Ga0500622_0215441 | Ga0500622_0215441_81_782 | 229 |
| 59 | 3300005329 | Ga0070683_100212096 | Ga0070683_1002120962 | 230 |
| 60 | 3300005336 | Ga0070680_100148352 | Ga0070680_1001483522 | 230 |
| 61 | 3300005337 | Ga0070682_100057326 | Ga0070682_1000573263 | 230 |
| 62 | 3300005339 | Ga0070660_100069799 | Ga0070660_1000697994 | 230 |
| 63 | 3300005339 | Ga0070660_100259150 | Ga0070660_1002591502 | 230 |
| 64 | 3300005347 | Ga0070668_100129084 | Ga0070668_1001290842 | 230 |
| 65 | 3300005347 | Ga0070668_100870852 | Ga0070668_1008708521 | 230 |
| 66 | 3300005353 | Ga0070669_100076542 | Ga0070669_1000765422 | 230 |
| 67 | 3300005354 | Ga0070675_100438082 | Ga0070675_1004380822 | 230 |
| 68 | 3300005355 | Ga0070671_100495664 | Ga0070671_1004956641 | 230 |
| 69 | 3300005365 | Ga0070688_100251439 | Ga0070688_1002514391 | 230 |
| 70 | 3300005366 | Ga0070659_100031970 | Ga0070659_1000319703 | 230 |
| 71 | 3300005434 | Ga0070709_10095937 | Ga0070709_100959372 | 230 |
| 72 | 3300005434 | Ga0070709_10390416 | Ga0070709_103904161 | 230 |
| 73 | 3300005435 | Ga0070714_100028108 | Ga0070714_1000281081 | 230 |
| 74 | 3300005435 | Ga0070714_100102155 | Ga0070714_1001021553 | 230 |
| 75 | 3300005436 | Ga0070713_100049101 | Ga0070713_1000491012 | 230 |
| 76 | 3300005436 | Ga0070713_100116722 | Ga0070713_1001167222 | 230 |
| 77 | 3300005436 | Ga0070713_100660947 | Ga0070713_1006609471 | 230 |
| 78 | 3300005437 | Ga0070710_10081702 | Ga0070710_100817022 | 230 |
| 79 | 3300005439 | Ga0070711_100014338 | Ga0070711_1000143385 | 230 |
| 80 | 3300005439 | Ga0070711_100569167 | Ga0070711_1005691672 | 230 |
| 81 | 3300005455 | Ga0070663_100121491 | Ga0070663_1001214911 | 230 |
| 82 | 3300005456 | Ga0070678_100399280 | Ga0070678_1003992801 | 230 |
| 83 | 3300005458 | Ga0070681_10062094 | Ga0070681_100620944 | 230 |
| 84 | 3300005458 | Ga0070681_10063112 | Ga0070681_100631125 | 230 |
| 85 | 3300005458 | Ga0070681_10088384 | Ga0070681_100883843 | 230 |
| 86 | 3300005458 | Ga0070681_10102719 | Ga0070681_101027192 | 230 |
| 87 | 3300005458 | Ga0070681_10222380 | Ga0070681_102223801 | 230 |
| 88 | 3300005466 | Ga0070685_10142607 | Ga0070685_101426072 | 230 |
| 89 | 3300005467 | Ga0070706_100078060 | Ga0070706_1000780601 | 230 |
| 90 | 3300005467 | Ga0070706_100242459 | Ga0070706_1002424592 | 230 |
| 91 | 3300005467 | Ga0070706_100616988 | Ga0070706_1006169881 | 230 |
| 92 | 3300005468 | Ga0070707_100021284 | Ga0070707_1000212844 | 230 |
| 93 | 3300005471 | Ga0070698_100016820 | Ga0070698_1000168208 | 230 |
| 94 | 3300005471 | Ga0070698_100045574 | Ga0070698_1000455741 | 230 |
| 95 | 3300005471 | Ga0070698_100141303 | Ga0070698_1001413032 | 230 |
| 96 | 3300005471 | Ga0070698_100219444 | Ga0070698_1002194442 | 230 |
| 97 | 3300005518 | Ga0070699_100184265 | Ga0070699_1001842651 | 230 |
| 98 | 3300005530 | Ga0070679_100042019 | Ga0070679_1000420195 | 230 |
| 99 | 3300005530 | Ga0070679_100104320 | Ga0070679_1001043202 | 230 |
| 100 | 3300005530 | Ga0070679_100130602 | Ga0070679_1001306024 | 230 |
| 101 | 3300005536 | Ga0070697_100063371 | Ga0070697_1000633715 | 230 |
| 102 | 3300005536 | Ga0070697_100246573 | Ga0070697_1002465732 | 230 |
| 103 | 3300005543 | Ga0070672_100253996 | Ga0070672_1002539962 | 230 |
| 104 | 3300005544 | Ga0070686_100316159 | Ga0070686_1003161591 | 230 |
| 105 | 3300005545 | Ga0070695_100525161 | Ga0070695_1005251611 | 230 |
| 106 | 3300005548 | Ga0070665_100218448 | Ga0070665_1002184483 | 230 |
| 107 | 3300005577 | Ga0068857_100149519 | Ga0068857_1001495193 | 230 |
| 108 | 3300005578 | Ga0068854_100343370 | Ga0068854_1003433702 | 230 |
| 109 | 3300005614 | Ga0068856_100255748 | Ga0068856_1002557482 | 230 |
| 110 | 3300005616 | Ga0068852_100515909 | Ga0068852_1005159091 | 230 |
| 111 | 3300005718 | Ga0068866_10195202 | Ga0068866_101952021 | 230 |
| 112 | 3300005840 | Ga0068870_10187119 | Ga0068870_101871192 | 230 |
| 113 | 3300005842 | Ga0068858_100267609 | Ga0068858_1002676093 | 230 |
| 114 | 3300005842 | Ga0068858_100987683 | Ga0068858_1009876831 | 230 |
| 115 | 3300005843 | Ga0068860_100139332 | Ga0068860_1001393322 | 230 |
| 116 | 3300005937 | Ga0081455_10300666 | Ga0081455_103006662 | 230 |
| 117 | 3300005983 | Ga0081540_1050097 | Ga0081540_10500972 | 230 |
| 118 | 3300005983 | Ga0081540_1162125 | Ga0081540_11621252 | 230 |
| 119 | 3300006028 | Ga0070717_10060234 | Ga0070717_100602343 | 230 |
| 120 | 3300006028 | Ga0070717_10250017 | Ga0070717_102500172 | 230 |
| 121 | 3300006028 | Ga0070717_10846068 | Ga0070717_108460681 | 230 |
| 122 | 3300006038 | Ga0075365_10234337 | Ga0075365_102343371 | 230 |
| 123 | 3300006038 | Ga0075365_10582862 | Ga0075365_105828621 | 230 |
| 124 | 3300006051 | Ga0075364_10153470 | Ga0075364_101534702 | 230 |
| 125 | 3300006173 | Ga0070716_100097360 | Ga0070716_1000973603 | 230 |
| 126 | 3300006173 | Ga0070716_100243469 | Ga0070716_1002434692 | 230 |
| 127 | 3300006175 | Ga0070712_100017585 | Ga0070712_1000175854 | 230 |
| 128 | 3300006175 | Ga0070712_100032258 | Ga0070712_1000322582 | 230 |
| 129 | 3300006175 | Ga0070712_100063239 | Ga0070712_1000632393 | 230 |
| 130 | 3300006175 | Ga0070712_100112306 | Ga0070712_1001123063 | 230 |
| 131 | 3300006175 | Ga0070712_100113030 | Ga0070712_1001130303 | 230 |
| 132 | 3300006175 | Ga0070712_100148770 | Ga0070712_1001487702 | 230 |
| 133 | 3300006175 | Ga0070712_100473919 | Ga0070712_1004739191 | 230 |
| 134 | 3300006237 | Ga0097621_100111027 | Ga0097621_1001110271 | 230 |
| 135 | 3300006358 | Ga0068871_100131839 | Ga0068871_1001318391 | 230 |
| 136 | 3300006844 | Ga0075428_100073107 | Ga0075428_1000731072 | 230 |
| 137 | 3300006846 | Ga0075430_100000311 | Ga0075430_10000031113 | 230 |
| 138 | 3300006847 | Ga0075431_100196082 | Ga0075431_1001960824 | 230 |
| 139 | 3300006871 | Ga0075434_100190454 | Ga0075434_1001904541 | 230 |
| 140 | 3300006871 | Ga0075434_100776665 | Ga0075434_1007766651 | 230 |
| 141 | 3300006871 | Ga0075434_101120770 | Ga0075434_1011207701 | 230 |
| 142 | 3300006880 | Ga0075429_100257534 | Ga0075429_1002575342 | 230 |
| 143 | 3300006881 | Ga0068865_100183851 | Ga0068865_1001838512 | 230 |
| 144 | 3300006914 | Ga0075436_100115320 | Ga0075436_1001153203 | 230 |
| 145 | 3300007076 | Ga0075435_100165663 | Ga0075435_1001656631 | 230 |
| 146 | 3300007076 | Ga0075435_100579291 | Ga0075435_1005792911 | 230 |
| 147 | 3300007788 | Ga0099795_10148462 | Ga0099795_101484622 | 230 |
| 148 | 3300009093 | Ga0105240_10096152 | Ga0105240_100961524 | 230 |
| 149 | 3300009094 | Ga0111539_10725908 | Ga0111539_107259081 | 230 |
| 150 | 3300009094 | Ga0111539_10866943 | Ga0111539_108669432 | 230 |
| 151 | 3300009101 | Ga0105247_10045669 | Ga0105247_100456692 | 230 |
| 152 | 3300009147 | Ga0114129_10219641 | Ga0114129_102196412 | 230 |
| 153 | 3300009147 | Ga0114129_10351990 | Ga0114129_103519902 | 230 |
| 154 | 3300009147 | Ga0114129_10935511 | Ga0114129_109355111 | 230 |
| 155 | 3300009148 | Ga0105243_10048514 | Ga0105243_100485142 | 230 |
| 156 | 3300009148 | Ga0105243_11358179 | Ga0105243_113581791 | 230 |
| 157 | 3300009174 | Ga0105241_10266721 | Ga0105241_102667212 | 230 |
| 158 | 3300009176 | Ga0105242_10576158 | Ga0105242_105761581 | 230 |
| 159 | 3300009553 | Ga0105249_10076826 | Ga0105249_100768263 | 230 |
| 160 | 3300009553 | Ga0105249_10155222 | Ga0105249_101552222 | 230 |
| 161 | 3300010159 | Ga0099796_10032463 | Ga0099796_100324632 | 230 |
| 162 | 3300010159 | Ga0099796_10169199 | Ga0099796_101691991 | 230 |
| 163 | 3300010375 | Ga0105239_10173617 | Ga0105239_101736171 | 230 |
| 164 | 3300013100 | Ga0157373_10080150 | Ga0157373_100801502 | 230 |
| 165 | 3300013104 | Ga0157370_10020408 | Ga0157370_100204086 | 230 |
| 166 | 3300013104 | Ga0157370_10121794 | Ga0157370_101217942 | 230 |
| 167 | 3300013105 | Ga0157369_10018726 | Ga0157369_100187263 | 230 |
| 168 | 3300013105 | Ga0157369_10472985 | Ga0157369_104729852 | 230 |
| 169 | 3300013105 | Ga0157369_10723057 | Ga0157369_107230572 | 230 |
| 170 | 3300013296 | Ga0157374_10306703 | Ga0157374_103067032 | 230 |
| 171 | 3300013296 | Ga0157374_10316641 | Ga0157374_103166412 | 230 |
| 172 | 3300013297 | Ga0157378_10048576 | Ga0157378_100485765 | 230 |
| 173 | 3300013297 | Ga0157378_10581171 | Ga0157378_105811712 | 230 |
| 174 | 3300014325 | Ga0163163_10132407 | Ga0163163_101324071 | 230 |
| 175 | 3300014326 | Ga0157380_10373703 | Ga0157380_103737031 | 230 |
| 176 | 3300014745 | Ga0157377_10269406 | Ga0157377_102694061 | 230 |
| 177 | 3300014968 | Ga0157379_10189136 | Ga0157379_101891361 | 230 |
| 178 | 3300014969 | Ga0157376_10832064 | Ga0157376_108320641 | 230 |
| 179 | 3300017792 | Ga0163161_10145509 | Ga0163161_101455091 | 230 |
| 180 | 3300021358 | Ga0213873_10084673 | Ga0213873_100846731 | 230 |
| 181 | 3300021377 | Ga0213874_10059850 | Ga0213874_100598501 | 230 |
| 182 | 3300021384 | Ga0213876_10019072 | Ga0213876_100190721 | 230 |
| 183 | 3300021388 | Ga0213875_10000132 | Ga0213875_100001322 | 230 |
| 184 | 3300021388 | Ga0213875_10000232 | Ga0213875_1000023245 | 230 |
| 185 | 3300021388 | Ga0213875_10003695 | Ga0213875_100036951 | 230 |
| 186 | 3300021388 | Ga0213875_10133708 | Ga0213875_101337081 | 230 |
| 187 | 3300024225 | Ga0224572_1023763 | Ga0224572_10237632 | 230 |
| 188 | 3300024227 | Ga0228598_1013877 | Ga0228598_10138771 | 230 |
| 189 | 3300025898 | Ga0207692_10102390 | Ga0207692_101023902 | 230 |
| 190 | 3300025898 | Ga0207692_10282143 | Ga0207692_102821431 | 230 |
| 191 | 3300025900 | Ga0207710_10156735 | Ga0207710_101567351 | 230 |
| 192 | 3300025901 | Ga0207688_10153704 | Ga0207688_101537041 | 230 |
| 193 | 3300025905 | Ga0207685_10046890 | Ga0207685_100468902 | 230 |
| 194 | 3300025910 | Ga0207684_10037507 | Ga0207684_100375073 | 230 |
| 195 | 3300025910 | Ga0207684_10100380 | Ga0207684_101003803 | 230 |
| 196 | 3300025910 | Ga0207684_10169313 | Ga0207684_101693132 | 230 |
| 197 | 3300025912 | Ga0207707_10012496 | Ga0207707_100124962 | 230 |
| 198 | 3300025912 | Ga0207707_10164919 | Ga0207707_101649192 | 230 |
| 199 | 3300025912 | Ga0207707_10507829 | Ga0207707_105078291 | 230 |
| 200 | 3300025913 | Ga0207695_10085943 | Ga0207695_100859434 | 230 |
| 201 | 3300025913 | Ga0207695_10165974 | Ga0207695_101659742 | 230 |
| 202 | 3300025915 | Ga0207693_10011145 | Ga0207693_100111452 | 230 |
| 203 | 3300025915 | Ga0207693_10064984 | Ga0207693_100649842 | 230 |
| 204 | 3300025915 | Ga0207693_10077628 | Ga0207693_100776283 | 230 |
| 205 | 3300025915 | Ga0207693_10080380 | Ga0207693_100803802 | 230 |
| 206 | 3300025915 | Ga0207693_10100350 | Ga0207693_101003503 | 230 |
| 207 | 3300025915 | Ga0207693_10425530 | Ga0207693_104255302 | 230 |
| 208 | 3300025916 | Ga0207663_10224023 | Ga0207663_102240231 | 230 |
| 209 | 3300025916 | Ga0207663_10495324 | Ga0207663_104953241 | 230 |
| 210 | 3300025916 | Ga0207663_10725607 | Ga0207663_107256071 | 230 |
| 211 | 3300025917 | Ga0207660_10122584 | Ga0207660_101225842 | 230 |
| 212 | 3300025917 | Ga0207660_10192200 | Ga0207660_101922002 | 230 |
| 213 | 3300025918 | Ga0207662_10134376 | Ga0207662_101343762 | 230 |
| 214 | 3300025919 | Ga0207657_10108172 | Ga0207657_101081724 | 230 |
| 215 | 3300025921 | Ga0207652_10022390 | Ga0207652_100223905 | 230 |
| 216 | 3300025921 | Ga0207652_10062636 | Ga0207652_100626362 | 230 |
| 217 | 3300025921 | Ga0207652_10636711 | Ga0207652_106367112 | 230 |
| 218 | 3300025921 | Ga0207652_10912107 | Ga0207652_109121071 | 230 |
| 219 | 3300025922 | Ga0207646_10180744 | Ga0207646_101807442 | 230 |
| 220 | 3300025922 | Ga0207646_10753185 | Ga0207646_107531851 | 230 |
| 221 | 3300025924 | Ga0207694_10324279 | Ga0207694_103242791 | 230 |
| 222 | 3300025926 | Ga0207659_10164711 | Ga0207659_101647113 | 230 |
| 223 | 3300025926 | Ga0207659_10482953 | Ga0207659_104829532 | 230 |
| 224 | 3300025928 | Ga0207700_10305199 | Ga0207700_103051992 | 230 |
| 225 | 3300025928 | Ga0207700_10309771 | Ga0207700_103097712 | 230 |
| 226 | 3300025928 | Ga0207700_10492390 | Ga0207700_104923901 | 230 |
| 227 | 3300025928 | Ga0207700_10604805 | Ga0207700_106048052 | 230 |
| 228 | 3300025932 | Ga0207690_10012115 | Ga0207690_100121153 | 230 |
| 229 | 3300025933 | Ga0207706_10178397 | Ga0207706_101783971 | 230 |
| 230 | 3300025934 | Ga0207686_10122159 | Ga0207686_101221592 | 230 |
| 231 | 3300025936 | Ga0207670_10336208 | Ga0207670_103362081 | 230 |
| 232 | 3300025939 | Ga0207665_10052136 | Ga0207665_100521363 | 230 |
| 233 | 3300025939 | Ga0207665_10055798 | Ga0207665_100557983 | 230 |
| 234 | 3300025942 | Ga0207689_10262466 | Ga0207689_102624662 | 230 |
| 235 | 3300026023 | Ga0207677_10393946 | Ga0207677_103939462 | 230 |
| 236 | 3300026035 | Ga0207703_10621284 | Ga0207703_106212841 | 230 |
| 237 | 3300026067 | Ga0207678_10100313 | Ga0207678_101003133 | 230 |
| 238 | 3300026075 | Ga0207708_10386691 | Ga0207708_103866911 | 230 |
| 239 | 3300026078 | Ga0207702_10134182 | Ga0207702_101341823 | 230 |
| 240 | 3300026116 | Ga0207674_10111848 | Ga0207674_101118483 | 230 |
| 241 | 3300026118 | Ga0207675_100079206 | Ga0207675_1000792062 | 230 |
| 242 | 3300026121 | Ga0207683_10166657 | Ga0207683_101666571 | 230 |
| 243 | 3300026142 | Ga0207698_10126601 | Ga0207698_101266011 | 230 |
| 244 | 3300027512 | Ga0209179_1010139 | Ga0209179_10101392 | 230 |
| 245 | 3300028023 | Ga0265357_1002577 | Ga0265357_10025773 | 230 |
| 246 | 3300028379 | Ga0268266_10361034 | Ga0268266_103610341 | 230 |
| 247 | 3300028381 | Ga0268264_10650440 | Ga0268264_106504401 | 230 |
| 248 | 3300030763 | Ga0265763_1000146 | Ga0265763_10001461 | 230 |
| 249 | 3300031018 | Ga0265773_1000199 | Ga0265773_10001992 | 230 |
| 250 | 3300031090 | Ga0265760_10038395 | Ga0265760_100383952 | 230 |
| 251 | 3300031090 | Ga0265760_10078908 | Ga0265760_100789082 | 230 |
| 252 | 3300031241 | Ga0265325_10000835 | Ga0265325_100008357 | 230 |
| 253 | 3300035111 | Ga0373923_0000166 | Ga0373923_0000166_10569_11261 | 230 |
| 254 | 3300035111 | Ga0373923_0073368 | Ga0373923_0073368_387_1079 | 230 |
| 255 | 3300035113 | Ga0373936_0000299 | Ga0373936_0000299_10472_11164 | 230 |
| 256 | 3300035115 | Ga0373941_0020266 | Ga0373941_0020266_50_742 | 230 |
| 257 | 3300035116 | Ga0373945_0000925 | Ga0373945_0000925_5802_6494 | 230 |
| 258 | 3300035116 | Ga0373945_0036573 | Ga0373945_0036573_85_837 | 230 |
| 259 | 3300035117 | Ga0373953_0065036 | Ga0373953_0065036_725_1417 | 230 |
| 260 | 3300035118 | Ga0373954_0023644 | Ga0373954_0023644_908_1600 | 230 |
| 261 | 3300035118 | Ga0373954_0053436 | Ga0373954_0053436_710_1402 | 230 |
| 262 | 3300035118 | Ga0373954_0119425 | Ga0373954_0119425_546_1238 | 230 |
| 263 | 3300035119 | Ga0373956_0008687 | Ga0373956_0008687_3177_3869 | 230 |
| 264 | 3300035119 | Ga0373956_0032349 | Ga0373956_0032349_997_1689 | 230 |
| 265 | 3300035120 | Ga0373957_0011455 | Ga0373957_0011455_374_1066 | 230 |
| 266 | 3300035170 | Ga0373943_0003656 | Ga0373943_0003656_486_1178 | 230 |
| 267 | 3300035170 | Ga0373943_0095805 | Ga0373943_0095805_244_936 | 230 |
| 268 | 3300035170 | Ga0373943_0261012 | Ga0373943_0261012_196_948 | 230 |
| 269 | 3300035171 | Ga0373946_0000961 | Ga0373946_0000961_5687_6379 | 230 |
| 270 | 3300035172 | Ga0373955_0000088 | Ga0373955_0000088_6645_7337 | 230 |
| 271 | 3300035241 | Ga0373961_0068248 | Ga0373961_0068248_261_953 | 230 |
| 272 | 3300035410 | Ga0373924_0001183 | Ga0373924_0001183_5229_5921 | 230 |
| 273 | 3300035410 | Ga0373924_0070500 | Ga0373924_0070500_251_976 | 230 |
| 274 | 3300035410 | Ga0373924_0192356 | Ga0373924_0192356_84_836 | 230 |
| 275 | 3300035691 | Ga0373931_0024128 | Ga0373931_0024128_121_813 | 230 |
| 276 | 3300035692 | Ga0373935_0000169 | Ga0373935_0000169_7141_7833 | 230 |
| 277 | 3300035692 | Ga0373935_0060649 | Ga0373935_0060649_923_1681 | 230 |
| 278 | 3300035692 | Ga0373935_0115676 | Ga0373935_0115676_381_1073 | 230 |
| 279 | 3300035695 | Ga0373927_0007789 | Ga0373927_0007789_1986_2678 | 230 |
| 280 | 3300035695 | Ga0373927_0064571 | Ga0373927_0064571_380_1132 | 230 |
| 281 | 3300035695 | Ga0373927_0266742 | Ga0373927_0266742_55_786 | 230 |
| 282 | 3300035724 | Ga0373933_0010891 | Ga0373933_0010891_1626_2318 | 230 |
| 283 | 3300035724 | Ga0373933_0033569 | Ga0373933_0033569_502_1227 | 230 |
| 284 | 3300035724 | Ga0373933_0057928 | Ga0373933_0057928_343_1035 | 230 |
| 285 | 3300035725 | Ga0373947_0000391 | Ga0373947_0000391_23091_23783 | 230 |
| 286 | 3300035725 | Ga0373947_0016862 | Ga0373947_0016862_2769_3527 | 230 |
| 287 | 3300035725 | Ga0373947_0023380 | Ga0373947_0023380_66_758 | 230 |
| 288 | 3300035725 | Ga0373947_0146756 | Ga0373947_0146756_781_1473 | 230 |
| 289 | 3300035725 | Ga0373947_0169402 | Ga0373947_0169402_610_1302 | 230 |
| 290 | 3300036401 | Ga0373937_0018907 | Ga0373937_0018907_1376_2068 | 230 |
| 291 | 3300036401 | Ga0373937_0021908 | Ga0373937_0021908_3181_3873 | 230 |
| 292 | 3300036401 | Ga0373937_0036243 | Ga0373937_0036243_1729_2421 | 230 |
| 293 | 3300036401 | Ga0373937_0091151 | Ga0373937_0091151_742_1485 | 230 |
| 294 | 3300036401 | Ga0373937_0406509 | Ga0373937_0406509_281_973 | 230 |
| 295 | 3300036401 | Ga0373937_0511186 | Ga0373937_0511186_211_903 | 230 |
| 296 | 3300036401 | Ga0373937_0594778 | Ga0373937_0594778_277_969 | 230 |
| 297 | 3300037068 | Ga0373925_0003861 | Ga0373925_0003861_6239_6931 | 230 |
| 298 | 3300037068 | Ga0373925_0041055 | Ga0373925_0041055_2108_2866 | 230 |
| 299 | 3300037068 | Ga0373925_0044133 | Ga0373925_0044133_683_1375 | 230 |
| 300 | 3300037068 | Ga0373925_0218021 | Ga0373925_0218021_760_1452 | 230 |
| 301 | 3300037068 | Ga0373925_0269468 | Ga0373925_0269468_470_1222 | 230 |
| 302 | 3300037068 | Ga0373925_0387349 | Ga0373925_0387349_29_754 | 230 |
| 303 | 3300037853 | Ga0436364_0093920 | Ga0436364_0093920_121_846 | 230 |
| 304 | 3300037853 | Ga0436364_0331243 | Ga0436364_0331243_1118_1810 | 230 |
| 305 | 3300037853 | Ga0436364_0345360 | Ga0436364_0345360_1038_1766 | 230 |
| 306 | 3300037853 | Ga0436364_0717863 | Ga0436364_0717863_123669_124394 | 230 |
| 307 | 3300037853 | Ga0436364_0990344 | Ga0436364_0990344_3571_4263 | 230 |
| 308 | 3300037853 | Ga0436364_1416468 | Ga0436364_1416468_25278_25970 | 230 |
| 309 | 3300037853 | Ga0436364_1558104 | Ga0436364_1558104_541_1245 | 230 |
| 310 | 3300038443 | Ga0395901_0736636 | Ga0395901_0736636_100_792 | 230 |
| 311 | 3300039437 | Ga0436365_0571973 | Ga0436365_0571973_35_727 | 230 |
| 312 | 3300039437 | Ga0436365_0687950 | Ga0436365_0687950_1594_2319 | 230 |
| 313 | 3300039437 | Ga0436365_0731168 | Ga0436365_0731168_4509_5213 | 230 |
| 314 | 3300039437 | Ga0436365_0815796 | Ga0436365_0815796_751_1443 | 230 |
| 315 | 3300039437 | Ga0436365_1176487 | Ga0436365_1176487_530_1222 | 230 |
| 316 | 3300039438 | Ga0436360_0282261 | Ga0436360_0282261_634_1326 | 230 |
| 317 | 3300039438 | Ga0436360_0545963 | Ga0436360_0545963_473_1165 | 230 |
| 318 | 3300039438 | Ga0436360_0714278 | Ga0436360_0714278_540_1265 | 230 |
| 319 | 3300039438 | Ga0436360_0735010 | Ga0436360_0735010_1270_1962 | 230 |
| 320 | 3300039438 | Ga0436360_0931475 | Ga0436360_0931475_857_1591 | 230 |
| 321 | 3300039447 | Ga0436361_0348596 | Ga0436361_0348596_158_850 | 230 |
| 322 | 3300039447 | Ga0436361_0447055 | Ga0436361_0447055_398_1090 | 230 |
| 323 | 3300039450 | Ga0436363_0132764 | Ga0436363_0132764_74_766 | 230 |
| 324 | 3300039450 | Ga0436363_0211088 | Ga0436363_0211088_485_1198 | 230 |
| 325 | 3300039450 | Ga0436363_1334541 | Ga0436363_1334541_339_1031 | 230 |
| 326 | 3300039450 | Ga0436363_1573494 | Ga0436363_1573494_150_842 | 230 |
| 327 | 3300039450 | Ga0436363_1698147 | Ga0436363_1698147_272_964 | 230 |
| 328 | 3300039453 | Ga0436362_0139666 | Ga0436362_0139666_137_829 | 230 |
| 329 | 3300039453 | Ga0436362_0334402 | Ga0436362_0334402_432_1124 | 230 |
| 330 | 3300041512 | Ga0451853_1236102 | Ga0451853_1236102_11_703 | 230 |
| 331 | 3300044673 | Ga0453683_0181713 | Ga0453683_0181713_83_775 | 230 |
| 332 | 3300045976 | Ga0466967_0141067 | Ga0466967_0141067_23_715 | 230 |
| 333 | 3300045976 | Ga0466967_0260574 | Ga0466967_0260574_854_1546 | 230 |
| 334 | 3300046453 | Ga0495627_038609 | Ga0495627_038609_151_903 | 230 |
| 335 | 3300046454 | Ga0495592_0000177 | Ga0495592_0000177_13926_14618 | 230 |
| 336 | 3300046455 | Ga0495603_0040160 | Ga0495603_0040160_390_1142 | 230 |
| 337 | 3300046458 | Ga0495591_056807 | Ga0495591_056807_13_765 | 230 |
| 338 | 3300046459 | Ga0495629_0006492 | Ga0495629_0006492_3581_4273 | 230 |
| 339 | 3300046459 | Ga0495629_0182340 | Ga0495629_0182340_413_1105 | 230 |
| 340 | 3300046460 | Ga0495638_0259909 | Ga0495638_0259909_37_789 | 230 |
| 341 | 3300046462 | Ga0495651_0000979 | Ga0495651_0000979_3854_4546 | 230 |
| 342 | 3300046462 | Ga0495651_0122649 | Ga0495651_0122649_279_1004 | 230 |
| 343 | 3300046463 | Ga0495653_0000054 | Ga0495653_0000054_1519_2211 | 230 |
| 344 | 3300046472 | Ga0495580_0320523 | Ga0495580_0320523_21_773 | 230 |
| 345 | 3300046472 | Ga0495580_0432690 | Ga0495580_0432690_20_712 | 230 |
| 346 | 3300046473 | Ga0495582_0050176 | Ga0495582_0050176_626_1318 | 230 |
| 347 | 3300046474 | Ga0495605_0066063 | Ga0495605_0066063_41_733 | 230 |
| 348 | 3300046476 | Ga0495662_0000766 | Ga0495662_0000766_12194_12886 | 230 |
| 349 | 3300046477 | Ga0495664_0000020 | Ga0495664_0000020_49472_50164 | 230 |
| 350 | 3300046492 | Ga0495585_0043838 | Ga0495585_0043838_1411_2163 | 230 |
| 351 | 3300046499 | Ga0495594_0292828 | Ga0495594_0292828_92_784 | 230 |
| 352 | 3300046500 | Ga0495596_0105358 | Ga0495596_0105358_177_929 | 230 |
| 353 | 3300046506 | Ga0495583_0194265 | Ga0495583_0194265_35_727 | 230 |
| 354 | 3300046511 | Ga0495608_0000024 | Ga0495608_0000024_58055_58747 | 230 |
| 355 | 3300046513 | Ga0495616_0046952 | Ga0495616_0046952_238_990 | 230 |
| 356 | 3300046514 | Ga0495618_0000020 | Ga0495618_0000020_100586_101278 | 230 |
| 357 | 3300046514 | Ga0495618_0078093 | Ga0495618_0078093_783_1514 | 230 |
| 358 | 3300046515 | Ga0495620_0166537 | Ga0495620_0166537_56_808 | 230 |
| 359 | 3300046516 | Ga0495628_0000015 | Ga0495628_0000015_97627_98319 | 230 |
| 360 | 3300046516 | Ga0495628_0085802 | Ga0495628_0085802_251_976 | 230 |
| 361 | 3300046517 | Ga0495630_0004598 | Ga0495630_0004598_6080_6772 | 230 |
| 362 | 3300046517 | Ga0495630_0318570 | Ga0495630_0318570_266_991 | 230 |
| 363 | 3300046518 | Ga0495631_0099698 | Ga0495631_0099698_323_1075 | 230 |
| 364 | 3300046520 | Ga0495637_0128284 | Ga0495637_0128284_165_917 | 230 |
| 365 | 3300046523 | Ga0495644_0170185 | Ga0495644_0170185_60_812 | 230 |
| 366 | 3300046525 | Ga0495663_0004714 | Ga0495663_0004714_1936_2688 | 230 |
| 367 | 3300046526 | Ga0495666_0239641 | Ga0495666_0239641_55_747 | 230 |
| 368 | 3300046528 | Ga0495642_0089840 | Ga0495642_0089840_286_1038 | 230 |
| 369 | 3300046529 | Ga0495652_0000006 | Ga0495652_0000006_358420_359112 | 230 |
| 370 | 3300046529 | Ga0495652_0107508 | Ga0495652_0107508_350_1075 | 230 |
| 371 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_545161_545853 | 230 |
| 372 | 3300046533 | Ga0495640_0379750 | Ga0495640_0379750_151_843 | 230 |
| 373 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_617617_618309 | 230 |
| 374 | 3300046537 | Ga0495598_0064323 | Ga0495598_0064323_132_884 | 230 |
| 375 | 3300046538 | Ga0495609_0032708 | Ga0495609_0032708_1534_2286 | 230 |
| 376 | 3300046539 | Ga0495621_0121861 | Ga0495621_0121861_152_904 | 230 |
| 377 | 3300046543 | Ga0495645_0000013 | Ga0495645_0000013_100578_101270 | 230 |
| 378 | 3300046559 | Ga0495667_0000030 | Ga0495667_0000030_105622_106314 | 230 |
| 379 | 3300046559 | Ga0495667_0014820 | Ga0495667_0014820_391_1083 | 230 |
| 380 | 3300046559 | Ga0495667_0182406 | Ga0495667_0182406_57_782 | 230 |
| 381 | 3300046615 | Ga0495656_0053523 | Ga0495656_0053523_36_788 | 230 |
| 382 | 3300046616 | Ga0495668_0192400 | Ga0495668_0192400_256_1008 | 230 |
| 383 | 3300046642 | Ga0495634_0000117 | Ga0495634_0000117_41550_42242 | 230 |
| 384 | 3300046642 | Ga0495634_0079685 | Ga0495634_0079685_766_1497 | 230 |
| 385 | 3300046642 | Ga0495634_0205963 | Ga0495634_0205963_14_706 | 230 |
| 386 | 3300046660 | Ga0495625_0270366 | Ga0495625_0270366_288_1040 | 230 |
| 387 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_603428_604120 | 230 |
| 388 | 3300046663 | Ga0495635_0500905 | Ga0495635_0500905_29_721 | 230 |
| 389 | 3300046664 | Ga0495659_0013021 | Ga0495659_0013021_201_893 | 230 |
| 390 | 3300046664 | Ga0495659_0121018 | Ga0495659_0121018_151_903 | 230 |
| 391 | 3300046665 | Ga0495661_0199633 | Ga0495661_0199633_227_919 | 230 |
| 392 | 3300046674 | Ga0495588_0239895 | Ga0495588_0239895_82_834 | 230 |
| 393 | 3300046675 | Ga0495657_0000028 | Ga0495657_0000028_88754_89446 | 230 |
| 394 | 3300046678 | Ga0495599_0000050 | Ga0495599_0000050_23811_24503 | 230 |
| 395 | 3300046679 | Ga0495623_0000013 | Ga0495623_0000013_78456_79148 | 230 |
| 396 | 3300046680 | Ga0495646_0000003 | Ga0495646_0000003_181416_182108 | 230 |
| 397 | 3300046681 | Ga0495647_0100191 | Ga0495647_0100191_229_921 | 230 |
| 398 | 3300046684 | Ga0495669_0024477 | Ga0495669_0024477_1580_2332 | 230 |
| 399 | 3300046689 | Ga0495613_0021178 | Ga0495613_0021178_4009_4701 | 230 |
| 400 | 3300046689 | Ga0495613_0078965 | Ga0495613_0078965_404_1096 | 230 |
| 401 | 3300046689 | Ga0495613_0154197 | Ga0495613_0154197_723_1454 | 230 |
| 402 | 3300046689 | Ga0495613_0328083 | Ga0495613_0328083_53_778 | 230 |
| 403 | 3300046690 | Ga0495624_0056500 | Ga0495624_0056500_220_912 | 230 |
| 404 | 3300046690 | Ga0495624_0343232 | Ga0495624_0343232_120_872 | 230 |
| 405 | 3300046691 | Ga0495670_0147332 | Ga0495670_0147332_384_1136 | 230 |
| 406 | 3300046692 | Ga0495671_0047371 | Ga0495671_0047371_188_940 | 230 |
| 407 | 3300046694 | Ga0495649_0197992 | Ga0495649_0197992_249_1001 | 230 |
| 408 | 3300046794 | Ga0495589_0035637 | Ga0495589_0035637_1289_2041 | 230 |
| 409 | 3300046809 | Ga0495600_0000002 | Ga0495600_0000002_88354_89046 | 230 |
| 410 | 3300047317 | Ga0495604_0000001 | Ga0495604_0000001_610410_611102 | 230 |
| 411 | 3300047319 | Ga0495674_0000018 | Ga0495674_0000018_105790_106482 | 230 |
| 412 | 3300047319 | Ga0495674_0395811 | Ga0495674_0395811_114_821 | 230 |
| 413 | 3300047321 | Ga0495676_0152296 | Ga0495676_0152296_662_1414 | 230 |
| 414 | 3300047322 | Ga0495680_0000159 | Ga0495680_0000159_50205_50897 | 230 |
| 415 | 3300047322 | Ga0495680_0319768 | Ga0495680_0319768_345_1070 | 230 |
| 416 | 3300047444 | Ga0495675_0000238 | Ga0495675_0000238_36114_36806 | 230 |
| 417 | 3300047445 | Ga0495677_0105890 | Ga0495677_0105890_30_782 | 230 |
| 418 | 3300047446 | Ga0495679_036712 | Ga0495679_036712_124_816 | 230 |
| 419 | 3300047469 | Ga0495673_0137378 | Ga0495673_0137378_100_852 | 230 |
| 420 | 3300047470 | Ga0495681_0062829 | Ga0495681_0062829_966_1658 | 230 |
| 421 | 3300047471 | Ga0495684_0000010 | Ga0495684_0000010_100686_101378 | 230 |
| 422 | 3300047471 | Ga0495684_0179653 | Ga0495684_0179653_448_1173 | 230 |
| 423 | 3300047673 | Ga0495593_0002061 | Ga0495593_0002061_7530_8222 | 230 |
| 424 | 3300048088 | Ga0495602_0000016 | Ga0495602_0000016_100488_101180 | 230 |
| 425 | 3300048088 | Ga0495602_0255476 | Ga0495602_0255476_553_1245 | 230 |
| 426 | 3300048090 | Ga0495615_0011448 | Ga0495615_0011448_919_1671 | 230 |
| 427 | 3300048903 | Ga0496100_0451663 | Ga0496100_0451663_212_904 | 230 |
| 428 | 3300048904 | Ga0496101_0077699 | Ga0496101_0077699_28_720 | 230 |
| 429 | 3300048905 | Ga0496102_0127417 | Ga0496102_0127417_1521_2273 | 230 |
| 430 | 3300048905 | Ga0496102_0197822 | Ga0496102_0197822_1152_1844 | 230 |
| 431 | 3300048906 | Ga0496103_0139777 | Ga0496103_0139777_596_1348 | 230 |
| 432 | 3300048907 | Ga0496104_0001464 | Ga0496104_0001464_15389_16081 | 230 |
| 433 | 3300048907 | Ga0496104_0027574 | Ga0496104_0027574_2023_2715 | 230 |
| 434 | 3300048907 | Ga0496104_0063381 | Ga0496104_0063381_640_1332 | 230 |
| 435 | 3300048907 | Ga0496104_0120841 | Ga0496104_0120841_1213_1965 | 230 |
| 436 | 3300048907 | Ga0496104_0252843 | Ga0496104_0252843_736_1428 | 230 |
| 437 | 3300048908 | Ga0496105_0050654 | Ga0496105_0050654_202_894 | 230 |
| 438 | 3300048909 | Ga0496106_0157028 | Ga0496106_0157028_637_1329 | 230 |
| 439 | 3300048909 | Ga0496106_0438514 | Ga0496106_0438514_267_1019 | 230 |
| 440 | 3300048910 | Ga0496107_0044462 | Ga0496107_0044462_38_790 | 230 |
| 441 | 3300048911 | Ga0496108_0098848 | Ga0496108_0098848_327_1019 | 230 |
| 442 | 3300048911 | Ga0496108_0137242 | Ga0496108_0137242_162_854 | 230 |
| 443 | 3300048911 | Ga0496108_0677655 | Ga0496108_0677655_147_839 | 230 |
| 444 | 3300048912 | Ga0496109_0113071 | Ga0496109_0113071_325_1017 | 230 |
| 445 | 3300048912 | Ga0496109_0225585 | Ga0496109_0225585_404_1156 | 230 |
| 446 | 3300048913 | Ga0496110_0275036 | Ga0496110_0275036_214_966 | 230 |
| 447 | 3300048913 | Ga0496110_0648710 | Ga0496110_0648710_101_793 | 230 |
| 448 | 3300048913 | Ga0496110_0904948 | Ga0496110_0904948_84_776 | 230 |
| 449 | 3300048914 | Ga0496111_0117835 | Ga0496111_0117835_391_1083 | 230 |
| 450 | 3300048914 | Ga0496111_0421819 | Ga0496111_0421819_217_969 | 230 |
| 451 | 3300048915 | Ga0496112_0061461 | Ga0496112_0061461_2437_3129 | 230 |
| 452 | 3300048915 | Ga0496112_0137720 | Ga0496112_0137720_1275_1967 | 230 |
| 453 | 3300048916 | Ga0496113_0088413 | Ga0496113_0088413_292_984 | 230 |
| 454 | 3300048916 | Ga0496113_0225347 | Ga0496113_0225347_292_1044 | 230 |
| 455 | 3300048917 | Ga0496114_0221558 | Ga0496114_0221558_441_1133 | 230 |
| 456 | 3300048917 | Ga0496114_0462138 | Ga0496114_0462138_107_859 | 230 |
| 457 | 3300048918 | Ga0496115_0085789 | Ga0496115_0085789_958_1650 | 230 |
| 458 | 3300048918 | Ga0496115_0095979 | Ga0496115_0095979_16_708 | 230 |
| 459 | 3300048918 | Ga0496115_0299156 | Ga0496115_0299156_319_1011 | 230 |
| 460 | 3300049574 | Ga0501038_0588284 | Ga0501038_0588284_53_745 | 230 |
| 461 | 3300049575 | Ga0501039_0209692 | Ga0501039_0209692_231_923 | 230 |
| 462 | 3300049576 | Ga0501040_0042041 | Ga0501040_0042041_869_1561 | 230 |
| 463 | 3300049577 | Ga0501041_0279026 | Ga0501041_0279026_64_756 | 230 |
| 464 | 3300049582 | Ga0501048_0231165 | Ga0501048_0231165_40_792 | 230 |
| 465 | 3300049584 | Ga0501068_0026678 | Ga0501068_0026678_2617_3309 | 230 |
| 466 | 3300049584 | Ga0501068_0236662 | Ga0501068_0236662_150_842 | 230 |
| 467 | 3300049585 | Ga0501069_0123758 | Ga0501069_0123758_639_1331 | 230 |
| 468 | 3300049586 | Ga0501070_0083902 | Ga0501070_0083902_236_931 | 230 |
| 469 | 3300049587 | Ga0501071_0374381 | Ga0501071_0374381_196_888 | 230 |
| 470 | 3300049588 | Ga0501072_0012735 | Ga0501072_0012735_523_1263 | 230 |
| 471 | 3300049588 | Ga0501072_0189789 | Ga0501072_0189789_569_1321 | 230 |
| 472 | 3300049588 | Ga0501072_0217010 | Ga0501072_0217010_601_1293 | 230 |
| 473 | 3300049591 | Ga0501075_0007759 | Ga0501075_0007759_5324_6016 | 230 |
| 474 | 3300049591 | Ga0501075_0158315 | Ga0501075_0158315_973_1713 | 230 |
| 475 | 3300049592 | Ga0501076_0060503 | Ga0501076_0060503_2057_2749 | 230 |
| 476 | 3300049592 | Ga0501076_0170406 | Ga0501076_0170406_612_1352 | 230 |
| 477 | 3300049592 | Ga0501076_0398333 | Ga0501076_0398333_12_704 | 230 |
| 478 | 3300049593 | Ga0501077_0091358 | Ga0501077_0091358_783_1523 | 230 |
| 479 | 3300049741 | Ga0501079_0093542 | Ga0501079_0093542_228_920 | 230 |
| 480 | 3300049742 | Ga0501080_0429539 | Ga0501080_0429539_409_1161 | 230 |
| 481 | 3300049743 | Ga0501081_0101820 | Ga0501081_0101820_327_1019 | 230 |
| 482 | 3300049743 | Ga0501081_0206157 | Ga0501081_0206157_257_997 | 230 |
| 483 | 3300049744 | Ga0501083_0324863 | Ga0501083_0324863_111_803 | 230 |
| 484 | 3300050492 | nmdc:mga0yw44_541195_c1 | nmdc:mga0yw44_541195_c1_53_745 | 230 |
| 485 | 3300050507 | nmdc:mga05p37_23571_c1 | nmdc:mga05p37_23571_c1_591_1283 | 230 |
| 486 | 3300050507 | nmdc:mga05p37_432074_c1 | nmdc:mga05p37_432074_c1_754_1446 | 230 |
| 487 | 3300050509 | nmdc:mga0qj67_111_c1 | nmdc:mga0qj67_111_c1_31030_31725 | 230 |
| 488 | 3300050510 | nmdc:mga06r32_74968_c1 | nmdc:mga06r32_74968_c1_2354_3046 | 230 |
| 489 | 3300050511 | nmdc:mga08y16_487764_c1 | nmdc:mga08y16_487764_c1_68_796 | 230 |
| 490 | 3300050511 | nmdc:mga08y16_719570_c1 | nmdc:mga08y16_719570_c1_162_914 | 230 |
| 491 | 3300050512 | nmdc:mga0n895_21602_c1 | nmdc:mga0n895_21602_c1_3123_3815 | 230 |
| 492 | 3300050512 | nmdc:mga0n895_283683_c1 | nmdc:mga0n895_283683_c1_470_1162 | 230 |
| 493 | 3300050512 | nmdc:mga0n895_454163_c1 | nmdc:mga0n895_454163_c1_457_1149 | 230 |
| 494 | 3300050512 | nmdc:mga0n895_939816_c1 | nmdc:mga0n895_939816_c1_71_763 | 230 |
| 495 | 3300050513 | nmdc:mga0rr50_131909_c1 | nmdc:mga0rr50_131909_c1_605_1297 | 230 |
| 496 | 3300050513 | nmdc:mga0rr50_206620_c1 | nmdc:mga0rr50_206620_c1_582_1274 | 230 |
| 497 | 3300050514 | nmdc:mga08x19_16623_c1 | nmdc:mga08x19_16623_c1_3203_3895 | 230 |
| 498 | 3300050514 | nmdc:mga08x19_48164_c1 | nmdc:mga08x19_48164_c1_1407_2099 | 230 |
| 499 | 3300053077 | Ga0495601_0000021 | Ga0495601_0000021_100568_101260 | 230 |
| 500 | 3300053077 | Ga0495601_0013904 | Ga0495601_0013904_198_923 | 230 |
| 501 | 3300053077 | Ga0495601_0066819 | Ga0495601_0066819_928_1635 | 230 |
| 502 | 3300053078 | Ga0495612_0000018 | Ga0495612_0000018_100579_101271 | 230 |
| 503 | 3300053083 | Ga0495655_0005056 | Ga0495655_0005056_1468_2220 | 230 |
| 504 | 3300053084 | Ga0495595_0000028 | Ga0495595_0000028_33516_34208 | 230 |
| 505 | 3300053084 | Ga0495595_0016963 | Ga0495595_0016963_2062_2787 | 230 |
| 506 | 3300053084 | Ga0495595_0139064 | Ga0495595_0139064_399_1091 | 230 |
| 507 | 3300053085 | Ga0495619_0000006 | Ga0495619_0000006_326033_326725 | 230 |
| 508 | 3300053085 | Ga0495619_0003473 | Ga0495619_0003473_4875_5600 | 230 |
| 509 | 3300053085 | Ga0495619_0043003 | Ga0495619_0043003_473_1165 | 230 |
| 510 | 3300053085 | Ga0495619_0072766 | Ga0495619_0072766_788_1531 | 230 |
| 511 | 3300053730 | Ga0500645_054975 | Ga0500645_054975_15_779 | 230 |
| 512 | 3300054114 | Ga0501084_0063617 | Ga0501084_0063617_79_771 | 230 |
| 513 | 3300054114 | Ga0501084_0096416 | Ga0501084_0096416_457_1197 | 230 |
| 514 | 3300059624 | Ga0587109_055080 | Ga0587109_055080_61_753 | 230 |
| 515 | 3300059641 | Ga0587068_042159 | Ga0587068_042159_123_815 | 230 |
| 516 | 3300060344 | Ga0587071_032368 | Ga0587071_032368_208_903 | 230 |
| 517 | 3300060353 | Ga0501082_0139236 | Ga0501082_0139236_250_942 | 230 |
| 518 | 3300061734 | Ga0530510_0011205 | Ga0530510_0011205_5046_5786 | 230 |
| 519 | 3300061734 | Ga0530510_0468425 | Ga0530510_0468425_86_778 | 230 |
| 520 | 3300003215 | JGI25153J46596_10002741 | JGI25153J46596_100027418 | 231 |
| 521 | 3300003215 | JGI25153J46596_10003269 | JGI25153J46596_100032698 | 231 |
| 522 | 3300005295 | Ga0065707_10142897 | Ga0065707_101428972 | 231 |
| 523 | 3300005338 | Ga0068868_100384805 | Ga0068868_1003848052 | 231 |
| 524 | 3300005340 | Ga0070689_100001797 | Ga0070689_1000017972 | 231 |
| 525 | 3300005343 | Ga0070687_100098622 | Ga0070687_1000986221 | 231 |
| 526 | 3300005347 | Ga0070668_100154075 | Ga0070668_1001540753 | 231 |
| 527 | 3300005353 | Ga0070669_100168193 | Ga0070669_1001681932 | 231 |
| 528 | 3300005354 | Ga0070675_100243754 | Ga0070675_1002437541 | 231 |
| 529 | 3300005367 | Ga0070667_100216190 | Ga0070667_1002161902 | 231 |
| 530 | 3300005456 | Ga0070678_100004761 | Ga0070678_1000047613 | 231 |
| 531 | 3300005459 | Ga0068867_100184693 | Ga0068867_1001846933 | 231 |
| 532 | 3300005466 | Ga0070685_10079735 | Ga0070685_100797351 | 231 |
| 533 | 3300005543 | Ga0070672_100397726 | Ga0070672_1003977261 | 231 |
| 534 | 3300005544 | Ga0070686_100069280 | Ga0070686_1000692802 | 231 |
| 535 | 3300005617 | Ga0068859_100086931 | Ga0068859_1000869312 | 231 |
| 536 | 3300005618 | Ga0068864_100012195 | Ga0068864_1000121958 | 231 |
| 537 | 3300005840 | Ga0068870_10225182 | Ga0068870_102251822 | 231 |
| 538 | 3300006051 | Ga0075364_10092115 | Ga0075364_100921152 | 231 |
| 539 | 3300006195 | Ga0075366_10010050 | Ga0075366_100100505 | 231 |
| 540 | 3300006195 | Ga0075366_10028122 | Ga0075366_100281222 | 231 |
| 541 | 3300006353 | Ga0075370_10210826 | Ga0075370_102108262 | 231 |
| 542 | 3300006358 | Ga0068871_100400749 | Ga0068871_1004007492 | 231 |
| 543 | 3300006881 | Ga0068865_100423815 | Ga0068865_1004238151 | 231 |
| 544 | 3300006931 | Ga0097620_100086930 | Ga0097620_1000869304 | 231 |
| 545 | 3300009011 | Ga0105251_10113130 | Ga0105251_101131302 | 231 |
| 546 | 3300009094 | Ga0111539_10370439 | Ga0111539_103704392 | 231 |
| 547 | 3300009094 | Ga0111539_10979917 | Ga0111539_109799171 | 231 |
| 548 | 3300009148 | Ga0105243_11012657 | Ga0105243_110126571 | 231 |
| 549 | 3300009177 | Ga0105248_11239949 | Ga0105248_112399491 | 231 |
| 550 | 3300009551 | Ga0105238_10368154 | Ga0105238_103681542 | 231 |
| 551 | 3300010159 | Ga0099796_10033213 | Ga0099796_100332132 | 231 |
| 552 | 3300013297 | Ga0157378_10421473 | Ga0157378_104214732 | 231 |
| 553 | 3300014325 | Ga0163163_10198649 | Ga0163163_101986492 | 231 |
| 554 | 3300014968 | Ga0157379_10343481 | Ga0157379_103434811 | 231 |
| 555 | 3300025297 | Ga0209758_1000556 | Ga0209758_100055637 | 231 |
| 556 | 3300025899 | Ga0207642_10236439 | Ga0207642_102364391 | 231 |
| 557 | 3300025903 | Ga0207680_10293954 | Ga0207680_102939541 | 231 |
| 558 | 3300025907 | Ga0207645_10124337 | Ga0207645_101243371 | 231 |
| 559 | 3300025908 | Ga0207643_10129294 | Ga0207643_101292942 | 231 |
| 560 | 3300025918 | Ga0207662_10041647 | Ga0207662_100416472 | 231 |
| 561 | 3300025923 | Ga0207681_10030702 | Ga0207681_100307025 | 231 |
| 562 | 3300025931 | Ga0207644_10008375 | Ga0207644_100083758 | 231 |
| 563 | 3300025932 | Ga0207690_10532684 | Ga0207690_105326842 | 231 |
| 564 | 3300025936 | Ga0207670_10000669 | Ga0207670_1000066913 | 231 |
| 565 | 3300025936 | Ga0207670_10222232 | Ga0207670_102222322 | 231 |
| 566 | 3300025940 | Ga0207691_10423237 | Ga0207691_104232372 | 231 |
| 567 | 3300025941 | Ga0207711_10004469 | Ga0207711_100044691 | 231 |
| 568 | 3300025972 | Ga0207668_10254062 | Ga0207668_102540622 | 231 |
| 569 | 3300025986 | Ga0207658_10813926 | Ga0207658_108139262 | 231 |
| 570 | 3300026088 | Ga0207641_10178641 | Ga0207641_101786413 | 231 |
| 571 | 3300026095 | Ga0207676_10007140 | Ga0207676_100071402 | 231 |
| 572 | 3300035084 | Ga0373928_0025554 | Ga0373928_0025554_66_761 | 231 |
| 573 | 3300035088 | Ga0373940_0012575 | Ga0373940_0012575_419_1114 | 231 |
| 574 | 3300035121 | Ga0373960_0008244 | Ga0373960_0008244_13_708 | 231 |
| 575 | 3300035207 | Ga0373942_0010665 | Ga0373942_0010665_998_1693 | 231 |
| 576 | 3300035691 | Ga0373931_0000647 | Ga0373931_0000647_12837_13532 | 231 |
| 577 | 3300035692 | Ga0373935_0217235 | Ga0373935_0217235_305_1000 | 231 |
| 578 | 3300035695 | Ga0373927_0249731 | Ga0373927_0249731_227_922 | 231 |
| 579 | 3300044684 | Ga0466966_0254124 | Ga0466966_0254124_136_831 | 231 |
| 580 | 3300044694 | Ga0466963_0203905 | Ga0466963_0203905_238_933 | 231 |
| 581 | 3300044842 | Ga0466957_0006539 | Ga0466957_0006539_2145_2840 | 231 |
| 582 | 3300045049 | Ga0466959_0074041 | Ga0466959_0074041_501_1196 | 231 |
| 583 | 3300045836 | Ga0466958_0012851 | Ga0466958_0012851_3414_4109 | 231 |
| 584 | 3300046516 | Ga0495628_0116727 | Ga0495628_0116727_1012_1707 | 231 |
| 585 | 3300048088 | Ga0495602_0291571 | Ga0495602_0291571_388_1083 | 231 |
| 586 | 3300048903 | Ga0496100_0005934 | Ga0496100_0005934_2281_2976 | 231 |
| 587 | 3300048904 | Ga0496101_0030655 | Ga0496101_0030655_851_1546 | 231 |
| 588 | 3300048905 | Ga0496102_0201613 | Ga0496102_0201613_790_1485 | 231 |
| 589 | 3300048907 | Ga0496104_0008482 | Ga0496104_0008482_4068_4763 | 231 |
| 590 | 3300048908 | Ga0496105_0008536 | Ga0496105_0008536_5589_6284 | 231 |
| 591 | 3300048909 | Ga0496106_0004688 | Ga0496106_0004688_4958_5653 | 231 |
| 592 | 3300048910 | Ga0496107_0022592 | Ga0496107_0022592_857_1552 | 231 |
| 593 | 3300048911 | Ga0496108_0020417 | Ga0496108_0020417_4234_4929 | 231 |
| 594 | 3300048912 | Ga0496109_0023504 | Ga0496109_0023504_2065_2760 | 231 |
| 595 | 3300048913 | Ga0496110_0080249 | Ga0496110_0080249_1073_1768 | 231 |
| 596 | 3300048915 | Ga0496112_0145391 | Ga0496112_0145391_14_709 | 231 |
| 597 | 3300048917 | Ga0496114_0002311 | Ga0496114_0002311_5713_6408 | 231 |
| 598 | 3300048918 | Ga0496115_0004279 | Ga0496115_0004279_4680_5375 | 231 |
| 599 | 3300049571 | Ga0501034_0673294 | Ga0501034_0673294_50_748 | 231 |
| 600 | 3300050493 | nmdc:mga0k408_18038_c1 | nmdc:mga0k408_18038_c1_2639_3334 | 231 |
| 601 | 3300050493 | nmdc:mga0k408_66438_c1 | nmdc:mga0k408_66438_c1_139_834 | 231 |
| 602 | 3300050496 | nmdc:mga07m45_163672_c1 | nmdc:mga07m45_163672_c1_193_912 | 231 |
| 603 | 3300050511 | nmdc:mga08y16_739669_c1 | nmdc:mga08y16_739669_c1_258_953 | 231 |
| 604 | 3300053077 | Ga0495601_0304376 | Ga0495601_0304376_282_977 | 231 |
| 605 | 3300053078 | Ga0495612_0046107 | Ga0495612_0046107_15_710 | 231 |
| 606 | 3300053084 | Ga0495595_0074225 | Ga0495595_0074225_243_938 | 231 |
| 607 | 3300053153 | Ga0500616_0069291 | Ga0500616_0069291_566_1261 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4g10-assembly1.cif.gz_A | ligg from sphingobium sp. syk-6 is related to the glutathione transferase omega class | 0.9146 | 4 | 213 |
| 5kej-assembly1.cif.gz_B | crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione | 0.9015 | 4 | 211 |
| 7dwf-assembly2.cif.gz_B | crystal structure of a glutathione s-transferase mutant sbgstu7(t53i) from salix babylonica | 0.8935 | 5 | 207 |
| 7dwe-assembly1.cif.gz_A | crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica in complex with glutathione | 0.8906 | 4 | 207 |
| 3lfl-assembly2.cif.gz_C | crystal structure of human glutathione transferase omega 1, delta 155 | 0.8852 | 3 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VSL6_6_114_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9357 | 4 | 91 | 3.40.30.10 |
| af_Q9VSL3_17_104_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9193 | 4 | 80 | 3.40.30.10 |
| 5g5fA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9165 | 4 | 75 | 3.40.30.10 |
| 4ke3D01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9128 | 4 | 77 | 3.40.30.10 |
| af_P0ACA3_4_88_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9121 | 4 | 81 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7WSS6-F1-model_v4 | Glutathione S-transferase | 0.9836 | 1 | 219 |
GO:0005737
|
| AF-A0A1Q7WSS6-F1-model_v4 | Glutathione S-transferase | 0.9747 | 1 | 219 |
GO:0005737
|
| AF-A0A7C2YTY6-F1-model_v4 | glutathione transferase (EC 2.5.1.18) | 0.9551 | 2 | 226 |
GO:0005737
GO:0016740 |
| AF-A0A7X1TWE0-F1-model_v4 | Glutathione S-transferase family protein | 0.9514 | 2 | 225 |
GO:0005737
GO:0016740 |
| AF-A0A1G7HYC5-F1-model_v4 | deleted | 0.948 | 3 | 222 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar