F468700

General Info

Members Datasets Scaffolds Average Seq Length
607 332 607 234

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10038395|Ga0265760_100383952
Length 266
Sequence MIEIGNAGTLACIPPSKGVESPQAHARWRELSGEDIMAKYLLVSFKTCPWVQRAAIVLREKNIDFEFRHIEPDNRPDWFLAISPHKKVPVLRVDDKVSLFESNAINEYLDETIAPRLHPDDPVLRAINRAWTDYVPTFADSVTGTAYADDEAAYKAAAAKIPVAFERLERALEKQGAGPFFNGAKYSLVDAAYAPFLQRYFFLDRIRPLGVIEKFPRLKAWADALMKRASTHSFPEAEFETLYRTNVRRRNKWVSQFIADVAVAAE

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
100 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
319 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
323 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
324 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
325 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.29
Nodule 0
Rhizoplane 7.58
Rhizosphere 85.17
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002741 3300003215 Bacteria 10031
2 JGI25153J46596_10003269 3300003215 Bacteria 9110
3 Ga0065707_10142897 3300005295 Bacteria 1749
4 Ga0070683_100212096 3300005329 Bacteria 1840
5 Ga0070683_100573869 3300005329 Bacteria 1079
6 Ga0070680_100148352 3300005336 Bacteria 1968
7 Ga0070682_100057326 3300005337 Bacteria 2454
8 Ga0068868_100384805 3300005338 Bacteria 1208
9 Ga0070660_100069799 3300005339 Bacteria 2741
10 Ga0070660_100259150 3300005339 Bacteria 1420
11 Ga0070689_100001797 3300005340 Bacteria 13779
12 Ga0070687_100098622 3300005343 Bacteria 1631
13 Ga0070668_100129084 3300005347 Bacteria 2027
14 Ga0070668_100154075 3300005347 Bacteria 1861
15 Ga0070668_100870852 3300005347 Bacteria 804
16 Ga0070669_100076542 3300005353 Bacteria 2484
17 Ga0070669_100168193 3300005353 Bacteria 1708
18 Ga0070675_100182890 3300005354 Bacteria 1813
19 Ga0070675_100243754 3300005354 Bacteria 1571
20 Ga0070675_100438082 3300005354 Bacteria 1171
21 Ga0070671_100495664 3300005355 Unclassified 1050
22 Ga0070674_100008624 3300005356 Bacteria 6076
23 Ga0070688_100251439 3300005365 Unclassified 1259
24 Ga0070659_100031970 3300005366 Bacteria 4079
25 Ga0070667_100216190 3300005367 Bacteria 1705
26 Ga0070709_10065986 3300005434 Bacteria 2319
27 Ga0070709_10095937 3300005434 Bacteria 1965
28 Ga0070709_10390416 3300005434 Bacteria 1037
29 Ga0070714_100003291 3300005435 Bacteria 12042
30 Ga0070714_100028108 3300005435 Bacteria 4662
31 Ga0070714_100102155 3300005435 Bacteria 2527
32 Ga0070713_100037240 3300005436 Unclassified 3932
33 Ga0070713_100049101 3300005436 Bacteria 3479
34 Ga0070713_100116722 3300005436 Bacteria 2334
35 Ga0070713_100660947 3300005436 Bacteria 996
36 Ga0070710_10001459 3300005437 Bacteria 11139
37 Ga0070710_10081702 3300005437 Bacteria 1888
38 Ga0070711_100014338 3300005439 Bacteria 4993
39 Ga0070711_100055931 3300005439 Bacteria 2727
40 Ga0070711_100569167 3300005439 Bacteria 942
41 Ga0070663_100121491 3300005455 Bacteria 1973
42 Ga0070678_100004761 3300005456 Bacteria 7742
43 Ga0070678_100399280 3300005456 Bacteria 1194
44 Ga0070681_10062094 3300005458 Bacteria 3710
45 Ga0070681_10063112 3300005458 Bacteria 3677
46 Ga0070681_10088384 3300005458 Bacteria 3050
47 Ga0070681_10102719 3300005458 Bacteria 2804
48 Ga0070681_10222380 3300005458 Unclassified 1803
49 Ga0068867_100184693 3300005459 Bacteria 1660
50 Ga0070685_10079735 3300005466 Bacteria 1960
51 Ga0070685_10142607 3300005466 Bacteria 1510
52 Ga0070706_100078060 3300005467 Bacteria 3065
53 Ga0070706_100242459 3300005467 Bacteria 1683
54 Ga0070706_100616988 3300005467 Unclassified 1007
55 Ga0070707_100021284 3300005468 Bacteria 6129
56 Ga0070698_100016820 3300005471 Bacteria 7714
57 Ga0070698_100045574 3300005471 Bacteria 4488
58 Ga0070698_100141303 3300005471 Bacteria 2358
59 Ga0070698_100219444 3300005471 Unclassified 1835
60 Ga0070699_100184265 3300005518 Bacteria 1853
61 Ga0070679_100042019 3300005530 Bacteria 4552
62 Ga0070679_100104320 3300005530 Bacteria 2821
63 Ga0070679_100130602 3300005530 Bacteria 2493
64 Ga0070697_100063371 3300005536 Bacteria 3019
65 Ga0070697_100246573 3300005536 Unclassified 1527
66 Ga0070672_100253996 3300005543 Bacteria 1481
67 Ga0070672_100264560 3300005543 Bacteria 1451
68 Ga0070672_100397726 3300005543 Bacteria 1181
69 Ga0070686_100069280 3300005544 Bacteria 2303
70 Ga0070686_100316159 3300005544 Bacteria 1163
71 Ga0070695_100525161 3300005545 Bacteria 919
72 Ga0070665_100218448 3300005548 Bacteria 1906
73 Ga0068857_100149519 3300005577 Bacteria 2115
74 Ga0068854_100343370 3300005578 Unclassified 1220
75 Ga0068856_100255748 3300005614 Bacteria 1766
76 Ga0068852_100515909 3300005616 Bacteria 1192
77 Ga0068859_100086931 3300005617 Bacteria 3173
78 Ga0068864_100012195 3300005618 Bacteria 7104
79 Ga0068866_10195202 3300005718 Unclassified 1205
80 Ga0068870_10187119 3300005840 Unclassified 1247
81 Ga0068870_10225182 3300005840 Bacteria 1150
82 Ga0068858_100267609 3300005842 Bacteria 1625
83 Ga0068858_100987683 3300005842 Unclassified 825
84 Ga0068860_100139332 3300005843 Bacteria 2331
85 Ga0081455_10006759 3300005937 Bacteria 12238
86 Ga0081455_10300666 3300005937 Bacteria 1151
87 Ga0081540_1050097 3300005983 Unclassified 2077
88 Ga0081540_1162125 3300005983 Bacteria 866
89 Ga0070717_10027202 3300006028 Unclassified 4570
90 Ga0070717_10060234 3300006028 Bacteria 3143
91 Ga0070717_10250017 3300006028 Bacteria 1566
92 Ga0070717_10846068 3300006028 Unclassified 832
93 Ga0075365_10234337 3300006038 Bacteria 1289
94 Ga0075365_10582862 3300006038 Bacteria 791
95 Ga0075364_10092115 3300006051 Bacteria 2012
96 Ga0075364_10153470 3300006051 Bacteria 1552
97 Ga0070716_100097360 3300006173 Bacteria 1795
98 Ga0070716_100243469 3300006173 Bacteria 1221
99 Ga0070712_100017585 3300006175 Bacteria 4631
100 Ga0070712_100022645 3300006175 Bacteria 4140
101 Ga0070712_100032258 3300006175 Bacteria 3536
102 Ga0070712_100063239 3300006175 Bacteria 2620
103 Ga0070712_100112306 3300006175 Bacteria 2035
104 Ga0070712_100113030 3300006175 Bacteria 2030
105 Ga0070712_100148770 3300006175 Bacteria 1795
106 Ga0070712_100473919 3300006175 Unclassified 1046
107 Ga0075366_10010050 3300006195 Bacteria 5304
108 Ga0075366_10028122 3300006195 Bacteria 3299
109 Ga0097621_100111027 3300006237 Bacteria 2317
110 Ga0097621_100300723 3300006237 Bacteria 1417
111 Ga0075370_10210826 3300006353 Bacteria 1147
112 Ga0068871_100131839 3300006358 Bacteria 2120
113 Ga0068871_100329314 3300006358 Bacteria 1347
114 Ga0068871_100400749 3300006358 Bacteria 1222
115 Ga0075428_100073107 3300006844 Bacteria 3744
116 Ga0075430_100000311 3300006846 Bacteria 34566
117 Ga0075431_100196082 3300006847 Unclassified 2067
118 Ga0075434_100190454 3300006871 Bacteria 2071
119 Ga0075434_100776665 3300006871 Bacteria 975
120 Ga0075434_101120770 3300006871 Bacteria 800
121 Ga0075429_100257534 3300006880 Bacteria 1528
122 Ga0068865_100183851 3300006881 Bacteria 1611
123 Ga0068865_100423815 3300006881 Bacteria 1095
124 Ga0075436_100115320 3300006914 Bacteria 1876
125 Ga0097620_100086930 3300006931 Bacteria 3173
126 Ga0075435_100165663 3300007076 Bacteria 1863
127 Ga0075435_100579291 3300007076 Bacteria 973
128 Ga0099795_10148462 3300007788 Bacteria 958
129 Ga0105251_10113130 3300009011 Bacteria 1236
130 Ga0105240_10096152 3300009093 Bacteria 3610
131 Ga0111539_10370439 3300009094 Bacteria 1667
132 Ga0111539_10725908 3300009094 Bacteria 1157
133 Ga0111539_10866943 3300009094 Bacteria 1050
134 Ga0111539_10979917 3300009094 Bacteria 983
135 Ga0105247_10045669 3300009101 Bacteria 2688
136 Ga0114129_10219641 3300009147 Bacteria 2564
137 Ga0114129_10351990 3300009147 Bacteria 1951
138 Ga0114129_10935511 3300009147 Bacteria 1096
139 Ga0105243_10048514 3300009148 Bacteria 3347
140 Ga0105243_11012657 3300009148 Bacteria 834
141 Ga0105243_11358179 3300009148 Bacteria 730
142 Ga0105241_10266721 3300009174 Bacteria 1457
143 Ga0105242_10576158 3300009176 Unclassified 1083
144 Ga0105248_11239949 3300009177 Bacteria 843
145 Ga0105238_10368154 3300009551 Bacteria 1427
146 Ga0105249_10076826 3300009553 Bacteria 3096
147 Ga0105249_10155222 3300009553 Bacteria 2207
148 Ga0099796_10032463 3300010159 Bacteria 1711
149 Ga0099796_10033213 3300010159 Bacteria 1696
150 Ga0099796_10169199 3300010159 Bacteria 871
151 Ga0105239_10173617 3300010375 Bacteria 2411
152 Ga0105246_10414388 3300011119 Bacteria 1122
153 Ga0157373_10080150 3300013100 Bacteria 2302
154 Ga0157370_10020408 3300013104 Bacteria 6618
155 Ga0157370_10121794 3300013104 Bacteria 2435
156 Ga0157369_10018726 3300013105 Bacteria 7764
157 Ga0157369_10472985 3300013105 Bacteria 1297
158 Ga0157369_10723057 3300013105 Bacteria 1025
159 Ga0157374_10306703 3300013296 Unclassified 1571
160 Ga0157374_10316641 3300013296 Bacteria 1545
161 Ga0157378_10048576 3300013297 Bacteria 3774
162 Ga0157378_10421473 3300013297 Bacteria 1319
163 Ga0157378_10581171 3300013297 Bacteria 1129
164 Ga0157375_10096304 3300013308 Bacteria 3032
165 Ga0163163_10073091 3300014325 Bacteria 3419
166 Ga0163163_10132407 3300014325 Bacteria 2534
167 Ga0163163_10198649 3300014325 Bacteria 2054
168 Ga0157380_10373703 3300014326 Unclassified 1343
169 Ga0157380_10399533 3300014326 Bacteria 1303
170 Ga0157377_10221221 3300014745 Bacteria 1212
171 Ga0157377_10269406 3300014745 Unclassified 1111
172 Ga0157379_10189136 3300014968 Bacteria 1860
173 Ga0157379_10343481 3300014968 Bacteria 1365
174 Ga0157376_10832064 3300014969 Bacteria 937
175 Ga0163161_10077851 3300017792 Bacteria 2436
176 Ga0163161_10145509 3300017792 Unclassified 1797
177 Ga0213873_10084673 3300021358 Bacteria 892
178 Ga0213874_10059850 3300021377 Unclassified 1190
179 Ga0213876_10019072 3300021384 Bacteria 3622
180 Ga0213875_10000132 3300021388 Bacteria 82929
181 Ga0213875_10000232 3300021388 Bacteria 56352
182 Ga0213875_10003695 3300021388 Bacteria 8629
183 Ga0213875_10133708 3300021388 Bacteria 1160
184 Ga0224572_1023763 3300024225 Bacteria 1177
185 Ga0228598_1013877 3300024227 Bacteria 1594
186 Ga0209758_1000556 3300025297 Bacteria 59164
187 Ga0207692_10032005 3300025898 Unclassified 2523
188 Ga0207692_10102390 3300025898 Bacteria 1575
189 Ga0207692_10193683 3300025898 Bacteria 1191
190 Ga0207692_10282143 3300025898 Bacteria 1005
191 Ga0207642_10236439 3300025899 Bacteria 1029
192 Ga0207710_10156735 3300025900 Bacteria 1107
193 Ga0207688_10153704 3300025901 Bacteria 1361
194 Ga0207680_10293954 3300025903 Bacteria 1131
195 Ga0207685_10046890 3300025905 Bacteria 1647
196 Ga0207699_10015964 3300025906 Unclassified 3916
197 Ga0207645_10124337 3300025907 Bacteria 1676
198 Ga0207643_10129294 3300025908 Bacteria 1501
199 Ga0207684_10037507 3300025910 Bacteria 4112
200 Ga0207684_10100380 3300025910 Unclassified 2473
201 Ga0207684_10169313 3300025910 Bacteria 1883
202 Ga0207707_10012496 3300025912 Bacteria 7382
203 Ga0207707_10164919 3300025912 Bacteria 1936
204 Ga0207707_10507829 3300025912 Bacteria 1027
205 Ga0207695_10085943 3300025913 Bacteria 3173
206 Ga0207695_10165974 3300025913 Bacteria 2136
207 Ga0207695_10511669 3300025913 Bacteria 1082
208 Ga0207693_10000650 3300025915 Bacteria 31123
209 Ga0207693_10011145 3300025915 Bacteria 7282
210 Ga0207693_10064984 3300025915 Bacteria 2857
211 Ga0207693_10077628 3300025915 Bacteria 2600
212 Ga0207693_10080380 3300025915 Bacteria 2552
213 Ga0207693_10100350 3300025915 Bacteria 2269
214 Ga0207693_10425530 3300025915 Unclassified 1038
215 Ga0207663_10050958 3300025916 Unclassified 2575
216 Ga0207663_10224023 3300025916 Bacteria 1370
217 Ga0207663_10495324 3300025916 Bacteria 949
218 Ga0207663_10725607 3300025916 Bacteria 788
219 Ga0207660_10122584 3300025917 Bacteria 1970
220 Ga0207660_10192200 3300025917 Bacteria 1590
221 Ga0207662_10041647 3300025918 Bacteria 2704
222 Ga0207662_10066994 3300025918 Bacteria 2165
223 Ga0207662_10134376 3300025918 Bacteria 1562
224 Ga0207657_10108172 3300025919 Bacteria 2298
225 Ga0207652_10022390 3300025921 Bacteria 5228
226 Ga0207652_10062636 3300025921 Bacteria 3214
227 Ga0207652_10636711 3300025921 Bacteria 954
228 Ga0207652_10912107 3300025921 Bacteria 776
229 Ga0207646_10180744 3300025922 Unclassified 1905
230 Ga0207646_10753185 3300025922 Bacteria 869
231 Ga0207681_10030702 3300025923 Bacteria 3505
232 Ga0207694_10324279 3300025924 Unclassified 1271
233 Ga0207659_10164711 3300025926 Bacteria 1744
234 Ga0207659_10482953 3300025926 Bacteria 1047
235 Ga0207659_10557529 3300025926 Bacteria 974
236 Ga0207700_10224424 3300025928 Bacteria 1594
237 Ga0207700_10305199 3300025928 Bacteria 1375
238 Ga0207700_10309771 3300025928 Bacteria 1365
239 Ga0207700_10492390 3300025928 Bacteria 1084
240 Ga0207700_10604805 3300025928 Unclassified 976
241 Ga0207664_10086600 3300025929 Bacteria 2559
242 Ga0207644_10008375 3300025931 Bacteria 6768
243 Ga0207690_10012115 3300025932 Bacteria 5158
244 Ga0207690_10532684 3300025932 Bacteria 953
245 Ga0207706_10178397 3300025933 Unclassified 1866
246 Ga0207686_10122159 3300025934 Bacteria 1774
247 Ga0207670_10000669 3300025936 Bacteria 18137
248 Ga0207670_10222232 3300025936 Bacteria 1446
249 Ga0207670_10336208 3300025936 Bacteria 1192
250 Ga0207669_10015320 3300025937 Bacteria 3864
251 Ga0207665_10052136 3300025939 Bacteria 2756
252 Ga0207665_10055798 3300025939 Bacteria 2666
253 Ga0207665_10243929 3300025939 Unclassified 1325
254 Ga0207691_10423237 3300025940 Bacteria 1135
255 Ga0207711_10004469 3300025941 Bacteria 11923
256 Ga0207689_10262466 3300025942 Bacteria 1429
257 Ga0207668_10254062 3300025972 Bacteria 1429
258 Ga0207658_10813926 3300025986 Bacteria 848
259 Ga0207677_10393946 3300026023 Unclassified 1172
260 Ga0207703_10621284 3300026035 Unclassified 1023
261 Ga0207678_10100313 3300026067 Bacteria 2473
262 Ga0207708_10386691 3300026075 Bacteria 1155
263 Ga0207702_10134182 3300026078 Bacteria 2231
264 Ga0207641_10178641 3300026088 Bacteria 1943
265 Ga0207648_10082991 3300026089 Bacteria 2795
266 Ga0207676_10007140 3300026095 Bacteria 7912
267 Ga0207674_10111848 3300026116 Bacteria 2705
268 Ga0207675_100079206 3300026118 Bacteria 3079
269 Ga0207683_10166657 3300026121 Bacteria 1994
270 Ga0207698_10126601 3300026142 Bacteria 2174
271 Ga0209179_1010139 3300027512 Bacteria 1635
272 Ga0265357_1002577 3300028023 Bacteria 1495
273 Ga0268266_10361034 3300028379 Bacteria 1367
274 Ga0268264_10650440 3300028381 Unclassified 1043
275 Ga0265763_1000146 3300030763 Bacteria 3547
276 Ga0265773_1000199 3300031018 Bacteria 1983
277 Ga0265760_10038395 3300031090 Bacteria 1424
278 Ga0265760_10078908 3300031090 Unclassified 1018
279 Ga0265332_10112509 3300031238 Bacteria 1146
280 Ga0265325_10000835 3300031241 Bacteria 22287
281 Ga0373928_0025554 3300035084 Bacteria 1274
282 Ga0373940_0012575 3300035088 Bacteria 2030
283 Ga0373923_0000166 3300035111 Bacteria 12998
284 Ga0373923_0073368 3300035111 Bacteria 1473
285 Ga0373923_0131367 3300035111 Bacteria 1126
286 Ga0373936_0000299 3300035113 Bacteria 16644
287 Ga0373941_0020266 3300035115 Bacteria 1862
288 Ga0373945_0000925 3300035116 Bacteria 8724
289 Ga0373945_0036573 3300035116 Unclassified 1759
290 Ga0373953_0065036 3300035117 Bacteria 1497
291 Ga0373953_0175719 3300035117 Bacteria 923
292 Ga0373954_0023644 3300035118 Bacteria 2796
293 Ga0373954_0053436 3300035118 Bacteria 1899
294 Ga0373954_0119425 3300035118 Bacteria 1279
295 Ga0373956_0008687 3300035119 Bacteria 4114
296 Ga0373956_0032349 3300035119 Bacteria 2295
297 Ga0373957_0011455 3300035120 Bacteria 2961
298 Ga0373957_0029514 3300035120 Bacteria 2004
299 Ga0373960_0008244 3300035121 Bacteria 2492
300 Ga0373943_0003656 3300035170 Bacteria 6992
301 Ga0373943_0095805 3300035170 Bacteria 1544
302 Ga0373943_0261012 3300035170 Unclassified 975
303 Ga0373946_0000961 3300035171 Bacteria 9877
304 Ga0373955_0000088 3300035172 Bacteria 37233
305 Ga0373942_0010665 3300035207 Bacteria 2164
306 Ga0373961_0047144 3300035241 Bacteria 1265
307 Ga0373961_0068248 3300035241 Bacteria 1094
308 Ga0373924_0001183 3300035410 Bacteria 8392
309 Ga0373924_0070500 3300035410 Bacteria 1474
310 Ga0373924_0192356 3300035410 Unclassified 899
311 Ga0373931_0000647 3300035691 Bacteria 14379
312 Ga0373931_0024128 3300035691 Bacteria 3078
313 Ga0373935_0000169 3300035692 Bacteria 30547
314 Ga0373935_0060649 3300035692 Bacteria 2420
315 Ga0373935_0115676 3300035692 Bacteria 1786
316 Ga0373935_0217235 3300035692 Bacteria 1327
317 Ga0373927_0007789 3300035695 Bacteria 7245
318 Ga0373927_0064571 3300035695 Bacteria 2368
319 Ga0373927_0249731 3300035695 Bacteria 1166
320 Ga0373927_0266742 3300035695 Bacteria 1126
321 Ga0373933_0010891 3300035724 Bacteria 4992
322 Ga0373933_0033569 3300035724 Bacteria 2986
323 Ga0373933_0057928 3300035724 Bacteria 2329
324 Ga0373933_0146990 3300035724 Bacteria 1491
325 Ga0373947_0000391 3300035725 Bacteria 24724
326 Ga0373947_0016862 3300035725 Bacteria 4196
327 Ga0373947_0023380 3300035725 Bacteria 3594
328 Ga0373947_0146756 3300035725 Bacteria 1517
329 Ga0373947_0169402 3300035725 Bacteria 1416
330 Ga0373937_0018907 3300036401 Bacteria 6159
331 Ga0373937_0021908 3300036401 Bacteria 5737
332 Ga0373937_0035943 3300036401 Bacteria 4512
333 Ga0373937_0036243 3300036401 Bacteria 4494
334 Ga0373937_0091151 3300036401 Bacteria 2824
335 Ga0373937_0406509 3300036401 Bacteria 1292
336 Ga0373937_0511186 3300036401 Bacteria 1141
337 Ga0373937_0594778 3300036401 Bacteria 1050
338 Ga0373937_0757345 3300036401 Bacteria 919
339 Ga0373925_0003861 3300037068 Bacteria 11472
340 Ga0373925_0041055 3300037068 Bacteria 3428
341 Ga0373925_0044133 3300037068 Bacteria 3310
342 Ga0373925_0218021 3300037068 Bacteria 1522
343 Ga0373925_0269468 3300037068 Unclassified 1369
344 Ga0373925_0387349 3300037068 Bacteria 1139
345 Ga0436364_0093920 3300037853 Bacteria 1061
346 Ga0436364_0331243 3300037853 Unclassified 1871
347 Ga0436364_0345360 3300037853 Bacteria 1926
348 Ga0436364_0717863 3300037853 Bacteria 145182
349 Ga0436364_0990344 3300037853 Bacteria 56392
350 Ga0436364_1416468 3300037853 Bacteria 30239
351 Ga0436364_1558104 3300037853 Bacteria 1361
352 Ga0395901_0736636 3300038443 Bacteria 980
353 Ga0436365_0571973 3300039437 Bacteria 1826
354 Ga0436365_0687950 3300039437 Bacteria 9684
355 Ga0436365_0731168 3300039437 Bacteria 5585
356 Ga0436365_0815796 3300039437 Bacteria 1527
357 Ga0436365_1176487 3300039437 Bacteria 14323
358 Ga0436360_0127060 3300039438 Bacteria 1166
359 Ga0436360_0282261 3300039438 Bacteria 1526
360 Ga0436360_0545963 3300039438 Bacteria 3456
361 Ga0436360_0714278 3300039438 Bacteria 1345
362 Ga0436360_0735010 3300039438 Bacteria 2041
363 Ga0436360_0931475 3300039438 Bacteria 1835
364 Ga0436361_0348596 3300039447 Bacteria 1139
365 Ga0436361_0447055 3300039447 Unclassified 1128
366 Ga0436363_0132764 3300039450 Bacteria 873
367 Ga0436363_0211088 3300039450 Bacteria 1215
368 Ga0436363_1334541 3300039450 Bacteria 2039
369 Ga0436363_1573494 3300039450 Bacteria 2810
370 Ga0436363_1698147 3300039450 Bacteria 1299
371 Ga0436362_0139666 3300039453 Bacteria 857
372 Ga0436362_0334402 3300039453 Bacteria 1233
373 Ga0436362_0512199 3300039453 Bacteria 970
374 Ga0436362_1306221 3300039453 Bacteria 1006
375 Ga0451853_1236102 3300041512 Bacteria 1086
376 Ga0453683_0181713 3300044673 Bacteria 1334
377 Ga0466966_0254124 3300044684 Bacteria 1058
378 Ga0466963_0203905 3300044694 Bacteria 1383
379 Ga0466957_0006539 3300044842 Bacteria 6584
380 Ga0466959_0074041 3300045049 Bacteria 2463
381 Ga0466958_0012851 3300045836 Bacteria 4751
382 Ga0466967_0141067 3300045976 Bacteria 2244
383 Ga0466967_0260574 3300045976 Bacteria 1659
384 Ga0495627_038609 3300046453 Bacteria 1475
385 Ga0495592_0000177 3300046454 Bacteria 56202
386 Ga0495603_0040160 3300046455 Bacteria 2801
387 Ga0495591_056807 3300046458 Bacteria 1051
388 Ga0495629_0006492 3300046459 Bacteria 8669
389 Ga0495629_0182340 3300046459 Bacteria 1455
390 Ga0495629_0444331 3300046459 Bacteria 878
391 Ga0495638_0259909 3300046460 Bacteria 953
392 Ga0495651_0000979 3300046462 Bacteria 22156
393 Ga0495651_0122649 3300046462 Bacteria 1907
394 Ga0495653_0000054 3300046463 Bacteria 102885
395 Ga0495580_0320523 3300046472 Unclassified 1053
396 Ga0495580_0432690 3300046472 Bacteria 884
397 Ga0495582_0050176 3300046473 Bacteria 2299
398 Ga0495605_0066063 3300046474 Bacteria 1719
399 Ga0495662_0000766 3300046476 Bacteria 15495
400 Ga0495664_0000020 3300046477 Bacteria 150749
401 Ga0495585_0043838 3300046492 Unclassified 2500
402 Ga0495594_0292828 3300046499 Unclassified 927
403 Ga0495596_0105358 3300046500 Unclassified 1095
404 Ga0495583_0194265 3300046506 Bacteria 827
405 Ga0495608_0000024 3300046511 Bacteria 159429
406 Ga0495616_0046952 3300046513 Bacteria 2177
407 Ga0495618_0000020 3300046514 Bacteria 130661
408 Ga0495618_0078093 3300046514 Bacteria 2110
409 Ga0495620_0166537 3300046515 Unclassified 855
410 Ga0495628_0000015 3300046516 Bacteria 198912
411 Ga0495628_0085802 3300046516 Bacteria 2442
412 Ga0495628_0116727 3300046516 Bacteria 2050
413 Ga0495630_0004598 3300046517 Bacteria 9673
414 Ga0495630_0318570 3300046517 Bacteria 1189
415 Ga0495631_0099698 3300046518 Unclassified 1250
416 Ga0495637_0128284 3300046520 Unclassified 970
417 Ga0495644_0170185 3300046523 Unclassified 836
418 Ga0495663_0004714 3300046525 Bacteria 3816
419 Ga0495666_0239641 3300046526 Bacteria 828
420 Ga0495642_0089840 3300046528 Bacteria 1300
421 Ga0495652_0000006 3300046529 Bacteria 459709
422 Ga0495652_0107508 3300046529 Bacteria 2251
423 Ga0495640_0000002 3300046533 Bacteria 646434
424 Ga0495640_0379750 3300046533 Bacteria 869
425 Ga0495586_0304689 3300046535 Bacteria 913
426 Ga0495587_0000001 3300046536 Bacteria 724132
427 Ga0495598_0064323 3300046537 Unclassified 1139
428 Ga0495609_0032708 3300046538 Bacteria 2362
429 Ga0495621_0121861 3300046539 Bacteria 1008
430 Ga0495645_0000013 3300046543 Bacteria 186399
431 Ga0495645_0577842 3300046543 Bacteria 694
432 Ga0495667_0000030 3300046559 Bacteria 147898
433 Ga0495667_0014820 3300046559 Bacteria 5268
434 Ga0495667_0182406 3300046559 Bacteria 1347
435 Ga0495656_0053523 3300046615 Bacteria 1734
436 Ga0495668_0192400 3300046616 Bacteria 1117
437 Ga0495634_0000117 3300046642 Bacteria 67216
438 Ga0495634_0079685 3300046642 Bacteria 2144
439 Ga0495634_0205963 3300046642 Bacteria 1220
440 Ga0495625_0270366 3300046660 Bacteria 1097
441 Ga0495635_0000001 3300046663 Bacteria 704901
442 Ga0495635_0500905 3300046663 Unclassified 800
443 Ga0495659_0013021 3300046664 Bacteria 2704
444 Ga0495659_0121018 3300046664 Unclassified 1030
445 Ga0495661_0199633 3300046665 Bacteria 1048
446 Ga0495588_0239895 3300046674 Unclassified 956
447 Ga0495657_0000028 3300046675 Bacteria 131008
448 Ga0495599_0000050 3300046678 Bacteria 82601
449 Ga0495623_0000013 3300046679 Bacteria 119870
450 Ga0495646_0000003 3300046680 Bacteria 287773
451 Ga0495647_0100191 3300046681 Bacteria 1199
452 Ga0495658_0493479 3300046683 Unclassified 783
453 Ga0495669_0024477 3300046684 Bacteria 2629
454 Ga0495613_0021178 3300046689 Bacteria 4849
455 Ga0495613_0078965 3300046689 Bacteria 2393
456 Ga0495613_0154197 3300046689 Bacteria 1637
457 Ga0495613_0328083 3300046689 Bacteria 1055
458 Ga0495624_0056500 3300046690 Bacteria 2470
459 Ga0495624_0343232 3300046690 Bacteria 898
460 Ga0495624_0553812 3300046690 Unclassified 687
461 Ga0495670_0147332 3300046691 Bacteria 1233
462 Ga0495671_0047371 3300046692 Bacteria 2148
463 Ga0495649_0197992 3300046694 Unclassified 1044
464 Ga0495589_0035637 3300046794 Unclassified 2494
465 Ga0495600_0000002 3300046809 Bacteria 186597
466 Ga0495581_0470488 3300047315 Bacteria 731
467 Ga0495604_0000001 3300047317 Bacteria 708627
468 Ga0495674_0000018 3300047319 Bacteria 204024
469 Ga0495674_0395811 3300047319 Bacteria 1116
470 Ga0495676_0152296 3300047321 Bacteria 1644
471 Ga0495680_0000159 3300047322 Bacteria 68873
472 Ga0495680_0319768 3300047322 Bacteria 1086
473 Ga0495680_0539763 3300047322 Bacteria 787
474 Ga0495675_0000238 3300047444 Bacteria 39857
475 Ga0495677_0105890 3300047445 Bacteria 1067
476 Ga0495679_036712 3300047446 Bacteria 1546
477 Ga0495673_0137378 3300047469 Bacteria 956
478 Ga0495681_0062829 3300047470 Bacteria 1706
479 Ga0495684_0000010 3300047471 Bacteria 198915
480 Ga0495684_0179653 3300047471 Bacteria 1569
481 Ga0495593_0002061 3300047673 Bacteria 12004
482 Ga0495602_0000016 3300048088 Bacteria 190311
483 Ga0495602_0255476 3300048088 Bacteria 1303
484 Ga0495602_0291571 3300048088 Bacteria 1198
485 Ga0495615_0011448 3300048090 Bacteria 1803
486 Ga0496100_0005934 3300048903 Bacteria 6621
487 Ga0496100_0451663 3300048903 Bacteria 985
488 Ga0496101_0030655 3300048904 Bacteria 3773
489 Ga0496101_0077699 3300048904 Bacteria 2447
490 Ga0496102_0127417 3300048905 Bacteria 2380
491 Ga0496102_0197822 3300048905 Bacteria 1894
492 Ga0496102_0201613 3300048905 Bacteria 1875
493 Ga0496103_0139777 3300048906 Unclassified 1548
494 Ga0496104_0001464 3300048907 Bacteria 20379
495 Ga0496104_0008482 3300048907 Bacteria 9138
496 Ga0496104_0027574 3300048907 Bacteria 5257
497 Ga0496104_0063381 3300048907 Bacteria 3505
498 Ga0496104_0120841 3300048907 Bacteria 2515
499 Ga0496104_0252843 3300048907 Bacteria 1675
500 Ga0496105_0008536 3300048908 Bacteria 7958
501 Ga0496105_0050654 3300048908 Bacteria 3430
502 Ga0496106_0004688 3300048909 Bacteria 10131
503 Ga0496106_0157028 3300048909 Bacteria 1797
504 Ga0496106_0438514 3300048909 Unclassified 1049
505 Ga0496107_0022592 3300048910 Bacteria 4444
506 Ga0496107_0044462 3300048910 Bacteria 3192
507 Ga0496108_0020417 3300048911 Bacteria 5446
508 Ga0496108_0098848 3300048911 Bacteria 2487
509 Ga0496108_0137242 3300048911 Bacteria 2105
510 Ga0496108_0677655 3300048911 Bacteria 895
511 Ga0496109_0023504 3300048912 Bacteria 5473
512 Ga0496109_0113071 3300048912 Bacteria 2525
513 Ga0496109_0225585 3300048912 Bacteria 1762
514 Ga0496110_0080249 3300048913 Bacteria 2907
515 Ga0496110_0275036 3300048913 Unclassified 1533
516 Ga0496110_0648710 3300048913 Unclassified 955
517 Ga0496110_0904948 3300048913 Bacteria 788
518 Ga0496111_0117835 3300048914 Bacteria 1960
519 Ga0496111_0421819 3300048914 Unclassified 985
520 Ga0496112_0061461 3300048915 Bacteria 3703
521 Ga0496112_0137720 3300048915 Bacteria 2411
522 Ga0496112_0145391 3300048915 Bacteria 2339
523 Ga0496113_0088413 3300048916 Bacteria 2383
524 Ga0496113_0225347 3300048916 Bacteria 1494
525 Ga0496114_0002311 3300048917 Bacteria 14515
526 Ga0496114_0221558 3300048917 Bacteria 1661
527 Ga0496114_0462138 3300048917 Unclassified 1123
528 Ga0496115_0004279 3300048918 Bacteria 10334
529 Ga0496115_0085789 3300048918 Bacteria 2568
530 Ga0496115_0095979 3300048918 Bacteria 2427
531 Ga0496115_0299156 3300048918 Bacteria 1319
532 Ga0501034_0673294 3300049571 Bacteria 935
533 Ga0501038_0588284 3300049574 Bacteria 843
534 Ga0501039_0209692 3300049575 Bacteria 1532
535 Ga0501040_0042041 3300049576 Bacteria 3113
536 Ga0501041_0279026 3300049577 Bacteria 1051
537 Ga0501048_0231165 3300049582 Bacteria 1312
538 Ga0501068_0026678 3300049584 Bacteria 3406
539 Ga0501068_0236662 3300049584 Bacteria 1162
540 Ga0501069_0123758 3300049585 Bacteria 1478
541 Ga0501070_0083902 3300049586 Bacteria 2638
542 Ga0501071_0374381 3300049587 Bacteria 1085
543 Ga0501072_0012735 3300049588 Bacteria 6431
544 Ga0501072_0189789 3300049588 Bacteria 1639
545 Ga0501072_0217010 3300049588 Bacteria 1524
546 Ga0501075_0007759 3300049591 Bacteria 7447
547 Ga0501075_0158315 3300049591 Bacteria 1727
548 Ga0501076_0060503 3300049592 Bacteria 3013
549 Ga0501076_0170406 3300049592 Bacteria 1774
550 Ga0501076_0398333 3300049592 Bacteria 1132
551 Ga0501077_0091358 3300049593 Bacteria 1929
552 Ga0501079_0093542 3300049741 Bacteria 2329
553 Ga0501080_0429539 3300049742 Bacteria 1186
554 Ga0501081_0101820 3300049743 Bacteria 2031
555 Ga0501081_0206157 3300049743 Bacteria 1427
556 Ga0501083_0324863 3300049744 Bacteria 1000
557 nmdc:mga00v17_634073_c1 3300050491 Bacteria 688
558 nmdc:mga0yw44_541195_c1 3300050492 Bacteria 791
559 nmdc:mga0k408_18038_c1 3300050493 Bacteria 3935
560 nmdc:mga0k408_66438_c1 3300050493 Bacteria 2101
561 nmdc:mga07m45_163672_c1 3300050496 Bacteria 1292
562 nmdc:mga05p37_23571_c1 3300050507 Bacteria 7469
563 nmdc:mga05p37_432074_c1 3300050507 Unclassified 1529
564 nmdc:mga0qj67_111_c1 3300050509 Bacteria 53806
565 nmdc:mga06r32_74968_c1 3300050510 Bacteria 3281
566 nmdc:mga08y16_487764_c1 3300050511 Unclassified 1253
567 nmdc:mga08y16_719570_c1 3300050511 Bacteria 996
568 nmdc:mga08y16_739669_c1 3300050511 Bacteria 980
569 nmdc:mga0n895_1207205_c1 3300050512 Bacteria 730
570 nmdc:mga0n895_21602_c1 3300050512 Bacteria 6023
571 nmdc:mga0n895_283683_c1 3300050512 Bacteria 1679
572 nmdc:mga0n895_454163_c1 3300050512 Unclassified 1293
573 nmdc:mga0n895_899869_c1 3300050512 Bacteria 870
574 nmdc:mga0n895_939816_c1 3300050512 Bacteria 848
575 nmdc:mga0rr50_131909_c1 3300050513 Bacteria 2001
576 nmdc:mga0rr50_206620_c1 3300050513 Bacteria 1616
577 nmdc:mga08x19_16623_c1 3300050514 Bacteria 4490
578 nmdc:mga08x19_48164_c1 3300050514 Bacteria 2730
579 Ga0495601_0000021 3300053077 Bacteria 159355
580 Ga0495601_0013904 3300053077 Bacteria 4846
581 Ga0495601_0066819 3300053077 Bacteria 2289
582 Ga0495601_0304376 3300053077 Bacteria 1038
583 Ga0495612_0000018 3300053078 Bacteria 150870
584 Ga0495612_0046107 3300053078 Bacteria 1785
585 Ga0495655_0005056 3300053083 Bacteria 2302
586 Ga0495595_0000028 3300053084 Bacteria 97682
587 Ga0495595_0016963 3300053084 Bacteria 3125
588 Ga0495595_0074225 3300053084 Bacteria 1612
589 Ga0495595_0139064 3300053084 Bacteria 1191
590 Ga0495619_0000006 3300053085 Bacteria 384835
591 Ga0495619_0003473 3300053085 Bacteria 10170
592 Ga0495619_0043003 3300053085 Bacteria 2960
593 Ga0495619_0072766 3300053085 Bacteria 2302
594 Ga0500643_000447 3300053087 Bacteria 30610
595 Ga0500593_027298 3300053117 Bacteria 2547
596 Ga0500616_0069291 3300053153 Bacteria 1804
597 Ga0500622_0215441 3300053156 Bacteria 864
598 Ga0500645_054975 3300053730 Bacteria 1157
599 Ga0501084_0063617 3300054114 Bacteria 3089
600 Ga0501084_0096416 3300054114 Bacteria 2484
601 Ga0501084_0387278 3300054114 Bacteria 1181
602 Ga0587109_055080 3300059624 Unclassified 824
603 Ga0587068_042159 3300059641 Bacteria 829
604 Ga0587071_032368 3300060344 Bacteria 1013
605 Ga0501082_0139236 3300060353 Bacteria 2106
606 Ga0530510_0011205 3300061734 Bacteria 6291
607 Ga0530510_0468425 3300061734 Bacteria 953

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0035943 Ga0373937_0035943_510_1226 211
2 3300005434 Ga0070709_10065986 Ga0070709_100659862 215
3 3300005435 Ga0070714_100003291 Ga0070714_1000032913 215
4 3300005436 Ga0070713_100037240 Ga0070713_1000372403 215
5 3300005437 Ga0070710_10001459 Ga0070710_1000145911 215
6 3300005439 Ga0070711_100055931 Ga0070711_1000559314 215
7 3300006028 Ga0070717_10027202 Ga0070717_100272024 215
8 3300006175 Ga0070712_100022645 Ga0070712_1000226452 215
9 3300025898 Ga0207692_10032005 Ga0207692_100320052 215
10 3300025906 Ga0207699_10015964 Ga0207699_100159642 215
11 3300025915 Ga0207693_10000650 Ga0207693_1000065023 215
12 3300025916 Ga0207663_10050958 Ga0207663_100509583 215
13 3300025928 Ga0207700_10224424 Ga0207700_102244242 215
14 3300025929 Ga0207664_10086600 Ga0207664_100866002 215
15 3300025939 Ga0207665_10243929 Ga0207665_102439291 215
16 3300035117 Ga0373953_0175719 Ga0373953_0175719_17_667 216
17 3300035120 Ga0373957_0029514 Ga0373957_0029514_1338_1988 216
18 3300035724 Ga0373933_0146990 Ga0373933_0146990_41_691 216
19 3300036401 Ga0373937_0757345 Ga0373937_0757345_248_898 216
20 3300046459 Ga0495629_0444331 Ga0495629_0444331_218_868 216
21 3300046543 Ga0495645_0577842 Ga0495645_0577842_24_674 216
22 3300046683 Ga0495658_0493479 Ga0495658_0493479_20_670 216
23 3300046690 Ga0495624_0553812 Ga0495624_0553812_10_660 216
24 3300047315 Ga0495581_0470488 Ga0495581_0470488_21_671 216
25 3300047322 Ga0495680_0539763 Ga0495680_0539763_125_775 216
26 3300050512 nmdc:mga0n895_1207205_c1 nmdc:mga0n895_1207205_c1_61_711 216
27 3300050512 nmdc:mga0n895_899869_c1 nmdc:mga0n895_899869_c1_194_844 216
28 3300054114 Ga0501084_0387278 Ga0501084_0387278_10_660 216
29 3300035111 Ga0373923_0131367 Ga0373923_0131367_458_1111 217
30 3300035241 Ga0373961_0047144 Ga0373961_0047144_16_669 217
31 3300050491 nmdc:mga00v17_634073_c1 nmdc:mga00v17_634073_c1_20_673 217
32 3300039438 Ga0436360_0127060 Ga0436360_0127060_249_941 220
33 3300025898 Ga0207692_10193683 Ga0207692_101936831 221
34 3300005937 Ga0081455_10006759 Ga0081455_100067598 224
35 3300053087 Ga0500643_000447 Ga0500643_000447_25946_26623 225
36 3300039453 Ga0436362_0512199 Ga0436362_0512199_121_801 226
37 3300039453 Ga0436362_1306221 Ga0436362_1306221_127_807 226
38 3300046535 Ga0495586_0304689 Ga0495586_0304689_40_720 226
39 3300005329 Ga0070683_100573869 Ga0070683_1005738691 229
40 3300005354 Ga0070675_100182890 Ga0070675_1001828902 229
41 3300005356 Ga0070674_100008624 Ga0070674_1000086244 229
42 3300005543 Ga0070672_100264560 Ga0070672_1002645601 229
43 3300006237 Ga0097621_100300723 Ga0097621_1003007232 229
44 3300006358 Ga0068871_100329314 Ga0068871_1003293142 229
45 3300011119 Ga0105246_10414388 Ga0105246_104143881 229
46 3300013308 Ga0157375_10096304 Ga0157375_100963043 229
47 3300014325 Ga0163163_10073091 Ga0163163_100730914 229
48 3300014326 Ga0157380_10399533 Ga0157380_103995331 229
49 3300014745 Ga0157377_10221221 Ga0157377_102212211 229
50 3300017792 Ga0163161_10077851 Ga0163161_100778512 229
51 3300025913 Ga0207695_10511669 Ga0207695_105116692 229
52 3300025918 Ga0207662_10066994 Ga0207662_100669942 229
53 3300025926 Ga0207659_10557529 Ga0207659_105575291 229
54 3300025937 Ga0207669_10015320 Ga0207669_100153204 229
55 3300026089 Ga0207648_10082991 Ga0207648_100829912 229
56 3300031238 Ga0265332_10112509 Ga0265332_101125092 229
57 3300053117 Ga0500593_027298 Ga0500593_027298_1586_2335 229
58 3300053156 Ga0500622_0215441 Ga0500622_0215441_81_782 229
59 3300005329 Ga0070683_100212096 Ga0070683_1002120962 230
60 3300005336 Ga0070680_100148352 Ga0070680_1001483522 230
61 3300005337 Ga0070682_100057326 Ga0070682_1000573263 230
62 3300005339 Ga0070660_100069799 Ga0070660_1000697994 230
63 3300005339 Ga0070660_100259150 Ga0070660_1002591502 230
64 3300005347 Ga0070668_100129084 Ga0070668_1001290842 230
65 3300005347 Ga0070668_100870852 Ga0070668_1008708521 230
66 3300005353 Ga0070669_100076542 Ga0070669_1000765422 230
67 3300005354 Ga0070675_100438082 Ga0070675_1004380822 230
68 3300005355 Ga0070671_100495664 Ga0070671_1004956641 230
69 3300005365 Ga0070688_100251439 Ga0070688_1002514391 230
70 3300005366 Ga0070659_100031970 Ga0070659_1000319703 230
71 3300005434 Ga0070709_10095937 Ga0070709_100959372 230
72 3300005434 Ga0070709_10390416 Ga0070709_103904161 230
73 3300005435 Ga0070714_100028108 Ga0070714_1000281081 230
74 3300005435 Ga0070714_100102155 Ga0070714_1001021553 230
75 3300005436 Ga0070713_100049101 Ga0070713_1000491012 230
76 3300005436 Ga0070713_100116722 Ga0070713_1001167222 230
77 3300005436 Ga0070713_100660947 Ga0070713_1006609471 230
78 3300005437 Ga0070710_10081702 Ga0070710_100817022 230
79 3300005439 Ga0070711_100014338 Ga0070711_1000143385 230
80 3300005439 Ga0070711_100569167 Ga0070711_1005691672 230
81 3300005455 Ga0070663_100121491 Ga0070663_1001214911 230
82 3300005456 Ga0070678_100399280 Ga0070678_1003992801 230
83 3300005458 Ga0070681_10062094 Ga0070681_100620944 230
84 3300005458 Ga0070681_10063112 Ga0070681_100631125 230
85 3300005458 Ga0070681_10088384 Ga0070681_100883843 230
86 3300005458 Ga0070681_10102719 Ga0070681_101027192 230
87 3300005458 Ga0070681_10222380 Ga0070681_102223801 230
88 3300005466 Ga0070685_10142607 Ga0070685_101426072 230
89 3300005467 Ga0070706_100078060 Ga0070706_1000780601 230
90 3300005467 Ga0070706_100242459 Ga0070706_1002424592 230
91 3300005467 Ga0070706_100616988 Ga0070706_1006169881 230
92 3300005468 Ga0070707_100021284 Ga0070707_1000212844 230
93 3300005471 Ga0070698_100016820 Ga0070698_1000168208 230
94 3300005471 Ga0070698_100045574 Ga0070698_1000455741 230
95 3300005471 Ga0070698_100141303 Ga0070698_1001413032 230
96 3300005471 Ga0070698_100219444 Ga0070698_1002194442 230
97 3300005518 Ga0070699_100184265 Ga0070699_1001842651 230
98 3300005530 Ga0070679_100042019 Ga0070679_1000420195 230
99 3300005530 Ga0070679_100104320 Ga0070679_1001043202 230
100 3300005530 Ga0070679_100130602 Ga0070679_1001306024 230
101 3300005536 Ga0070697_100063371 Ga0070697_1000633715 230
102 3300005536 Ga0070697_100246573 Ga0070697_1002465732 230
103 3300005543 Ga0070672_100253996 Ga0070672_1002539962 230
104 3300005544 Ga0070686_100316159 Ga0070686_1003161591 230
105 3300005545 Ga0070695_100525161 Ga0070695_1005251611 230
106 3300005548 Ga0070665_100218448 Ga0070665_1002184483 230
107 3300005577 Ga0068857_100149519 Ga0068857_1001495193 230
108 3300005578 Ga0068854_100343370 Ga0068854_1003433702 230
109 3300005614 Ga0068856_100255748 Ga0068856_1002557482 230
110 3300005616 Ga0068852_100515909 Ga0068852_1005159091 230
111 3300005718 Ga0068866_10195202 Ga0068866_101952021 230
112 3300005840 Ga0068870_10187119 Ga0068870_101871192 230
113 3300005842 Ga0068858_100267609 Ga0068858_1002676093 230
114 3300005842 Ga0068858_100987683 Ga0068858_1009876831 230
115 3300005843 Ga0068860_100139332 Ga0068860_1001393322 230
116 3300005937 Ga0081455_10300666 Ga0081455_103006662 230
117 3300005983 Ga0081540_1050097 Ga0081540_10500972 230
118 3300005983 Ga0081540_1162125 Ga0081540_11621252 230
119 3300006028 Ga0070717_10060234 Ga0070717_100602343 230
120 3300006028 Ga0070717_10250017 Ga0070717_102500172 230
121 3300006028 Ga0070717_10846068 Ga0070717_108460681 230
122 3300006038 Ga0075365_10234337 Ga0075365_102343371 230
123 3300006038 Ga0075365_10582862 Ga0075365_105828621 230
124 3300006051 Ga0075364_10153470 Ga0075364_101534702 230
125 3300006173 Ga0070716_100097360 Ga0070716_1000973603 230
126 3300006173 Ga0070716_100243469 Ga0070716_1002434692 230
127 3300006175 Ga0070712_100017585 Ga0070712_1000175854 230
128 3300006175 Ga0070712_100032258 Ga0070712_1000322582 230
129 3300006175 Ga0070712_100063239 Ga0070712_1000632393 230
130 3300006175 Ga0070712_100112306 Ga0070712_1001123063 230
131 3300006175 Ga0070712_100113030 Ga0070712_1001130303 230
132 3300006175 Ga0070712_100148770 Ga0070712_1001487702 230
133 3300006175 Ga0070712_100473919 Ga0070712_1004739191 230
134 3300006237 Ga0097621_100111027 Ga0097621_1001110271 230
135 3300006358 Ga0068871_100131839 Ga0068871_1001318391 230
136 3300006844 Ga0075428_100073107 Ga0075428_1000731072 230
137 3300006846 Ga0075430_100000311 Ga0075430_10000031113 230
138 3300006847 Ga0075431_100196082 Ga0075431_1001960824 230
139 3300006871 Ga0075434_100190454 Ga0075434_1001904541 230
140 3300006871 Ga0075434_100776665 Ga0075434_1007766651 230
141 3300006871 Ga0075434_101120770 Ga0075434_1011207701 230
142 3300006880 Ga0075429_100257534 Ga0075429_1002575342 230
143 3300006881 Ga0068865_100183851 Ga0068865_1001838512 230
144 3300006914 Ga0075436_100115320 Ga0075436_1001153203 230
145 3300007076 Ga0075435_100165663 Ga0075435_1001656631 230
146 3300007076 Ga0075435_100579291 Ga0075435_1005792911 230
147 3300007788 Ga0099795_10148462 Ga0099795_101484622 230
148 3300009093 Ga0105240_10096152 Ga0105240_100961524 230
149 3300009094 Ga0111539_10725908 Ga0111539_107259081 230
150 3300009094 Ga0111539_10866943 Ga0111539_108669432 230
151 3300009101 Ga0105247_10045669 Ga0105247_100456692 230
152 3300009147 Ga0114129_10219641 Ga0114129_102196412 230
153 3300009147 Ga0114129_10351990 Ga0114129_103519902 230
154 3300009147 Ga0114129_10935511 Ga0114129_109355111 230
155 3300009148 Ga0105243_10048514 Ga0105243_100485142 230
156 3300009148 Ga0105243_11358179 Ga0105243_113581791 230
157 3300009174 Ga0105241_10266721 Ga0105241_102667212 230
158 3300009176 Ga0105242_10576158 Ga0105242_105761581 230
159 3300009553 Ga0105249_10076826 Ga0105249_100768263 230
160 3300009553 Ga0105249_10155222 Ga0105249_101552222 230
161 3300010159 Ga0099796_10032463 Ga0099796_100324632 230
162 3300010159 Ga0099796_10169199 Ga0099796_101691991 230
163 3300010375 Ga0105239_10173617 Ga0105239_101736171 230
164 3300013100 Ga0157373_10080150 Ga0157373_100801502 230
165 3300013104 Ga0157370_10020408 Ga0157370_100204086 230
166 3300013104 Ga0157370_10121794 Ga0157370_101217942 230
167 3300013105 Ga0157369_10018726 Ga0157369_100187263 230
168 3300013105 Ga0157369_10472985 Ga0157369_104729852 230
169 3300013105 Ga0157369_10723057 Ga0157369_107230572 230
170 3300013296 Ga0157374_10306703 Ga0157374_103067032 230
171 3300013296 Ga0157374_10316641 Ga0157374_103166412 230
172 3300013297 Ga0157378_10048576 Ga0157378_100485765 230
173 3300013297 Ga0157378_10581171 Ga0157378_105811712 230
174 3300014325 Ga0163163_10132407 Ga0163163_101324071 230
175 3300014326 Ga0157380_10373703 Ga0157380_103737031 230
176 3300014745 Ga0157377_10269406 Ga0157377_102694061 230
177 3300014968 Ga0157379_10189136 Ga0157379_101891361 230
178 3300014969 Ga0157376_10832064 Ga0157376_108320641 230
179 3300017792 Ga0163161_10145509 Ga0163161_101455091 230
180 3300021358 Ga0213873_10084673 Ga0213873_100846731 230
181 3300021377 Ga0213874_10059850 Ga0213874_100598501 230
182 3300021384 Ga0213876_10019072 Ga0213876_100190721 230
183 3300021388 Ga0213875_10000132 Ga0213875_100001322 230
184 3300021388 Ga0213875_10000232 Ga0213875_1000023245 230
185 3300021388 Ga0213875_10003695 Ga0213875_100036951 230
186 3300021388 Ga0213875_10133708 Ga0213875_101337081 230
187 3300024225 Ga0224572_1023763 Ga0224572_10237632 230
188 3300024227 Ga0228598_1013877 Ga0228598_10138771 230
189 3300025898 Ga0207692_10102390 Ga0207692_101023902 230
190 3300025898 Ga0207692_10282143 Ga0207692_102821431 230
191 3300025900 Ga0207710_10156735 Ga0207710_101567351 230
192 3300025901 Ga0207688_10153704 Ga0207688_101537041 230
193 3300025905 Ga0207685_10046890 Ga0207685_100468902 230
194 3300025910 Ga0207684_10037507 Ga0207684_100375073 230
195 3300025910 Ga0207684_10100380 Ga0207684_101003803 230
196 3300025910 Ga0207684_10169313 Ga0207684_101693132 230
197 3300025912 Ga0207707_10012496 Ga0207707_100124962 230
198 3300025912 Ga0207707_10164919 Ga0207707_101649192 230
199 3300025912 Ga0207707_10507829 Ga0207707_105078291 230
200 3300025913 Ga0207695_10085943 Ga0207695_100859434 230
201 3300025913 Ga0207695_10165974 Ga0207695_101659742 230
202 3300025915 Ga0207693_10011145 Ga0207693_100111452 230
203 3300025915 Ga0207693_10064984 Ga0207693_100649842 230
204 3300025915 Ga0207693_10077628 Ga0207693_100776283 230
205 3300025915 Ga0207693_10080380 Ga0207693_100803802 230
206 3300025915 Ga0207693_10100350 Ga0207693_101003503 230
207 3300025915 Ga0207693_10425530 Ga0207693_104255302 230
208 3300025916 Ga0207663_10224023 Ga0207663_102240231 230
209 3300025916 Ga0207663_10495324 Ga0207663_104953241 230
210 3300025916 Ga0207663_10725607 Ga0207663_107256071 230
211 3300025917 Ga0207660_10122584 Ga0207660_101225842 230
212 3300025917 Ga0207660_10192200 Ga0207660_101922002 230
213 3300025918 Ga0207662_10134376 Ga0207662_101343762 230
214 3300025919 Ga0207657_10108172 Ga0207657_101081724 230
215 3300025921 Ga0207652_10022390 Ga0207652_100223905 230
216 3300025921 Ga0207652_10062636 Ga0207652_100626362 230
217 3300025921 Ga0207652_10636711 Ga0207652_106367112 230
218 3300025921 Ga0207652_10912107 Ga0207652_109121071 230
219 3300025922 Ga0207646_10180744 Ga0207646_101807442 230
220 3300025922 Ga0207646_10753185 Ga0207646_107531851 230
221 3300025924 Ga0207694_10324279 Ga0207694_103242791 230
222 3300025926 Ga0207659_10164711 Ga0207659_101647113 230
223 3300025926 Ga0207659_10482953 Ga0207659_104829532 230
224 3300025928 Ga0207700_10305199 Ga0207700_103051992 230
225 3300025928 Ga0207700_10309771 Ga0207700_103097712 230
226 3300025928 Ga0207700_10492390 Ga0207700_104923901 230
227 3300025928 Ga0207700_10604805 Ga0207700_106048052 230
228 3300025932 Ga0207690_10012115 Ga0207690_100121153 230
229 3300025933 Ga0207706_10178397 Ga0207706_101783971 230
230 3300025934 Ga0207686_10122159 Ga0207686_101221592 230
231 3300025936 Ga0207670_10336208 Ga0207670_103362081 230
232 3300025939 Ga0207665_10052136 Ga0207665_100521363 230
233 3300025939 Ga0207665_10055798 Ga0207665_100557983 230
234 3300025942 Ga0207689_10262466 Ga0207689_102624662 230
235 3300026023 Ga0207677_10393946 Ga0207677_103939462 230
236 3300026035 Ga0207703_10621284 Ga0207703_106212841 230
237 3300026067 Ga0207678_10100313 Ga0207678_101003133 230
238 3300026075 Ga0207708_10386691 Ga0207708_103866911 230
239 3300026078 Ga0207702_10134182 Ga0207702_101341823 230
240 3300026116 Ga0207674_10111848 Ga0207674_101118483 230
241 3300026118 Ga0207675_100079206 Ga0207675_1000792062 230
242 3300026121 Ga0207683_10166657 Ga0207683_101666571 230
243 3300026142 Ga0207698_10126601 Ga0207698_101266011 230
244 3300027512 Ga0209179_1010139 Ga0209179_10101392 230
245 3300028023 Ga0265357_1002577 Ga0265357_10025773 230
246 3300028379 Ga0268266_10361034 Ga0268266_103610341 230
247 3300028381 Ga0268264_10650440 Ga0268264_106504401 230
248 3300030763 Ga0265763_1000146 Ga0265763_10001461 230
249 3300031018 Ga0265773_1000199 Ga0265773_10001992 230
250 3300031090 Ga0265760_10038395 Ga0265760_100383952 230
251 3300031090 Ga0265760_10078908 Ga0265760_100789082 230
252 3300031241 Ga0265325_10000835 Ga0265325_100008357 230
253 3300035111 Ga0373923_0000166 Ga0373923_0000166_10569_11261 230
254 3300035111 Ga0373923_0073368 Ga0373923_0073368_387_1079 230
255 3300035113 Ga0373936_0000299 Ga0373936_0000299_10472_11164 230
256 3300035115 Ga0373941_0020266 Ga0373941_0020266_50_742 230
257 3300035116 Ga0373945_0000925 Ga0373945_0000925_5802_6494 230
258 3300035116 Ga0373945_0036573 Ga0373945_0036573_85_837 230
259 3300035117 Ga0373953_0065036 Ga0373953_0065036_725_1417 230
260 3300035118 Ga0373954_0023644 Ga0373954_0023644_908_1600 230
261 3300035118 Ga0373954_0053436 Ga0373954_0053436_710_1402 230
262 3300035118 Ga0373954_0119425 Ga0373954_0119425_546_1238 230
263 3300035119 Ga0373956_0008687 Ga0373956_0008687_3177_3869 230
264 3300035119 Ga0373956_0032349 Ga0373956_0032349_997_1689 230
265 3300035120 Ga0373957_0011455 Ga0373957_0011455_374_1066 230
266 3300035170 Ga0373943_0003656 Ga0373943_0003656_486_1178 230
267 3300035170 Ga0373943_0095805 Ga0373943_0095805_244_936 230
268 3300035170 Ga0373943_0261012 Ga0373943_0261012_196_948 230
269 3300035171 Ga0373946_0000961 Ga0373946_0000961_5687_6379 230
270 3300035172 Ga0373955_0000088 Ga0373955_0000088_6645_7337 230
271 3300035241 Ga0373961_0068248 Ga0373961_0068248_261_953 230
272 3300035410 Ga0373924_0001183 Ga0373924_0001183_5229_5921 230
273 3300035410 Ga0373924_0070500 Ga0373924_0070500_251_976 230
274 3300035410 Ga0373924_0192356 Ga0373924_0192356_84_836 230
275 3300035691 Ga0373931_0024128 Ga0373931_0024128_121_813 230
276 3300035692 Ga0373935_0000169 Ga0373935_0000169_7141_7833 230
277 3300035692 Ga0373935_0060649 Ga0373935_0060649_923_1681 230
278 3300035692 Ga0373935_0115676 Ga0373935_0115676_381_1073 230
279 3300035695 Ga0373927_0007789 Ga0373927_0007789_1986_2678 230
280 3300035695 Ga0373927_0064571 Ga0373927_0064571_380_1132 230
281 3300035695 Ga0373927_0266742 Ga0373927_0266742_55_786 230
282 3300035724 Ga0373933_0010891 Ga0373933_0010891_1626_2318 230
283 3300035724 Ga0373933_0033569 Ga0373933_0033569_502_1227 230
284 3300035724 Ga0373933_0057928 Ga0373933_0057928_343_1035 230
285 3300035725 Ga0373947_0000391 Ga0373947_0000391_23091_23783 230
286 3300035725 Ga0373947_0016862 Ga0373947_0016862_2769_3527 230
287 3300035725 Ga0373947_0023380 Ga0373947_0023380_66_758 230
288 3300035725 Ga0373947_0146756 Ga0373947_0146756_781_1473 230
289 3300035725 Ga0373947_0169402 Ga0373947_0169402_610_1302 230
290 3300036401 Ga0373937_0018907 Ga0373937_0018907_1376_2068 230
291 3300036401 Ga0373937_0021908 Ga0373937_0021908_3181_3873 230
292 3300036401 Ga0373937_0036243 Ga0373937_0036243_1729_2421 230
293 3300036401 Ga0373937_0091151 Ga0373937_0091151_742_1485 230
294 3300036401 Ga0373937_0406509 Ga0373937_0406509_281_973 230
295 3300036401 Ga0373937_0511186 Ga0373937_0511186_211_903 230
296 3300036401 Ga0373937_0594778 Ga0373937_0594778_277_969 230
297 3300037068 Ga0373925_0003861 Ga0373925_0003861_6239_6931 230
298 3300037068 Ga0373925_0041055 Ga0373925_0041055_2108_2866 230
299 3300037068 Ga0373925_0044133 Ga0373925_0044133_683_1375 230
300 3300037068 Ga0373925_0218021 Ga0373925_0218021_760_1452 230
301 3300037068 Ga0373925_0269468 Ga0373925_0269468_470_1222 230
302 3300037068 Ga0373925_0387349 Ga0373925_0387349_29_754 230
303 3300037853 Ga0436364_0093920 Ga0436364_0093920_121_846 230
304 3300037853 Ga0436364_0331243 Ga0436364_0331243_1118_1810 230
305 3300037853 Ga0436364_0345360 Ga0436364_0345360_1038_1766 230
306 3300037853 Ga0436364_0717863 Ga0436364_0717863_123669_124394 230
307 3300037853 Ga0436364_0990344 Ga0436364_0990344_3571_4263 230
308 3300037853 Ga0436364_1416468 Ga0436364_1416468_25278_25970 230
309 3300037853 Ga0436364_1558104 Ga0436364_1558104_541_1245 230
310 3300038443 Ga0395901_0736636 Ga0395901_0736636_100_792 230
311 3300039437 Ga0436365_0571973 Ga0436365_0571973_35_727 230
312 3300039437 Ga0436365_0687950 Ga0436365_0687950_1594_2319 230
313 3300039437 Ga0436365_0731168 Ga0436365_0731168_4509_5213 230
314 3300039437 Ga0436365_0815796 Ga0436365_0815796_751_1443 230
315 3300039437 Ga0436365_1176487 Ga0436365_1176487_530_1222 230
316 3300039438 Ga0436360_0282261 Ga0436360_0282261_634_1326 230
317 3300039438 Ga0436360_0545963 Ga0436360_0545963_473_1165 230
318 3300039438 Ga0436360_0714278 Ga0436360_0714278_540_1265 230
319 3300039438 Ga0436360_0735010 Ga0436360_0735010_1270_1962 230
320 3300039438 Ga0436360_0931475 Ga0436360_0931475_857_1591 230
321 3300039447 Ga0436361_0348596 Ga0436361_0348596_158_850 230
322 3300039447 Ga0436361_0447055 Ga0436361_0447055_398_1090 230
323 3300039450 Ga0436363_0132764 Ga0436363_0132764_74_766 230
324 3300039450 Ga0436363_0211088 Ga0436363_0211088_485_1198 230
325 3300039450 Ga0436363_1334541 Ga0436363_1334541_339_1031 230
326 3300039450 Ga0436363_1573494 Ga0436363_1573494_150_842 230
327 3300039450 Ga0436363_1698147 Ga0436363_1698147_272_964 230
328 3300039453 Ga0436362_0139666 Ga0436362_0139666_137_829 230
329 3300039453 Ga0436362_0334402 Ga0436362_0334402_432_1124 230
330 3300041512 Ga0451853_1236102 Ga0451853_1236102_11_703 230
331 3300044673 Ga0453683_0181713 Ga0453683_0181713_83_775 230
332 3300045976 Ga0466967_0141067 Ga0466967_0141067_23_715 230
333 3300045976 Ga0466967_0260574 Ga0466967_0260574_854_1546 230
334 3300046453 Ga0495627_038609 Ga0495627_038609_151_903 230
335 3300046454 Ga0495592_0000177 Ga0495592_0000177_13926_14618 230
336 3300046455 Ga0495603_0040160 Ga0495603_0040160_390_1142 230
337 3300046458 Ga0495591_056807 Ga0495591_056807_13_765 230
338 3300046459 Ga0495629_0006492 Ga0495629_0006492_3581_4273 230
339 3300046459 Ga0495629_0182340 Ga0495629_0182340_413_1105 230
340 3300046460 Ga0495638_0259909 Ga0495638_0259909_37_789 230
341 3300046462 Ga0495651_0000979 Ga0495651_0000979_3854_4546 230
342 3300046462 Ga0495651_0122649 Ga0495651_0122649_279_1004 230
343 3300046463 Ga0495653_0000054 Ga0495653_0000054_1519_2211 230
344 3300046472 Ga0495580_0320523 Ga0495580_0320523_21_773 230
345 3300046472 Ga0495580_0432690 Ga0495580_0432690_20_712 230
346 3300046473 Ga0495582_0050176 Ga0495582_0050176_626_1318 230
347 3300046474 Ga0495605_0066063 Ga0495605_0066063_41_733 230
348 3300046476 Ga0495662_0000766 Ga0495662_0000766_12194_12886 230
349 3300046477 Ga0495664_0000020 Ga0495664_0000020_49472_50164 230
350 3300046492 Ga0495585_0043838 Ga0495585_0043838_1411_2163 230
351 3300046499 Ga0495594_0292828 Ga0495594_0292828_92_784 230
352 3300046500 Ga0495596_0105358 Ga0495596_0105358_177_929 230
353 3300046506 Ga0495583_0194265 Ga0495583_0194265_35_727 230
354 3300046511 Ga0495608_0000024 Ga0495608_0000024_58055_58747 230
355 3300046513 Ga0495616_0046952 Ga0495616_0046952_238_990 230
356 3300046514 Ga0495618_0000020 Ga0495618_0000020_100586_101278 230
357 3300046514 Ga0495618_0078093 Ga0495618_0078093_783_1514 230
358 3300046515 Ga0495620_0166537 Ga0495620_0166537_56_808 230
359 3300046516 Ga0495628_0000015 Ga0495628_0000015_97627_98319 230
360 3300046516 Ga0495628_0085802 Ga0495628_0085802_251_976 230
361 3300046517 Ga0495630_0004598 Ga0495630_0004598_6080_6772 230
362 3300046517 Ga0495630_0318570 Ga0495630_0318570_266_991 230
363 3300046518 Ga0495631_0099698 Ga0495631_0099698_323_1075 230
364 3300046520 Ga0495637_0128284 Ga0495637_0128284_165_917 230
365 3300046523 Ga0495644_0170185 Ga0495644_0170185_60_812 230
366 3300046525 Ga0495663_0004714 Ga0495663_0004714_1936_2688 230
367 3300046526 Ga0495666_0239641 Ga0495666_0239641_55_747 230
368 3300046528 Ga0495642_0089840 Ga0495642_0089840_286_1038 230
369 3300046529 Ga0495652_0000006 Ga0495652_0000006_358420_359112 230
370 3300046529 Ga0495652_0107508 Ga0495652_0107508_350_1075 230
371 3300046533 Ga0495640_0000002 Ga0495640_0000002_545161_545853 230
372 3300046533 Ga0495640_0379750 Ga0495640_0379750_151_843 230
373 3300046536 Ga0495587_0000001 Ga0495587_0000001_617617_618309 230
374 3300046537 Ga0495598_0064323 Ga0495598_0064323_132_884 230
375 3300046538 Ga0495609_0032708 Ga0495609_0032708_1534_2286 230
376 3300046539 Ga0495621_0121861 Ga0495621_0121861_152_904 230
377 3300046543 Ga0495645_0000013 Ga0495645_0000013_100578_101270 230
378 3300046559 Ga0495667_0000030 Ga0495667_0000030_105622_106314 230
379 3300046559 Ga0495667_0014820 Ga0495667_0014820_391_1083 230
380 3300046559 Ga0495667_0182406 Ga0495667_0182406_57_782 230
381 3300046615 Ga0495656_0053523 Ga0495656_0053523_36_788 230
382 3300046616 Ga0495668_0192400 Ga0495668_0192400_256_1008 230
383 3300046642 Ga0495634_0000117 Ga0495634_0000117_41550_42242 230
384 3300046642 Ga0495634_0079685 Ga0495634_0079685_766_1497 230
385 3300046642 Ga0495634_0205963 Ga0495634_0205963_14_706 230
386 3300046660 Ga0495625_0270366 Ga0495625_0270366_288_1040 230
387 3300046663 Ga0495635_0000001 Ga0495635_0000001_603428_604120 230
388 3300046663 Ga0495635_0500905 Ga0495635_0500905_29_721 230
389 3300046664 Ga0495659_0013021 Ga0495659_0013021_201_893 230
390 3300046664 Ga0495659_0121018 Ga0495659_0121018_151_903 230
391 3300046665 Ga0495661_0199633 Ga0495661_0199633_227_919 230
392 3300046674 Ga0495588_0239895 Ga0495588_0239895_82_834 230
393 3300046675 Ga0495657_0000028 Ga0495657_0000028_88754_89446 230
394 3300046678 Ga0495599_0000050 Ga0495599_0000050_23811_24503 230
395 3300046679 Ga0495623_0000013 Ga0495623_0000013_78456_79148 230
396 3300046680 Ga0495646_0000003 Ga0495646_0000003_181416_182108 230
397 3300046681 Ga0495647_0100191 Ga0495647_0100191_229_921 230
398 3300046684 Ga0495669_0024477 Ga0495669_0024477_1580_2332 230
399 3300046689 Ga0495613_0021178 Ga0495613_0021178_4009_4701 230
400 3300046689 Ga0495613_0078965 Ga0495613_0078965_404_1096 230
401 3300046689 Ga0495613_0154197 Ga0495613_0154197_723_1454 230
402 3300046689 Ga0495613_0328083 Ga0495613_0328083_53_778 230
403 3300046690 Ga0495624_0056500 Ga0495624_0056500_220_912 230
404 3300046690 Ga0495624_0343232 Ga0495624_0343232_120_872 230
405 3300046691 Ga0495670_0147332 Ga0495670_0147332_384_1136 230
406 3300046692 Ga0495671_0047371 Ga0495671_0047371_188_940 230
407 3300046694 Ga0495649_0197992 Ga0495649_0197992_249_1001 230
408 3300046794 Ga0495589_0035637 Ga0495589_0035637_1289_2041 230
409 3300046809 Ga0495600_0000002 Ga0495600_0000002_88354_89046 230
410 3300047317 Ga0495604_0000001 Ga0495604_0000001_610410_611102 230
411 3300047319 Ga0495674_0000018 Ga0495674_0000018_105790_106482 230
412 3300047319 Ga0495674_0395811 Ga0495674_0395811_114_821 230
413 3300047321 Ga0495676_0152296 Ga0495676_0152296_662_1414 230
414 3300047322 Ga0495680_0000159 Ga0495680_0000159_50205_50897 230
415 3300047322 Ga0495680_0319768 Ga0495680_0319768_345_1070 230
416 3300047444 Ga0495675_0000238 Ga0495675_0000238_36114_36806 230
417 3300047445 Ga0495677_0105890 Ga0495677_0105890_30_782 230
418 3300047446 Ga0495679_036712 Ga0495679_036712_124_816 230
419 3300047469 Ga0495673_0137378 Ga0495673_0137378_100_852 230
420 3300047470 Ga0495681_0062829 Ga0495681_0062829_966_1658 230
421 3300047471 Ga0495684_0000010 Ga0495684_0000010_100686_101378 230
422 3300047471 Ga0495684_0179653 Ga0495684_0179653_448_1173 230
423 3300047673 Ga0495593_0002061 Ga0495593_0002061_7530_8222 230
424 3300048088 Ga0495602_0000016 Ga0495602_0000016_100488_101180 230
425 3300048088 Ga0495602_0255476 Ga0495602_0255476_553_1245 230
426 3300048090 Ga0495615_0011448 Ga0495615_0011448_919_1671 230
427 3300048903 Ga0496100_0451663 Ga0496100_0451663_212_904 230
428 3300048904 Ga0496101_0077699 Ga0496101_0077699_28_720 230
429 3300048905 Ga0496102_0127417 Ga0496102_0127417_1521_2273 230
430 3300048905 Ga0496102_0197822 Ga0496102_0197822_1152_1844 230
431 3300048906 Ga0496103_0139777 Ga0496103_0139777_596_1348 230
432 3300048907 Ga0496104_0001464 Ga0496104_0001464_15389_16081 230
433 3300048907 Ga0496104_0027574 Ga0496104_0027574_2023_2715 230
434 3300048907 Ga0496104_0063381 Ga0496104_0063381_640_1332 230
435 3300048907 Ga0496104_0120841 Ga0496104_0120841_1213_1965 230
436 3300048907 Ga0496104_0252843 Ga0496104_0252843_736_1428 230
437 3300048908 Ga0496105_0050654 Ga0496105_0050654_202_894 230
438 3300048909 Ga0496106_0157028 Ga0496106_0157028_637_1329 230
439 3300048909 Ga0496106_0438514 Ga0496106_0438514_267_1019 230
440 3300048910 Ga0496107_0044462 Ga0496107_0044462_38_790 230
441 3300048911 Ga0496108_0098848 Ga0496108_0098848_327_1019 230
442 3300048911 Ga0496108_0137242 Ga0496108_0137242_162_854 230
443 3300048911 Ga0496108_0677655 Ga0496108_0677655_147_839 230
444 3300048912 Ga0496109_0113071 Ga0496109_0113071_325_1017 230
445 3300048912 Ga0496109_0225585 Ga0496109_0225585_404_1156 230
446 3300048913 Ga0496110_0275036 Ga0496110_0275036_214_966 230
447 3300048913 Ga0496110_0648710 Ga0496110_0648710_101_793 230
448 3300048913 Ga0496110_0904948 Ga0496110_0904948_84_776 230
449 3300048914 Ga0496111_0117835 Ga0496111_0117835_391_1083 230
450 3300048914 Ga0496111_0421819 Ga0496111_0421819_217_969 230
451 3300048915 Ga0496112_0061461 Ga0496112_0061461_2437_3129 230
452 3300048915 Ga0496112_0137720 Ga0496112_0137720_1275_1967 230
453 3300048916 Ga0496113_0088413 Ga0496113_0088413_292_984 230
454 3300048916 Ga0496113_0225347 Ga0496113_0225347_292_1044 230
455 3300048917 Ga0496114_0221558 Ga0496114_0221558_441_1133 230
456 3300048917 Ga0496114_0462138 Ga0496114_0462138_107_859 230
457 3300048918 Ga0496115_0085789 Ga0496115_0085789_958_1650 230
458 3300048918 Ga0496115_0095979 Ga0496115_0095979_16_708 230
459 3300048918 Ga0496115_0299156 Ga0496115_0299156_319_1011 230
460 3300049574 Ga0501038_0588284 Ga0501038_0588284_53_745 230
461 3300049575 Ga0501039_0209692 Ga0501039_0209692_231_923 230
462 3300049576 Ga0501040_0042041 Ga0501040_0042041_869_1561 230
463 3300049577 Ga0501041_0279026 Ga0501041_0279026_64_756 230
464 3300049582 Ga0501048_0231165 Ga0501048_0231165_40_792 230
465 3300049584 Ga0501068_0026678 Ga0501068_0026678_2617_3309 230
466 3300049584 Ga0501068_0236662 Ga0501068_0236662_150_842 230
467 3300049585 Ga0501069_0123758 Ga0501069_0123758_639_1331 230
468 3300049586 Ga0501070_0083902 Ga0501070_0083902_236_931 230
469 3300049587 Ga0501071_0374381 Ga0501071_0374381_196_888 230
470 3300049588 Ga0501072_0012735 Ga0501072_0012735_523_1263 230
471 3300049588 Ga0501072_0189789 Ga0501072_0189789_569_1321 230
472 3300049588 Ga0501072_0217010 Ga0501072_0217010_601_1293 230
473 3300049591 Ga0501075_0007759 Ga0501075_0007759_5324_6016 230
474 3300049591 Ga0501075_0158315 Ga0501075_0158315_973_1713 230
475 3300049592 Ga0501076_0060503 Ga0501076_0060503_2057_2749 230
476 3300049592 Ga0501076_0170406 Ga0501076_0170406_612_1352 230
477 3300049592 Ga0501076_0398333 Ga0501076_0398333_12_704 230
478 3300049593 Ga0501077_0091358 Ga0501077_0091358_783_1523 230
479 3300049741 Ga0501079_0093542 Ga0501079_0093542_228_920 230
480 3300049742 Ga0501080_0429539 Ga0501080_0429539_409_1161 230
481 3300049743 Ga0501081_0101820 Ga0501081_0101820_327_1019 230
482 3300049743 Ga0501081_0206157 Ga0501081_0206157_257_997 230
483 3300049744 Ga0501083_0324863 Ga0501083_0324863_111_803 230
484 3300050492 nmdc:mga0yw44_541195_c1 nmdc:mga0yw44_541195_c1_53_745 230
485 3300050507 nmdc:mga05p37_23571_c1 nmdc:mga05p37_23571_c1_591_1283 230
486 3300050507 nmdc:mga05p37_432074_c1 nmdc:mga05p37_432074_c1_754_1446 230
487 3300050509 nmdc:mga0qj67_111_c1 nmdc:mga0qj67_111_c1_31030_31725 230
488 3300050510 nmdc:mga06r32_74968_c1 nmdc:mga06r32_74968_c1_2354_3046 230
489 3300050511 nmdc:mga08y16_487764_c1 nmdc:mga08y16_487764_c1_68_796 230
490 3300050511 nmdc:mga08y16_719570_c1 nmdc:mga08y16_719570_c1_162_914 230
491 3300050512 nmdc:mga0n895_21602_c1 nmdc:mga0n895_21602_c1_3123_3815 230
492 3300050512 nmdc:mga0n895_283683_c1 nmdc:mga0n895_283683_c1_470_1162 230
493 3300050512 nmdc:mga0n895_454163_c1 nmdc:mga0n895_454163_c1_457_1149 230
494 3300050512 nmdc:mga0n895_939816_c1 nmdc:mga0n895_939816_c1_71_763 230
495 3300050513 nmdc:mga0rr50_131909_c1 nmdc:mga0rr50_131909_c1_605_1297 230
496 3300050513 nmdc:mga0rr50_206620_c1 nmdc:mga0rr50_206620_c1_582_1274 230
497 3300050514 nmdc:mga08x19_16623_c1 nmdc:mga08x19_16623_c1_3203_3895 230
498 3300050514 nmdc:mga08x19_48164_c1 nmdc:mga08x19_48164_c1_1407_2099 230
499 3300053077 Ga0495601_0000021 Ga0495601_0000021_100568_101260 230
500 3300053077 Ga0495601_0013904 Ga0495601_0013904_198_923 230
501 3300053077 Ga0495601_0066819 Ga0495601_0066819_928_1635 230
502 3300053078 Ga0495612_0000018 Ga0495612_0000018_100579_101271 230
503 3300053083 Ga0495655_0005056 Ga0495655_0005056_1468_2220 230
504 3300053084 Ga0495595_0000028 Ga0495595_0000028_33516_34208 230
505 3300053084 Ga0495595_0016963 Ga0495595_0016963_2062_2787 230
506 3300053084 Ga0495595_0139064 Ga0495595_0139064_399_1091 230
507 3300053085 Ga0495619_0000006 Ga0495619_0000006_326033_326725 230
508 3300053085 Ga0495619_0003473 Ga0495619_0003473_4875_5600 230
509 3300053085 Ga0495619_0043003 Ga0495619_0043003_473_1165 230
510 3300053085 Ga0495619_0072766 Ga0495619_0072766_788_1531 230
511 3300053730 Ga0500645_054975 Ga0500645_054975_15_779 230
512 3300054114 Ga0501084_0063617 Ga0501084_0063617_79_771 230
513 3300054114 Ga0501084_0096416 Ga0501084_0096416_457_1197 230
514 3300059624 Ga0587109_055080 Ga0587109_055080_61_753 230
515 3300059641 Ga0587068_042159 Ga0587068_042159_123_815 230
516 3300060344 Ga0587071_032368 Ga0587071_032368_208_903 230
517 3300060353 Ga0501082_0139236 Ga0501082_0139236_250_942 230
518 3300061734 Ga0530510_0011205 Ga0530510_0011205_5046_5786 230
519 3300061734 Ga0530510_0468425 Ga0530510_0468425_86_778 230
520 3300003215 JGI25153J46596_10002741 JGI25153J46596_100027418 231
521 3300003215 JGI25153J46596_10003269 JGI25153J46596_100032698 231
522 3300005295 Ga0065707_10142897 Ga0065707_101428972 231
523 3300005338 Ga0068868_100384805 Ga0068868_1003848052 231
524 3300005340 Ga0070689_100001797 Ga0070689_1000017972 231
525 3300005343 Ga0070687_100098622 Ga0070687_1000986221 231
526 3300005347 Ga0070668_100154075 Ga0070668_1001540753 231
527 3300005353 Ga0070669_100168193 Ga0070669_1001681932 231
528 3300005354 Ga0070675_100243754 Ga0070675_1002437541 231
529 3300005367 Ga0070667_100216190 Ga0070667_1002161902 231
530 3300005456 Ga0070678_100004761 Ga0070678_1000047613 231
531 3300005459 Ga0068867_100184693 Ga0068867_1001846933 231
532 3300005466 Ga0070685_10079735 Ga0070685_100797351 231
533 3300005543 Ga0070672_100397726 Ga0070672_1003977261 231
534 3300005544 Ga0070686_100069280 Ga0070686_1000692802 231
535 3300005617 Ga0068859_100086931 Ga0068859_1000869312 231
536 3300005618 Ga0068864_100012195 Ga0068864_1000121958 231
537 3300005840 Ga0068870_10225182 Ga0068870_102251822 231
538 3300006051 Ga0075364_10092115 Ga0075364_100921152 231
539 3300006195 Ga0075366_10010050 Ga0075366_100100505 231
540 3300006195 Ga0075366_10028122 Ga0075366_100281222 231
541 3300006353 Ga0075370_10210826 Ga0075370_102108262 231
542 3300006358 Ga0068871_100400749 Ga0068871_1004007492 231
543 3300006881 Ga0068865_100423815 Ga0068865_1004238151 231
544 3300006931 Ga0097620_100086930 Ga0097620_1000869304 231
545 3300009011 Ga0105251_10113130 Ga0105251_101131302 231
546 3300009094 Ga0111539_10370439 Ga0111539_103704392 231
547 3300009094 Ga0111539_10979917 Ga0111539_109799171 231
548 3300009148 Ga0105243_11012657 Ga0105243_110126571 231
549 3300009177 Ga0105248_11239949 Ga0105248_112399491 231
550 3300009551 Ga0105238_10368154 Ga0105238_103681542 231
551 3300010159 Ga0099796_10033213 Ga0099796_100332132 231
552 3300013297 Ga0157378_10421473 Ga0157378_104214732 231
553 3300014325 Ga0163163_10198649 Ga0163163_101986492 231
554 3300014968 Ga0157379_10343481 Ga0157379_103434811 231
555 3300025297 Ga0209758_1000556 Ga0209758_100055637 231
556 3300025899 Ga0207642_10236439 Ga0207642_102364391 231
557 3300025903 Ga0207680_10293954 Ga0207680_102939541 231
558 3300025907 Ga0207645_10124337 Ga0207645_101243371 231
559 3300025908 Ga0207643_10129294 Ga0207643_101292942 231
560 3300025918 Ga0207662_10041647 Ga0207662_100416472 231
561 3300025923 Ga0207681_10030702 Ga0207681_100307025 231
562 3300025931 Ga0207644_10008375 Ga0207644_100083758 231
563 3300025932 Ga0207690_10532684 Ga0207690_105326842 231
564 3300025936 Ga0207670_10000669 Ga0207670_1000066913 231
565 3300025936 Ga0207670_10222232 Ga0207670_102222322 231
566 3300025940 Ga0207691_10423237 Ga0207691_104232372 231
567 3300025941 Ga0207711_10004469 Ga0207711_100044691 231
568 3300025972 Ga0207668_10254062 Ga0207668_102540622 231
569 3300025986 Ga0207658_10813926 Ga0207658_108139262 231
570 3300026088 Ga0207641_10178641 Ga0207641_101786413 231
571 3300026095 Ga0207676_10007140 Ga0207676_100071402 231
572 3300035084 Ga0373928_0025554 Ga0373928_0025554_66_761 231
573 3300035088 Ga0373940_0012575 Ga0373940_0012575_419_1114 231
574 3300035121 Ga0373960_0008244 Ga0373960_0008244_13_708 231
575 3300035207 Ga0373942_0010665 Ga0373942_0010665_998_1693 231
576 3300035691 Ga0373931_0000647 Ga0373931_0000647_12837_13532 231
577 3300035692 Ga0373935_0217235 Ga0373935_0217235_305_1000 231
578 3300035695 Ga0373927_0249731 Ga0373927_0249731_227_922 231
579 3300044684 Ga0466966_0254124 Ga0466966_0254124_136_831 231
580 3300044694 Ga0466963_0203905 Ga0466963_0203905_238_933 231
581 3300044842 Ga0466957_0006539 Ga0466957_0006539_2145_2840 231
582 3300045049 Ga0466959_0074041 Ga0466959_0074041_501_1196 231
583 3300045836 Ga0466958_0012851 Ga0466958_0012851_3414_4109 231
584 3300046516 Ga0495628_0116727 Ga0495628_0116727_1012_1707 231
585 3300048088 Ga0495602_0291571 Ga0495602_0291571_388_1083 231
586 3300048903 Ga0496100_0005934 Ga0496100_0005934_2281_2976 231
587 3300048904 Ga0496101_0030655 Ga0496101_0030655_851_1546 231
588 3300048905 Ga0496102_0201613 Ga0496102_0201613_790_1485 231
589 3300048907 Ga0496104_0008482 Ga0496104_0008482_4068_4763 231
590 3300048908 Ga0496105_0008536 Ga0496105_0008536_5589_6284 231
591 3300048909 Ga0496106_0004688 Ga0496106_0004688_4958_5653 231
592 3300048910 Ga0496107_0022592 Ga0496107_0022592_857_1552 231
593 3300048911 Ga0496108_0020417 Ga0496108_0020417_4234_4929 231
594 3300048912 Ga0496109_0023504 Ga0496109_0023504_2065_2760 231
595 3300048913 Ga0496110_0080249 Ga0496110_0080249_1073_1768 231
596 3300048915 Ga0496112_0145391 Ga0496112_0145391_14_709 231
597 3300048917 Ga0496114_0002311 Ga0496114_0002311_5713_6408 231
598 3300048918 Ga0496115_0004279 Ga0496115_0004279_4680_5375 231
599 3300049571 Ga0501034_0673294 Ga0501034_0673294_50_748 231
600 3300050493 nmdc:mga0k408_18038_c1 nmdc:mga0k408_18038_c1_2639_3334 231
601 3300050493 nmdc:mga0k408_66438_c1 nmdc:mga0k408_66438_c1_139_834 231
602 3300050496 nmdc:mga07m45_163672_c1 nmdc:mga07m45_163672_c1_193_912 231
603 3300050511 nmdc:mga08y16_739669_c1 nmdc:mga08y16_739669_c1_258_953 231
604 3300053077 Ga0495601_0304376 Ga0495601_0304376_282_977 231
605 3300053078 Ga0495612_0046107 Ga0495612_0046107_15_710 231
606 3300053084 Ga0495595_0074225 Ga0495595_0074225_243_938 231
607 3300053153 Ga0500616_0069291 Ga0500616_0069291_566_1261 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

47

112

0.97

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

42

116

0.95

PF22441

CLIC-like_N

CLIC-like N-terminal domain

42

116

0.94

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

151

224

0.91

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

38

111

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

137

237

0.87

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

125

229

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g10-assembly1.cif.gz_A ligg from sphingobium sp. syk-6 is related to the glutathione transferase omega class 0.9146 4 213
5kej-assembly1.cif.gz_B crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione 0.9015 4 211
7dwf-assembly2.cif.gz_B crystal structure of a glutathione s-transferase mutant sbgstu7(t53i) from salix babylonica 0.8935 5 207
7dwe-assembly1.cif.gz_A crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica in complex with glutathione 0.8906 4 207
3lfl-assembly2.cif.gz_C crystal structure of human glutathione transferase omega 1, delta 155 0.8852 3 206
ID Description Score Start End Superfamily
af_Q9VSL6_6_114_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9357 4 91 3.40.30.10
af_Q9VSL3_17_104_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9193 4 80 3.40.30.10
5g5fA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9165 4 75 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9128 4 77 3.40.30.10
af_P0ACA3_4_88_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9121 4 81 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1Q7WSS6-F1-model_v4 Glutathione S-transferase 0.9836 1 219 GO:0005737
AF-A0A1Q7WSS6-F1-model_v4 Glutathione S-transferase 0.9747 1 219 GO:0005737
AF-A0A7C2YTY6-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9551 2 226 GO:0005737
GO:0016740
AF-A0A7X1TWE0-F1-model_v4 Glutathione S-transferase family protein 0.9514 2 225 GO:0005737
GO:0016740
AF-A0A1G7HYC5-F1-model_v4 deleted 0.948 3 222

Feature Viewer

pLDDT pTM Quality
94.03 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map