F468696

General Info

Members Datasets Scaffolds Average Seq Length
607 348 1214 124

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10098657|Ga0207665_100986573
Length 149
Sequence VAEVTAIKLAEFQQALCMKTRKSTMWLSKVAALALIIGAAGPMSVSLALAASDCPKLVELADWGENSSGDISVASGESCLFPITMRGTVSSSDILQKPSHGKLKKLNITTYEYKAKARFKGKDTFAIKATGQGPTASGTSVITVHATIK

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
185 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
262 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
263 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
264 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
265 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
283 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
286 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
287 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
288 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
289 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
290 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
291 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
292 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
293 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
294 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
295 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
296 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
297 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
298 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
299 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
300 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
302 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
303 2791355199
304 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
305 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
306 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
307 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
308 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
309 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
310 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
311 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
312 2922368715
313 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
314 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
315 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
316 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
317 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
318 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
319 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
320 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
321 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
322 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
323 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
324 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
325 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
326 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
327 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
328 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
329 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
330 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
331 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
332 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
333 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
334 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
335 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
336 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
337 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
338 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
339 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
340 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
341 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
342 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
343 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
344 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
345 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
346 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
347 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
348 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.4
Metatranscriptomes 0.17
Isolates 8.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.71
Nodule 7.74
Rhizoplane 7.58
Rhizosphere 69.69
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10098657 3300025939 Bacteria 2036
2 JGI24750J21931_1058286 3300002070 Bacteria 614
3 JGI24742J22300_10083899 3300002244 Bacteria 604
4 Ga0070676_10086729 3300005328 Bacteria 1910
5 Ga0070683_100408282 3300005329 Bacteria 1295
6 Ga0070683_100445499 3300005329 Bacteria 1236
7 Ga0068869_100061420 3300005334 Bacteria 2756
8 Ga0068869_100065769 3300005334 Bacteria 2670
9 Ga0068869_100231340 3300005334 Bacteria 1469
10 Ga0068869_101410366 3300005334 Bacteria 617
11 Ga0070666_10212305 3300005335 Bacteria 1363
12 Ga0068868_100198078 3300005338 Bacteria 1673
13 Ga0068868_101591827 3300005338 Bacteria 614
14 Ga0068868_101711854 3300005338 Bacteria 593
15 Ga0068868_101736881 3300005338 Bacteria 589
16 Ga0070660_100274006 3300005339 Bacteria 1380
17 Ga0070660_100530966 3300005339 Bacteria 980
18 Ga0070689_100234394 3300005340 Bacteria 1510
19 Ga0070661_100100393 3300005344 Bacteria 2151
20 Ga0070668_100055681 3300005347 Bacteria 3053
21 Ga0070668_100100503 3300005347 Bacteria 2291
22 Ga0070668_100119044 3300005347 Bacteria 2109
23 Ga0070668_100301692 3300005347 Bacteria 1343
24 Ga0070668_100352217 3300005347 Bacteria 1246
25 Ga0070669_101428276 3300005353 Bacteria 601
26 Ga0070675_100189017 3300005354 Bacteria 1784
27 Ga0070675_100386892 3300005354 Bacteria 1246
28 Ga0070675_101144739 3300005354 Bacteria 716
29 Ga0070671_100109903 3300005355 Bacteria 2315
30 Ga0070671_100501737 3300005355 Bacteria 1044
31 Ga0070674_100098773 3300005356 Bacteria 2122
32 Ga0070674_100558709 3300005356 Bacteria 961
33 Ga0070673_100326750 3300005364 Bacteria 1356
34 Ga0070659_100461439 3300005366 Bacteria 1079
35 Ga0070667_100743490 3300005367 Bacteria 909
36 Ga0070667_100935097 3300005367 Bacteria 808
37 Ga0070713_100963826 3300005436 Bacteria 822
38 Ga0070710_10258144 3300005437 Bacteria 1123
39 Ga0070701_10087309 3300005438 Bacteria 1701
40 Ga0070711_100933531 3300005439 Bacteria 742
41 Ga0070700_100194364 3300005441 Bacteria 1421
42 Ga0070700_100399184 3300005441 Bacteria 1033
43 Ga0070694_100136536 3300005444 Bacteria 1778
44 Ga0070694_101792831 3300005444 Bacteria 523
45 Ga0070663_100075481 3300005455 Bacteria 2464
46 Ga0070663_100087927 3300005455 Bacteria 2297
47 Ga0070663_100104408 3300005455 Bacteria 2119
48 Ga0070663_100329246 3300005455 Bacteria 1231
49 Ga0070678_100012629 3300005456 Bacteria 5263
50 Ga0070678_100032022 3300005456 Bacteria 3634
51 Ga0070678_100040379 3300005456 Bacteria 3301
52 Ga0070678_100054250 3300005456 Bacteria 2919
53 Ga0070662_100024491 3300005457 Bacteria 4158
54 Ga0070662_100069261 3300005457 Bacteria 2595
55 Ga0070662_100371360 3300005457 Bacteria 1175
56 Ga0070681_10184437 3300005458 Bacteria 2007
57 Ga0068867_100170192 3300005459 Bacteria 1725
58 Ga0068867_101472785 3300005459 Bacteria 633
59 Ga0070706_100161428 3300005467 Bacteria 2093
60 Ga0070684_100154390 3300005535 Bacteria 2081
61 Ga0070697_101004846 3300005536 Bacteria 741
62 Ga0068853_100113256 3300005539 Bacteria 2412
63 Ga0068853_101540588 3300005539 Bacteria 644
64 Ga0070672_100046304 3300005543 Bacteria 3369
65 Ga0070686_100066712 3300005544 Bacteria 2342
66 Ga0070693_100484521 3300005547 Bacteria 874
67 Ga0070693_100723803 3300005547 Bacteria 731
68 Ga0070693_101073248 3300005547 Bacteria 613
69 Ga0070665_100123899 3300005548 Bacteria 2586
70 Ga0070665_101071592 3300005548 Bacteria 818
71 Ga0070665_101436899 3300005548 Bacteria 699
72 Ga0068855_100299326 3300005563 Bacteria 1782
73 Ga0070664_100826572 3300005564 Bacteria 867
74 Ga0068857_101256553 3300005577 Bacteria 718
75 Ga0068854_100937215 3300005578 Bacteria 763
76 Ga0068856_100388208 3300005614 Bacteria 1416
77 Ga0068856_101377252 3300005614 Bacteria 720
78 Ga0070702_100480344 3300005615 Bacteria 908
79 Ga0068852_100577245 3300005616 Bacteria 1127
80 Ga0068852_100863211 3300005616 Bacteria 921
81 Ga0068859_100640643 3300005617 Bacteria 1155
82 Ga0068859_100997727 3300005617 Bacteria 919
83 Ga0068864_100120886 3300005618 Bacteria 2342
84 Ga0068864_100532287 3300005618 Bacteria 1134
85 Ga0068866_10069128 3300005718 Bacteria 1859
86 Ga0068861_100146258 3300005719 Bacteria 1934
87 Ga0068861_100414489 3300005719 Bacteria 1199
88 Ga0068861_100745116 3300005719 Bacteria 914
89 Ga0068861_101080740 3300005719 Bacteria 770
90 Ga0068870_10111791 3300005840 Bacteria 1561
91 Ga0068870_10249517 3300005840 Bacteria 1099
92 Ga0068863_100653029 3300005841 Bacteria 1043
93 Ga0068863_101074763 3300005841 Bacteria 809
94 Ga0068863_102124980 3300005841 Bacteria 572
95 Ga0068858_100537841 3300005842 Bacteria 1131
96 Ga0068860_100271395 3300005843 Bacteria 1656
97 Ga0068862_100096446 3300005844 Bacteria 2581
98 Ga0068862_100158106 3300005844 Bacteria 2021
99 Ga0068862_100275007 3300005844 Bacteria 1541
100 Ga0068862_100339042 3300005844 Bacteria 1392
101 Ga0068862_100494499 3300005844 Bacteria 1160
102 Ga0068862_100649296 3300005844 Bacteria 1018
103 Ga0068862_100685433 3300005844 Bacteria 991
104 Ga0081455_10010248 3300005937 Bacteria 9531
105 Ga0081455_10032693 3300005937 Bacteria 4685
106 Ga0081540_1010485 3300005983 Bacteria 6267
107 Ga0081540_1025779 3300005983 Bacteria 3374
108 Ga0070717_10093537 3300006028 Bacteria 2541
109 Ga0075365_10047066 3300006038 Bacteria 2834
110 Ga0075365_10064022 3300006038 Bacteria 2462
111 Ga0075365_10108340 3300006038 Bacteria 1907
112 Ga0075365_10330973 3300006038 Bacteria 1073
113 Ga0075365_10556314 3300006038 Bacteria 811
114 Ga0075365_11010297 3300006038 Bacteria 586
115 Ga0075365_11148072 3300006038 Bacteria 547
116 Ga0075363_100152705 3300006048 Bacteria 1304
117 Ga0075363_100244363 3300006048 Bacteria 1032
118 Ga0075363_101035302 3300006048 Bacteria 507
119 Ga0075364_10527844 3300006051 Bacteria 807
120 Ga0075432_10339281 3300006058 Bacteria 634
121 Ga0070716_100178519 3300006173 Bacteria 1392
122 Ga0070716_100375317 3300006173 Bacteria 1015
123 Ga0070712_100022891 3300006175 Bacteria 4120
124 Ga0070712_101105077 3300006175 Bacteria 688
125 Ga0075362_10010840 3300006177 Bacteria 3573
126 Ga0075362_10207570 3300006177 Bacteria 955
127 Ga0075367_10010105 3300006178 Bacteria 4949
128 Ga0075367_10015604 3300006178 Bacteria 4135
129 Ga0075367_10370348 3300006178 Bacteria 905
130 Ga0075367_10403517 3300006178 Bacteria 865
131 Ga0075367_10763046 3300006178 Bacteria 616
132 Ga0075369_10027569 3300006186 Bacteria 2375
133 Ga0075369_10111435 3300006186 Bacteria 1233
134 Ga0075369_10115066 3300006186 Bacteria 1214
135 Ga0075369_10418563 3300006186 Bacteria 633
136 Ga0075366_10088031 3300006195 Bacteria 1859
137 Ga0075366_10393582 3300006195 Bacteria 853
138 Ga0097621_100466517 3300006237 Bacteria 1139
139 Ga0075370_10014849 3300006353 Bacteria 4160
140 Ga0068871_100207326 3300006358 Bacteria 1694
141 Ga0075428_101124951 3300006844 Bacteria 829
142 Ga0068865_100097344 3300006881 Bacteria 2147
143 Ga0068865_100224698 3300006881 Bacteria 1469
144 Ga0097620_100640669 3300006931 Bacteria 1155
145 Ga0097620_100997760 3300006931 Bacteria 919
146 Ga0099794_10198046 3300007265 Bacteria 1028
147 Ga0099795_10303557 3300007788 Bacteria 703
148 Ga0111539_10063823 3300009094 Bacteria 4358
149 Ga0105245_10086952 3300009098 Bacteria 2868
150 Ga0105245_10312939 3300009098 Bacteria 1545
151 Ga0105247_11108093 3300009101 Bacteria 625
152 Ga0114129_10473370 3300009147 Bacteria 1640
153 Ga0114129_11774977 3300009147 Bacteria 751
154 Ga0105243_10051295 3300009148 Bacteria 3263
155 Ga0105243_10129295 3300009148 Bacteria 2141
156 Ga0105243_10178041 3300009148 Bacteria 1847
157 Ga0105243_10595587 3300009148 Bacteria 1063
158 Ga0105243_10622508 3300009148 Bacteria 1042
159 Ga0105242_11526163 3300009176 Unclassified 699
160 Ga0105237_11863084 3300009545 Bacteria 609
161 Ga0105238_11051335 3300009551 Bacteria 836
162 Ga0105238_12090906 3300009551 Bacteria 600
163 Ga0105249_10152353 3300009553 Bacteria 2227
164 Ga0105249_11239007 3300009553 Bacteria 817
165 Ga0105249_11589634 3300009553 Bacteria 726
166 Ga0099796_10010086 3300010159 Bacteria 2584
167 Ga0099796_10286469 3300010159 Bacteria 694
168 Ga0105246_10072418 3300011119 Bacteria 2429
169 Ga0105246_10153159 3300011119 Bacteria 1747
170 Ga0105246_10264762 3300011119 Bacteria 1371
171 Ga0105246_11819989 3300011119 Unclassified 582
172 Ga0157327_1089059 3300012512 Unclassified 509
173 Ga0157369_10573948 3300013105 Bacteria 1165
174 Ga0157374_10037319 3300013296 Bacteria 4459
175 Ga0157374_10167593 3300013296 Bacteria 2141
176 Ga0157374_11031091 3300013296 Bacteria 842
177 Ga0157378_10528191 3300013297 Bacteria 1182
178 Ga0157378_11028184 3300013297 Bacteria 859
179 Ga0163162_10061848 3300013306 Bacteria 3782
180 Ga0163162_10131302 3300013306 Bacteria 2613
181 Ga0163162_10132227 3300013306 Bacteria 2604
182 Ga0163162_11668064 3300013306 Bacteria 728
183 Ga0157375_10239656 3300013308 Bacteria 1973
184 Ga0157375_10737339 3300013308 Bacteria 1137
185 Ga0157375_10777152 3300013308 Bacteria 1108
186 Ga0163163_10072523 3300014325 Bacteria 3433
187 Ga0163163_10540883 3300014325 Bacteria 1227
188 Ga0157380_10028870 3300014326 Bacteria 4235
189 Ga0157380_10029303 3300014326 Bacteria 4207
190 Ga0157377_10085397 3300014745 Bacteria 1853
191 Ga0157377_10236212 3300014745 Bacteria 1178
192 Ga0157379_10171072 3300014968 Bacteria 1961
193 Ga0157379_10270364 3300014968 Bacteria 1546
194 Ga0157376_10029686 3300014969 Bacteria 4358
195 Ga0157376_10048843 3300014969 Bacteria 3503
196 Ga0157376_10100421 3300014969 Bacteria 2527
197 Ga0157376_10227593 3300014969 Bacteria 1730
198 Ga0163161_10127785 3300017792 Bacteria 1915
199 Ga0163161_10326051 3300017792 Bacteria 1215
200 Ga0213871_10003003 3300021441 Bacteria 3190
201 Ga0207426_1018579 3300025302 Bacteria 2446
202 Ga0207697_10247836 3300025315 Bacteria 788
203 Ga0207656_10321173 3300025321 Bacteria 769
204 Ga0207656_10391785 3300025321 Bacteria 697
205 Ga0207682_10034630 3300025893 Bacteria 2036
206 Ga0207682_10239648 3300025893 Bacteria 843
207 Ga0207692_10023828 3300025898 Bacteria 2837
208 Ga0207642_10111666 3300025899 Bacteria 1393
209 Ga0207642_10407178 3300025899 Bacteria 815
210 Ga0207710_10182611 3300025900 Bacteria 1030
211 Ga0207688_10028265 3300025901 Bacteria 3085
212 Ga0207688_10060233 3300025901 Bacteria 2138
213 Ga0207688_10384495 3300025901 Bacteria 868
214 Ga0207680_10097154 3300025903 Bacteria 1885
215 Ga0207647_10603158 3300025904 Bacteria 605
216 Ga0207699_10062167 3300025906 Bacteria 2250
217 Ga0207643_10053819 3300025908 Bacteria 2287
218 Ga0207643_10156176 3300025908 Bacteria 1370
219 Ga0207705_10032092 3300025909 Bacteria 3752
220 Ga0207705_10347614 3300025909 Bacteria 1142
221 Ga0207684_10231489 3300025910 Bacteria 1594
222 Ga0207684_11411235 3300025910 Bacteria 570
223 Ga0207654_10301928 3300025911 Bacteria 1089
224 Ga0207707_10038517 3300025912 Bacteria 4177
225 Ga0207693_10403042 3300025915 Bacteria 1069
226 Ga0207663_10031000 3300025916 Bacteria 3159
227 Ga0207663_10076375 3300025916 Bacteria 2177
228 Ga0207657_10233307 3300025919 Bacteria 1471
229 Ga0207657_10575994 3300025919 Bacteria 879
230 Ga0207649_10055381 3300025920 Bacteria 2472
231 Ga0207649_10197188 3300025920 Bacteria 1420
232 Ga0207652_10721837 3300025921 Bacteria 888
233 Ga0207694_10457575 3300025924 Bacteria 1066
234 Ga0207694_10604813 3300025924 Bacteria 922
235 Ga0207659_10115864 3300025926 Bacteria 2045
236 Ga0207659_10898448 3300025926 Bacteria 761
237 Ga0207687_10145680 3300025927 Bacteria 1802
238 Ga0207687_10161042 3300025927 Bacteria 1722
239 Ga0207700_10288014 3300025928 Bacteria 1415
240 Ga0207700_10745094 3300025928 Bacteria 875
241 Ga0207700_10888415 3300025928 Bacteria 797
242 Ga0207700_10923459 3300025928 Bacteria 781
243 Ga0207700_10994068 3300025928 Bacteria 751
244 Ga0207664_10863555 3300025929 Bacteria 813
245 Ga0207644_10124264 3300025931 Bacteria 1968
246 Ga0207644_10432996 3300025931 Bacteria 1079
247 Ga0207644_10985051 3300025931 Bacteria 707
248 Ga0207644_11131063 3300025931 Bacteria 658
249 Ga0207644_11354219 3300025931 Bacteria 598
250 Ga0207690_10184156 3300025932 Bacteria 1575
251 Ga0207706_10028054 3300025933 Bacteria 5029
252 Ga0207706_10103764 3300025933 Bacteria 2501
253 Ga0207706_10241868 3300025933 Bacteria 1578
254 Ga0207686_10362015 3300025934 Bacteria 1095
255 Ga0207686_10512620 3300025934 Bacteria 932
256 Ga0207686_11127210 3300025934 Bacteria 640
257 Ga0207709_10044345 3300025935 Bacteria 2686
258 Ga0207709_10182896 3300025935 Bacteria 1482
259 Ga0207709_10381346 3300025935 Bacteria 1073
260 Ga0207709_10548389 3300025935 Bacteria 909
261 Ga0207709_10550441 3300025935 Bacteria 907
262 Ga0207670_10601746 3300025936 Bacteria 903
263 Ga0207669_10060622 3300025937 Bacteria 2320
264 Ga0207704_10023741 3300025938 Bacteria 3311
265 Ga0207704_10470331 3300025938 Bacteria 1007
266 Ga0207691_10058891 3300025940 Bacteria 3493
267 Ga0207711_10506982 3300025941 Bacteria 1125
268 Ga0207689_10030824 3300025942 Bacteria 4469
269 Ga0207689_10192281 3300025942 Bacteria 1684
270 Ga0207689_10355671 3300025942 Bacteria 1218
271 Ga0207679_11970004 3300025945 Bacteria 532
272 Ga0207667_10740402 3300025949 Bacteria 983
273 Ga0207651_10361534 3300025960 Bacteria 1225
274 Ga0207712_10098746 3300025961 Bacteria 2166
275 Ga0207668_10016598 3300025972 Bacteria 4597
276 Ga0207668_10532129 3300025972 Bacteria 1015
277 Ga0207668_10786275 3300025972 Bacteria 841
278 Ga0207668_11024471 3300025972 Bacteria 738
279 Ga0207640_10331952 3300025981 Bacteria 1215
280 Ga0207640_10518315 3300025981 Bacteria 996
281 Ga0207658_10222461 3300025986 Bacteria 1589
282 Ga0207677_10163200 3300026023 Bacteria 1733
283 Ga0207703_10918035 3300026035 Bacteria 839
284 Ga0207639_10284672 3300026041 Bacteria 1455
285 Ga0207639_10437475 3300026041 Bacteria 1185
286 Ga0207639_10693480 3300026041 Bacteria 944
287 Ga0207639_11100586 3300026041 Bacteria 745
288 Ga0207678_10014474 3300026067 Bacteria 6934
289 Ga0207678_10025695 3300026067 Bacteria 5140
290 Ga0207678_10088395 3300026067 Bacteria 2648
291 Ga0207678_10127232 3300026067 Bacteria 2173
292 Ga0207678_10128892 3300026067 Bacteria 2157
293 Ga0207678_10654408 3300026067 Bacteria 923
294 Ga0207708_10051720 3300026075 Bacteria 3128
295 Ga0207702_10217560 3300026078 Bacteria 1779
296 Ga0207702_10563269 3300026078 Bacteria 1115
297 Ga0207702_10758402 3300026078 Bacteria 958
298 Ga0207702_10922964 3300026078 Bacteria 865
299 Ga0207641_10439748 3300026088 Bacteria 1259
300 Ga0207641_10952661 3300026088 Bacteria 854
301 Ga0207641_11607373 3300026088 Bacteria 652
302 Ga0207648_10228298 3300026089 Bacteria 1655
303 Ga0207648_10487022 3300026089 Bacteria 1127
304 Ga0207648_11268141 3300026089 Bacteria 692
305 Ga0207648_11308042 3300026089 Bacteria 681
306 Ga0207676_10463614 3300026095 Bacteria 1197
307 Ga0207675_100105675 3300026118 Bacteria 2654
308 Ga0207675_100125431 3300026118 Bacteria 2432
309 Ga0207675_100436994 3300026118 Bacteria 1295
310 Ga0207683_10030555 3300026121 Bacteria 4668
311 Ga0207683_10052770 3300026121 Bacteria 3563
312 Ga0207683_10069285 3300026121 Bacteria 3115
313 Ga0207698_10145070 3300026142 Bacteria 2052
314 Ga0207698_10364680 3300026142 Bacteria 1369
315 Ga0207698_12094877 3300026142 Bacteria 579
316 Ga0207428_10900492 3300027907 Bacteria 625
317 Ga0268266_10069655 3300028379 Bacteria 3048
318 Ga0268266_10159256 3300028379 Bacteria 2041
319 Ga0268266_10254387 3300028379 Bacteria 1626
320 Ga0268266_11125455 3300028379 Bacteria 759
321 Ga0268266_12060622 3300028379 Bacteria 544
322 Ga0268265_10125700 3300028380 Bacteria 2121
323 Ga0268265_10381031 3300028380 Bacteria 1297
324 Ga0268265_10702917 3300028380 Bacteria 977
325 Ga0268265_10803869 3300028380 Bacteria 917
326 Ga0268265_11121774 3300028380 Bacteria 781
327 Ga0268264_10617794 3300028381 Bacteria 1070
328 Ga0307515_10441619 3300028794 Bacteria 918
329 Ga0265339_10014663 3300031249 Bacteria 4719
330 Ga0307513_10127902 3300031456 Bacteria 2492
331 Ga0307513_10334006 3300031456 Bacteria 1269
332 Ga0307509_10048526 3300031507 Bacteria 4558
333 Ga0307408_100194520 3300031548 Bacteria 1637
334 Ga0307508_10025641 3300031616 Bacteria 5342
335 Ga0307508_10192167 3300031616 Bacteria 1643
336 Ga0307516_10047101 3300031730 Bacteria 4251
337 Ga0307516_10309310 3300031730 Bacteria 1254
338 Ga0307405_10511199 3300031731 Bacteria 965
339 Ga0307413_10214756 3300031824 Bacteria 1400
340 Ga0307410_10830071 3300031852 Bacteria 788
341 Ga0307407_10848710 3300031903 Bacteria 698
342 Ga0307412_10082624 3300031911 Bacteria 2225
343 Ga0307412_10402450 3300031911 Bacteria 1115
344 Ga0307409_100448206 3300031995 Bacteria 1245
345 Ga0307409_100859305 3300031995 Bacteria 918
346 Ga0307416_100274116 3300032002 Bacteria 1659
347 Ga0307416_100584975 3300032002 Bacteria 1194
348 Ga0307416_102448325 3300032002 Bacteria 621
349 Ga0307416_102707166 3300032002 Bacteria 592
350 Ga0307415_100369903 3300032126 Bacteria 1213
351 Ga0307507_10245922 3300033179 Bacteria 1163
352 Ga0307510_10002750 3300033180 Bacteria 20142
353 Ga0373924_0085176 3300035410 Bacteria 1348
354 Ga0373927_0076037 3300035695 Bacteria 2175
355 Ga0373927_0082527 3300035695 Bacteria 2084
356 Ga0395905_0300502 3300037471 Bacteria 1492
357 Ga0395901_0093777 3300038443 Bacteria 3144
358 Ga0436360_0171673 3300039438 Bacteria 1967
359 Ga0436361_0980533 3300039447 Bacteria 2758
360 Ga0436362_1195182 3300039453 Bacteria 8393
361 Ga0451791_0984995 3300041451 Bacteria 790
362 Ga0451797_0145581 3300041453 Bacteria 801
363 Ga0451802_2061766 3300041460 Bacteria 623
364 Ga0451837_0635699 3300041494 Bacteria 980
365 Ga0451853_0001777 3300041512 Bacteria 1226
366 Ga0495617_047766 3300046452 Bacteria 1424
367 Ga0495603_0376533 3300046455 Bacteria 814
368 Ga0495603_0398284 3300046455 Bacteria 789
369 Ga0495603_0614277 3300046455 Bacteria 622
370 Ga0495590_0024200 3300046457 Bacteria 2140
371 Ga0495638_0055163 3300046460 Bacteria 2468
372 Ga0495580_0233630 3300046472 Bacteria 1262
373 Ga0495580_0319164 3300046472 Bacteria 1056
374 Ga0495582_0040006 3300046473 Bacteria 2581
375 Ga0495664_0007535 3300046477 Bacteria 6050
376 Ga0495584_0052987 3300046491 Bacteria 2042
377 Ga0495584_0121185 3300046491 Bacteria 1324
378 Ga0495585_0134543 3300046492 Bacteria 1298
379 Ga0495596_0126577 3300046500 Bacteria 992
380 Ga0495596_0388389 3300046500 Bacteria 544
381 Ga0495606_0055353 3300046507 Bacteria 2565
382 Ga0495610_0024455 3300046512 Bacteria 3259
383 Ga0495610_0233094 3300046512 Bacteria 738
384 Ga0495616_0112694 3300046513 Bacteria 1262
385 Ga0495628_0837587 3300046516 Bacteria 642
386 Ga0495631_0098964 3300046518 Bacteria 1255
387 Ga0495631_0192280 3300046518 Bacteria 873
388 Ga0495632_0414995 3300046519 Bacteria 587
389 Ga0495637_0066071 3300046520 Bacteria 1471
390 Ga0495643_0211238 3300046522 Bacteria 926
391 Ga0495644_0055237 3300046523 Bacteria 1492
392 Ga0495663_0355483 3300046525 Bacteria 534
393 Ga0495642_0116295 3300046528 Bacteria 1146
394 Ga0495598_0061197 3300046537 Bacteria 1162
395 Ga0495598_0266561 3300046537 Bacteria 639
396 Ga0495609_0065367 3300046538 Bacteria 1603
397 Ga0495645_0095728 3300046543 Bacteria 2116
398 Ga0495622_0271679 3300046557 Bacteria 743
399 Ga0495633_0203504 3300046558 Bacteria 908
400 Ga0495656_0017676 3300046615 Bacteria 2724
401 Ga0495656_0059399 3300046615 Bacteria 1663
402 Ga0495656_0059467 3300046615 Bacteria 1663
403 Ga0495656_0064256 3300046615 Bacteria 1611
404 Ga0495668_0042024 3300046616 Bacteria 2545
405 Ga0495668_0328740 3300046616 Bacteria 838
406 Ga0495668_0422269 3300046616 Bacteria 733
407 Ga0495668_0546327 3300046616 Unclassified 639
408 Ga0495611_0127198 3300046648 Bacteria 1188
409 Ga0495611_0162544 3300046648 Bacteria 1043
410 Ga0495625_0074014 3300046660 Bacteria 2386
411 Ga0495625_0162746 3300046660 Bacteria 1494
412 Ga0495625_0249504 3300046660 Bacteria 1153
413 Ga0495625_0441404 3300046660 Bacteria 806
414 Ga0495635_0069599 3300046663 Bacteria 2412
415 Ga0495635_0449643 3300046663 Bacteria 852
416 Ga0495659_0010297 3300046664 Bacteria 2996
417 Ga0495661_0103242 3300046665 Bacteria 1601
418 Ga0495661_0168755 3300046665 Bacteria 1169
419 Ga0495599_0009732 3300046678 Bacteria 5883
420 Ga0495623_0513646 3300046679 Bacteria 631
421 Ga0495647_0144253 3300046681 Bacteria 1017
422 Ga0495669_0006370 3300046684 Bacteria 4931
423 Ga0495669_0050356 3300046684 Bacteria 1867
424 Ga0495669_0107790 3300046684 Bacteria 1299
425 Ga0495613_0410434 3300046689 Bacteria 923
426 Ga0495624_0155079 3300046690 Bacteria 1400
427 Ga0495624_0359281 3300046690 Bacteria 876
428 Ga0495670_0053358 3300046691 Bacteria 2025
429 Ga0495670_0085573 3300046691 Bacteria 1609
430 Ga0495671_0085197 3300046692 Bacteria 1548
431 Ga0495671_0397749 3300046692 Bacteria 660
432 Ga0495589_0161169 3300046794 Bacteria 1068
433 Ga0495589_0423486 3300046794 Bacteria 610
434 Ga0495660_0095278 3300046810 Bacteria 1540
435 Ga0495660_0446198 3300046810 Bacteria 560
436 Ga0495581_0438746 3300047315 Bacteria 761
437 Ga0495581_0813154 3300047315 Bacteria 536
438 Ga0495636_0583368 3300047318 Bacteria 546
439 Ga0495672_0557872 3300047320 Bacteria 501
440 Ga0495683_0064953 3300047323 Bacteria 1801
441 Ga0495683_0179822 3300047323 Bacteria 967
442 Ga0495677_0202144 3300047445 Bacteria 772
443 Ga0495673_0117517 3300047469 Bacteria 1056
444 Ga0495686_0385063 3300047472 Bacteria 756
445 Ga0495686_0489887 3300047472 Bacteria 649
446 Ga0495615_0266763 3300048090 Bacteria 546
447 Ga0496100_0039720 3300048903 Bacteria 2989
448 Ga0496100_0042622 3300048903 Bacteria 2899
449 Ga0496100_0104682 3300048903 Bacteria 1956
450 Ga0496100_0111806 3300048903 Bacteria 1899
451 Ga0496100_0711147 3300048903 Bacteria 784
452 Ga0496101_0035228 3300048904 Bacteria 3539
453 Ga0496101_0144942 3300048904 Bacteria 1813
454 Ga0496101_0176540 3300048904 Bacteria 1643
455 Ga0496101_0209126 3300048904 Bacteria 1511
456 Ga0496101_0881685 3300048904 Bacteria 705
457 Ga0496101_1480068 3300048904 Bacteria 529
458 Ga0496102_0007280 3300048905 Bacteria 9446
459 Ga0496102_0059093 3300048905 Bacteria 3505
460 Ga0496102_0230541 3300048905 Bacteria 1746
461 Ga0496102_0370421 3300048905 Bacteria 1348
462 Ga0496102_0706523 3300048905 Bacteria 931
463 Ga0496103_0025530 3300048906 Bacteria 3572
464 Ga0496103_0110091 3300048906 Bacteria 1749
465 Ga0496103_0145176 3300048906 Bacteria 1519
466 Ga0496103_0376006 3300048906 Bacteria 913
467 Ga0496104_0105847 3300048907 Bacteria 2695
468 Ga0496105_0037782 3300048908 Bacteria 3976
469 Ga0496105_0095148 3300048908 Bacteria 2460
470 Ga0496106_0016633 3300048909 Bacteria 5442
471 Ga0496106_0023672 3300048909 Bacteria 4563
472 Ga0496106_1536405 3300048909 Bacteria 511
473 Ga0496107_0011045 3300048910 Bacteria 6283
474 Ga0496108_0036764 3300048911 Bacteria 4075
475 Ga0496108_0055252 3300048911 Bacteria 3333
476 Ga0496109_0015296 3300048912 Bacteria 6682
477 Ga0496109_0017506 3300048912 Bacteria 6283
478 Ga0496110_0849010 3300048913 Bacteria 818
479 Ga0496111_0289304 3300048914 Bacteria 1215
480 Ga0496111_0610898 3300048914 Bacteria 798
481 Ga0496112_0452199 3300048915 Bacteria 1222
482 Ga0496112_0600478 3300048915 Bacteria 1032
483 Ga0496112_0666399 3300048915 Bacteria 969
484 Ga0496113_0044800 3300048916 Bacteria 3279
485 Ga0496114_0222610 3300048917 Bacteria 1656
486 Ga0496114_0273197 3300048917 Bacteria 1489
487 Ga0496114_0651312 3300048917 Bacteria 926
488 Ga0496115_0009330 3300048918 Bacteria 7290
489 Ga0496115_0016299 3300048918 Bacteria 5655
490 Ga0496120_0212754 3300048923 Bacteria 929
491 Ga0496121_0060878 3300048924 Bacteria 3102
492 Ga0496121_0433298 3300048924 Bacteria 852
493 Ga0496124_0670726 3300048927 Bacteria 662
494 Ga0496125_0074753 3300048928 Bacteria 2626
495 Ga0496126_0013541 3300048929 Bacteria 8286
496 Ga0496126_0141949 3300048929 Bacteria 2066
497 Ga0496126_1061857 3300048929 Bacteria 604
498 Ga0495678_036478 3300049459 Bacteria 2006
499 Ga0495682_0018175 3300049460 Bacteria 2649
500 Ga0501249_176182 3300049679 Bacteria 551
501 Ga0501258_044383 3300049687 Bacteria 603
502 Ga0501221_038966 3300049704 Bacteria 1029
503 nmdc:mga03683_325955_c1 3300050489 Bacteria 724
504 nmdc:mga03n38_410819_c1 3300050490 Bacteria 747
505 nmdc:mga00v17_181798_c1 3300050491 Bacteria 1357
506 nmdc:mga0yw44_1129352_c1 3300050492 Bacteria 529
507 nmdc:mga0yw44_134371_c1 3300050492 Bacteria 1604
508 nmdc:mga0yw44_503581_c1 3300050492 Bacteria 822
509 nmdc:mga0yw44_514636_c1 3300050492 Bacteria 812
510 nmdc:mga0k408_335288_c1 3300050493 Bacteria 902
511 nmdc:mga0k408_843256_c1 3300050493 Bacteria 533
512 nmdc:mga06z11_12868_c1 3300050494 Bacteria 3652
513 nmdc:mga06z11_135888_c1 3300050494 Bacteria 1385
514 nmdc:mga06z11_143897_c1 3300050494 Bacteria 1350
515 nmdc:mga06z11_180487_c1 3300050494 Bacteria 1217
516 nmdc:mga06z11_643312_c1 3300050494 Bacteria 645
517 nmdc:mga07m45_48938_c1 3300050496 Bacteria 2378
518 nmdc:mga07m45_591602_c1 3300050496 Bacteria 641
519 nmdc:mga05p37_1107660_c1 3300050507 Bacteria 828
520 nmdc:mga05p37_284490_c1 3300050507 Bacteria 1970
521 nmdc:mga08y16_1072201_c1 3300050511 Bacteria 782
522 nmdc:mga08y16_1196722_c1 3300050511 Bacteria 731
523 nmdc:mga08y16_97542_c1 3300050511 Bacteria 3061
524 nmdc:mga0n895_137117_c1 3300050512 Bacteria 2474
525 nmdc:mga0rr50_642470_c1 3300050513 Unclassified 905
526 nmdc:mga0a205_493051_c1 3300050515 Unclassified 1082
527 nmdc:mga0sz30_120026_c1 3300050516 Bacteria 1155
528 nmdc:mga0sz30_39977_c1 3300050516 Bacteria 1970
529 Ga0495601_0176770 3300053077 Bacteria 1395
530 Ga0495612_0019127 3300053078 Bacteria 2743
531 Ga0495655_0125070 3300053083 Bacteria 787
532 Ga0495655_0215197 3300053083 Bacteria 634
533 Ga0500646_0029619 3300053090 Bacteria 1500
534 Ga0500566_0228413 3300053094 Bacteria 920
535 Ga0500641_0007121 3300053096 Bacteria 3981
536 Ga0500641_0227549 3300053096 Bacteria 789
537 Ga0500650_0095425 3300053098 Bacteria 1392
538 Ga0500562_037409 3300053108 Bacteria 1288
539 Ga0500594_0207125 3300053118 Bacteria 646
540 Ga0500594_0311717 3300053118 Bacteria 528
541 Ga0500595_014673 3300053119 Bacteria 2965
542 Ga0500628_232394 3300053129 Bacteria 539
543 Ga0500642_0183799 3300053130 Bacteria 977
544 Ga0500655_013504 3300053133 Bacteria 1491
545 Ga0500588_0045689 3300053146 Bacteria 1343
546 Ga0500604_0063691 3300053151 Bacteria 1163
547 Ga0500622_0261946 3300053156 Bacteria 754
548 Ga0500633_0109388 3300053160 Bacteria 1023
549 Ga0500634_0024704 3300053161 Bacteria 3269
550 Ga0500634_0242631 3300053161 Bacteria 755
551 Ga0500638_057435 3300053162 Bacteria 1874
552 Ga0500637_0415050 3300053178 Bacteria 694
553 Ga0500609_024714 3300053731 Bacteria 823
554 Ga0587070_063518 3300059491 Bacteria 770
555 2524471613 2524023210 Bacteria 9029266
556 2528852837 2528768022 Bacteria 10457665
557 2793079862
558 2818241304 2816332527 Bacteria 8933356
559 2824662815 2824661429 Bacteria 9877870
560 2876769259 2876761206 Bacteria 10111113
561 2876817350 2876808645 Bacteria 8824342
562 2879102782 2879099564 Bacteria 10442239
563 2879115635 2879110137 Bacteria 8907982
564 2885416759 2885409591 Bacteria 9235467
565 2889034785 2889033259 Bacteria 9099371
566 2922370761
567 2932785465 2932784394 Bacteria 9704911
568 2932816616 2932809354 Bacteria 9135765
569 2932822097 2932818245 Bacteria 9955613
570 2932833178 2932828146 Bacteria 9745859
571 2935620575 2935616580 Bacteria 9032984
572 2935639662 2935638405 Bacteria 10015038
573 2935644125 2935638405 Bacteria 10015038
574 2935667500 2935665750 Bacteria 9571747
575 2935668961 2935665750 Bacteria 9571747
576 2935677442 2935675223 Bacteria 9928132
577 2935690616 2935684952 Bacteria 9590419
578 2935705240 2935703347 Bacteria 10242284
579 2935717688 2935713505 Bacteria 9608509
580 2935727162 2935722832 Bacteria 9608746
581 2935735932 2935732158 Bacteria 9706831
582 2935744797 2935741537 Bacteria 9707219
583 2935755625 2935750917 Bacteria 9590372
584 2935761862 2935760218 Bacteria 9817913
585 2935805678 2935801545 Bacteria 9301974
586 2935806986 2935801545 Bacteria 9301974
587 2935814183 2935810662 Bacteria 9401221
588 2935829145 2935827899 Bacteria 10038562
589 2935833376 2935827899 Bacteria 10038562
590 2935845321 2935837841 Bacteria 9454360
591 2935858383 2935855204 Bacteria 9035059
592 2935872319 2935864058 Bacteria 9784707
593 2935877334 2935873716 Bacteria 9632195
594 2935995047 2935992306 Bacteria 9802711
595 2935995428 2935992306 Bacteria 9802711
596 2936006140 2936002035 Bacteria 9362176
597 2936039738 2936037263 Bacteria 9446081
598 2940561094 2940556831 Bacteria 9590747
599 2941545708 2941538514 Bacteria 9402094
600 8006967412 8006964411 Bacteria 8966052
601 8016516880 8016511872 Bacteria 9921665
602 8017059692 8017057580 Bacteria 10023680
603 8019579165 8019576017 Bacteria 10049540
604 8019597218 8019586578 Bacteria 10212056
605 8019604475 8019597564 Bacteria 10041141
606 8019614062 8019608314 Bacteria 10042931
607 8056674517 8056673599 Bacteria 7871253
608 Ga0207665_10098657
609 JGI24750J21931_1058286
610 JGI24742J22300_10083899
611 Ga0070676_10086729
612 Ga0070683_100408282
613 Ga0070683_100445499
614 Ga0068869_100061420
615 Ga0068869_100065769
616 Ga0068869_100231340
617 Ga0068869_101410366
618 Ga0070666_10212305
619 Ga0068868_100198078
620 Ga0068868_101591827
621 Ga0068868_101711854
622 Ga0068868_101736881
623 Ga0070660_100274006
624 Ga0070660_100530966
625 Ga0070689_100234394
626 Ga0070661_100100393
627 Ga0070668_100055681
628 Ga0070668_100100503
629 Ga0070668_100119044
630 Ga0070668_100301692
631 Ga0070668_100352217
632 Ga0070669_101428276
633 Ga0070675_100189017
634 Ga0070675_100386892
635 Ga0070675_101144739
636 Ga0070671_100109903
637 Ga0070671_100501737
638 Ga0070674_100098773
639 Ga0070674_100558709
640 Ga0070673_100326750
641 Ga0070659_100461439
642 Ga0070667_100743490
643 Ga0070667_100935097
644 Ga0070713_100963826
645 Ga0070710_10258144
646 Ga0070701_10087309
647 Ga0070711_100933531
648 Ga0070700_100194364
649 Ga0070700_100399184
650 Ga0070694_100136536
651 Ga0070694_101792831
652 Ga0070663_100075481
653 Ga0070663_100087927
654 Ga0070663_100104408
655 Ga0070663_100329246
656 Ga0070678_100012629
657 Ga0070678_100032022
658 Ga0070678_100040379
659 Ga0070678_100054250
660 Ga0070662_100024491
661 Ga0070662_100069261
662 Ga0070662_100371360
663 Ga0070681_10184437
664 Ga0068867_100170192
665 Ga0068867_101472785
666 Ga0070706_100161428
667 Ga0070684_100154390
668 Ga0070697_101004846
669 Ga0068853_100113256
670 Ga0068853_101540588
671 Ga0070672_100046304
672 Ga0070686_100066712
673 Ga0070693_100484521
674 Ga0070693_100723803
675 Ga0070693_101073248
676 Ga0070665_100123899
677 Ga0070665_101071592
678 Ga0070665_101436899
679 Ga0068855_100299326
680 Ga0070664_100826572
681 Ga0068857_101256553
682 Ga0068854_100937215
683 Ga0068856_100388208
684 Ga0068856_101377252
685 Ga0070702_100480344
686 Ga0068852_100577245
687 Ga0068852_100863211
688 Ga0068859_100640643
689 Ga0068859_100997727
690 Ga0068864_100120886
691 Ga0068864_100532287
692 Ga0068866_10069128
693 Ga0068861_100146258
694 Ga0068861_100414489
695 Ga0068861_100745116
696 Ga0068861_101080740
697 Ga0068870_10111791
698 Ga0068870_10249517
699 Ga0068863_100653029
700 Ga0068863_101074763
701 Ga0068863_102124980
702 Ga0068858_100537841
703 Ga0068860_100271395
704 Ga0068862_100096446
705 Ga0068862_100158106
706 Ga0068862_100275007
707 Ga0068862_100339042
708 Ga0068862_100494499
709 Ga0068862_100649296
710 Ga0068862_100685433
711 Ga0081455_10010248
712 Ga0081455_10032693
713 Ga0081540_1010485
714 Ga0081540_1025779
715 Ga0070717_10093537
716 Ga0075365_10047066
717 Ga0075365_10064022
718 Ga0075365_10108340
719 Ga0075365_10330973
720 Ga0075365_10556314
721 Ga0075365_11010297
722 Ga0075365_11148072
723 Ga0075363_100152705
724 Ga0075363_100244363
725 Ga0075363_101035302
726 Ga0075364_10527844
727 Ga0075432_10339281
728 Ga0070716_100178519
729 Ga0070716_100375317
730 Ga0070712_100022891
731 Ga0070712_101105077
732 Ga0075362_10010840
733 Ga0075362_10207570
734 Ga0075367_10010105
735 Ga0075367_10015604
736 Ga0075367_10370348
737 Ga0075367_10403517
738 Ga0075367_10763046
739 Ga0075369_10027569
740 Ga0075369_10111435
741 Ga0075369_10115066
742 Ga0075369_10418563
743 Ga0075366_10088031
744 Ga0075366_10393582
745 Ga0097621_100466517
746 Ga0075370_10014849
747 Ga0068871_100207326
748 Ga0075428_101124951
749 Ga0068865_100097344
750 Ga0068865_100224698
751 Ga0097620_100640669
752 Ga0097620_100997760
753 Ga0099794_10198046
754 Ga0099795_10303557
755 Ga0111539_10063823
756 Ga0105245_10086952
757 Ga0105245_10312939
758 Ga0105247_11108093
759 Ga0114129_10473370
760 Ga0114129_11774977
761 Ga0105243_10051295
762 Ga0105243_10129295
763 Ga0105243_10178041
764 Ga0105243_10595587
765 Ga0105243_10622508
766 Ga0105242_11526163
767 Ga0105237_11863084
768 Ga0105238_11051335
769 Ga0105238_12090906
770 Ga0105249_10152353
771 Ga0105249_11239007
772 Ga0105249_11589634
773 Ga0099796_10010086
774 Ga0099796_10286469
775 Ga0105246_10072418
776 Ga0105246_10153159
777 Ga0105246_10264762
778 Ga0105246_11819989
779 Ga0157327_1089059
780 Ga0157369_10573948
781 Ga0157374_10037319
782 Ga0157374_10167593
783 Ga0157374_11031091
784 Ga0157378_10528191
785 Ga0157378_11028184
786 Ga0163162_10061848
787 Ga0163162_10131302
788 Ga0163162_10132227
789 Ga0163162_11668064
790 Ga0157375_10239656
791 Ga0157375_10737339
792 Ga0157375_10777152
793 Ga0163163_10072523
794 Ga0163163_10540883
795 Ga0157380_10028870
796 Ga0157380_10029303
797 Ga0157377_10085397
798 Ga0157377_10236212
799 Ga0157379_10171072
800 Ga0157379_10270364
801 Ga0157376_10029686
802 Ga0157376_10048843
803 Ga0157376_10100421
804 Ga0157376_10227593
805 Ga0163161_10127785
806 Ga0163161_10326051
807 Ga0213871_10003003
808 Ga0207426_1018579
809 Ga0207697_10247836
810 Ga0207656_10321173
811 Ga0207656_10391785
812 Ga0207682_10034630
813 Ga0207682_10239648
814 Ga0207692_10023828
815 Ga0207642_10111666
816 Ga0207642_10407178
817 Ga0207710_10182611
818 Ga0207688_10028265
819 Ga0207688_10060233
820 Ga0207688_10384495
821 Ga0207680_10097154
822 Ga0207647_10603158
823 Ga0207699_10062167
824 Ga0207643_10053819
825 Ga0207643_10156176
826 Ga0207705_10032092
827 Ga0207705_10347614
828 Ga0207684_10231489
829 Ga0207684_11411235
830 Ga0207654_10301928
831 Ga0207707_10038517
832 Ga0207693_10403042
833 Ga0207663_10031000
834 Ga0207663_10076375
835 Ga0207657_10233307
836 Ga0207657_10575994
837 Ga0207649_10055381
838 Ga0207649_10197188
839 Ga0207652_10721837
840 Ga0207694_10457575
841 Ga0207694_10604813
842 Ga0207659_10115864
843 Ga0207659_10898448
844 Ga0207687_10145680
845 Ga0207687_10161042
846 Ga0207700_10288014
847 Ga0207700_10745094
848 Ga0207700_10888415
849 Ga0207700_10923459
850 Ga0207700_10994068
851 Ga0207664_10863555
852 Ga0207644_10124264
853 Ga0207644_10432996
854 Ga0207644_10985051
855 Ga0207644_11131063
856 Ga0207644_11354219
857 Ga0207690_10184156
858 Ga0207706_10028054
859 Ga0207706_10103764
860 Ga0207706_10241868
861 Ga0207686_10362015
862 Ga0207686_10512620
863 Ga0207686_11127210
864 Ga0207709_10044345
865 Ga0207709_10182896
866 Ga0207709_10381346
867 Ga0207709_10548389
868 Ga0207709_10550441
869 Ga0207670_10601746
870 Ga0207669_10060622
871 Ga0207704_10023741
872 Ga0207704_10470331
873 Ga0207691_10058891
874 Ga0207711_10506982
875 Ga0207689_10030824
876 Ga0207689_10192281
877 Ga0207689_10355671
878 Ga0207679_11970004
879 Ga0207667_10740402
880 Ga0207651_10361534
881 Ga0207712_10098746
882 Ga0207668_10016598
883 Ga0207668_10532129
884 Ga0207668_10786275
885 Ga0207668_11024471
886 Ga0207640_10331952
887 Ga0207640_10518315
888 Ga0207658_10222461
889 Ga0207677_10163200
890 Ga0207703_10918035
891 Ga0207639_10284672
892 Ga0207639_10437475
893 Ga0207639_10693480
894 Ga0207639_11100586
895 Ga0207678_10014474
896 Ga0207678_10025695
897 Ga0207678_10088395
898 Ga0207678_10127232
899 Ga0207678_10128892
900 Ga0207678_10654408
901 Ga0207708_10051720
902 Ga0207702_10217560
903 Ga0207702_10563269
904 Ga0207702_10758402
905 Ga0207702_10922964
906 Ga0207641_10439748
907 Ga0207641_10952661
908 Ga0207641_11607373
909 Ga0207648_10228298
910 Ga0207648_10487022
911 Ga0207648_11268141
912 Ga0207648_11308042
913 Ga0207676_10463614
914 Ga0207675_100105675
915 Ga0207675_100125431
916 Ga0207675_100436994
917 Ga0207683_10030555
918 Ga0207683_10052770
919 Ga0207683_10069285
920 Ga0207698_10145070
921 Ga0207698_10364680
922 Ga0207698_12094877
923 Ga0207428_10900492
924 Ga0268266_10069655
925 Ga0268266_10159256
926 Ga0268266_10254387
927 Ga0268266_11125455
928 Ga0268266_12060622
929 Ga0268265_10125700
930 Ga0268265_10381031
931 Ga0268265_10702917
932 Ga0268265_10803869
933 Ga0268265_11121774
934 Ga0268264_10617794
935 Ga0307515_10441619
936 Ga0265339_10014663
937 Ga0307513_10127902
938 Ga0307513_10334006
939 Ga0307509_10048526
940 Ga0307408_100194520
941 Ga0307508_10025641
942 Ga0307508_10192167
943 Ga0307516_10047101
944 Ga0307516_10309310
945 Ga0307405_10511199
946 Ga0307413_10214756
947 Ga0307410_10830071
948 Ga0307407_10848710
949 Ga0307412_10082624
950 Ga0307412_10402450
951 Ga0307409_100448206
952 Ga0307409_100859305
953 Ga0307416_100274116
954 Ga0307416_100584975
955 Ga0307416_102448325
956 Ga0307416_102707166
957 Ga0307415_100369903
958 Ga0307507_10245922
959 Ga0307510_10002750
960 Ga0373924_0085176
961 Ga0373927_0076037
962 Ga0373927_0082527
963 Ga0395905_0300502
964 Ga0395901_0093777
965 Ga0436360_0171673
966 Ga0436361_0980533
967 Ga0436362_1195182
968 Ga0451791_0984995
969 Ga0451797_0145581
970 Ga0451802_2061766
971 Ga0451837_0635699
972 Ga0451853_0001777
973 Ga0495617_047766
974 Ga0495603_0376533
975 Ga0495603_0398284
976 Ga0495603_0614277
977 Ga0495590_0024200
978 Ga0495638_0055163
979 Ga0495580_0233630
980 Ga0495580_0319164
981 Ga0495582_0040006
982 Ga0495664_0007535
983 Ga0495584_0052987
984 Ga0495584_0121185
985 Ga0495585_0134543
986 Ga0495596_0126577
987 Ga0495596_0388389
988 Ga0495606_0055353
989 Ga0495610_0024455
990 Ga0495610_0233094
991 Ga0495616_0112694
992 Ga0495628_0837587
993 Ga0495631_0098964
994 Ga0495631_0192280
995 Ga0495632_0414995
996 Ga0495637_0066071
997 Ga0495643_0211238
998 Ga0495644_0055237
999 Ga0495663_0355483
1000 Ga0495642_0116295
1001 Ga0495598_0061197
1002 Ga0495598_0266561
1003 Ga0495609_0065367
1004 Ga0495645_0095728
1005 Ga0495622_0271679
1006 Ga0495633_0203504
1007 Ga0495656_0017676
1008 Ga0495656_0059399
1009 Ga0495656_0059467
1010 Ga0495656_0064256
1011 Ga0495668_0042024
1012 Ga0495668_0328740
1013 Ga0495668_0422269
1014 Ga0495668_0546327
1015 Ga0495611_0127198
1016 Ga0495611_0162544
1017 Ga0495625_0074014
1018 Ga0495625_0162746
1019 Ga0495625_0249504
1020 Ga0495625_0441404
1021 Ga0495635_0069599
1022 Ga0495635_0449643
1023 Ga0495659_0010297
1024 Ga0495661_0103242
1025 Ga0495661_0168755
1026 Ga0495599_0009732
1027 Ga0495623_0513646
1028 Ga0495647_0144253
1029 Ga0495669_0006370
1030 Ga0495669_0050356
1031 Ga0495669_0107790
1032 Ga0495613_0410434
1033 Ga0495624_0155079
1034 Ga0495624_0359281
1035 Ga0495670_0053358
1036 Ga0495670_0085573
1037 Ga0495671_0085197
1038 Ga0495671_0397749
1039 Ga0495589_0161169
1040 Ga0495589_0423486
1041 Ga0495660_0095278
1042 Ga0495660_0446198
1043 Ga0495581_0438746
1044 Ga0495581_0813154
1045 Ga0495636_0583368
1046 Ga0495672_0557872
1047 Ga0495683_0064953
1048 Ga0495683_0179822
1049 Ga0495677_0202144
1050 Ga0495673_0117517
1051 Ga0495686_0385063
1052 Ga0495686_0489887
1053 Ga0495615_0266763
1054 Ga0496100_0039720
1055 Ga0496100_0042622
1056 Ga0496100_0104682
1057 Ga0496100_0111806
1058 Ga0496100_0711147
1059 Ga0496101_0035228
1060 Ga0496101_0144942
1061 Ga0496101_0176540
1062 Ga0496101_0209126
1063 Ga0496101_0881685
1064 Ga0496101_1480068
1065 Ga0496102_0007280
1066 Ga0496102_0059093
1067 Ga0496102_0230541
1068 Ga0496102_0370421
1069 Ga0496102_0706523
1070 Ga0496103_0025530
1071 Ga0496103_0110091
1072 Ga0496103_0145176
1073 Ga0496103_0376006
1074 Ga0496104_0105847
1075 Ga0496105_0037782
1076 Ga0496105_0095148
1077 Ga0496106_0016633
1078 Ga0496106_0023672
1079 Ga0496106_1536405
1080 Ga0496107_0011045
1081 Ga0496108_0036764
1082 Ga0496108_0055252
1083 Ga0496109_0015296
1084 Ga0496109_0017506
1085 Ga0496110_0849010
1086 Ga0496111_0289304
1087 Ga0496111_0610898
1088 Ga0496112_0452199
1089 Ga0496112_0600478
1090 Ga0496112_0666399
1091 Ga0496113_0044800
1092 Ga0496114_0222610
1093 Ga0496114_0273197
1094 Ga0496114_0651312
1095 Ga0496115_0009330
1096 Ga0496115_0016299
1097 Ga0496120_0212754
1098 Ga0496121_0060878
1099 Ga0496121_0433298
1100 Ga0496124_0670726
1101 Ga0496125_0074753
1102 Ga0496126_0013541
1103 Ga0496126_0141949
1104 Ga0496126_1061857
1105 Ga0495678_036478
1106 Ga0495682_0018175
1107 Ga0501249_176182
1108 Ga0501258_044383
1109 Ga0501221_038966
1110 nmdc:mga03683_325955_c1
1111 nmdc:mga03n38_410819_c1
1112 nmdc:mga00v17_181798_c1
1113 nmdc:mga0yw44_1129352_c1
1114 nmdc:mga0yw44_134371_c1
1115 nmdc:mga0yw44_503581_c1
1116 nmdc:mga0yw44_514636_c1
1117 nmdc:mga0k408_335288_c1
1118 nmdc:mga0k408_843256_c1
1119 nmdc:mga06z11_12868_c1
1120 nmdc:mga06z11_135888_c1
1121 nmdc:mga06z11_143897_c1
1122 nmdc:mga06z11_180487_c1
1123 nmdc:mga06z11_643312_c1
1124 nmdc:mga07m45_48938_c1
1125 nmdc:mga07m45_591602_c1
1126 nmdc:mga05p37_1107660_c1
1127 nmdc:mga05p37_284490_c1
1128 nmdc:mga08y16_1072201_c1
1129 nmdc:mga08y16_1196722_c1
1130 nmdc:mga08y16_97542_c1
1131 nmdc:mga0n895_137117_c1
1132 nmdc:mga0rr50_642470_c1
1133 nmdc:mga0a205_493051_c1
1134 nmdc:mga0sz30_120026_c1
1135 nmdc:mga0sz30_39977_c1
1136 Ga0495601_0176770
1137 Ga0495612_0019127
1138 Ga0495655_0125070
1139 Ga0495655_0215197
1140 Ga0500646_0029619
1141 Ga0500566_0228413
1142 Ga0500641_0007121
1143 Ga0500641_0227549
1144 Ga0500650_0095425
1145 Ga0500562_037409
1146 Ga0500594_0207125
1147 Ga0500594_0311717
1148 Ga0500595_014673
1149 Ga0500628_232394
1150 Ga0500642_0183799
1151 Ga0500655_013504
1152 Ga0500588_0045689
1153 Ga0500604_0063691
1154 Ga0500622_0261946
1155 Ga0500633_0109388
1156 Ga0500634_0024704
1157 Ga0500634_0242631
1158 Ga0500638_057435
1159 Ga0500637_0415050
1160 Ga0500609_024714
1161 Ga0587070_063518
1162 2524471613
1163 2528852837
1164 2793079862
1165 2818241304
1166 2824662815
1167 2876769259
1168 2876817350
1169 2879102782
1170 2879115635
1171 2885416759
1172 2889034785
1173 2922370761
1174 2932785465
1175 2932816616
1176 2932822097
1177 2932833178
1178 2935620575
1179 2935639662
1180 2935644125
1181 2935667500
1182 2935668961
1183 2935677442
1184 2935690616
1185 2935705240
1186 2935717688
1187 2935727162
1188 2935735932
1189 2935744797
1190 2935755625
1191 2935761862
1192 2935805678
1193 2935806986
1194 2935814183
1195 2935829145
1196 2935833376
1197 2935845321
1198 2935858383
1199 2935872319
1200 2935877334
1201 2935995047
1202 2935995428
1203 2936006140
1204 2936039738
1205 2940561094
1206 2941545708
1207 8006967412
1208 8016516880
1209 8017059692
1210 8019579165
1211 8019597218
1212 8019604475
1213 8019614062
1214 8056674517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fxr-assembly1.cif.gz_D3 structure of neck with portal vertex of capsid of agrobacterium phage milano 0.6571 31 127
8fxr-assembly1.cif.gz_U3 structure of neck with portal vertex of capsid of agrobacterium phage milano 0.64 31 127
4ak2-assembly1.cif.gz_A structure of bt4661, a suse-like surface located polysaccharide binding protein from the bacteroides thetaiotaomicron heparin utilisation locus 0.6188 69 126
6tda-assembly1.cif.gz_R structure of swi/snf chromatin remodeler rsc bound to a nucleosome 0.615 46 126
3o4o-assembly1.cif.gz_C crystal structure of an interleukin-1 receptor complex 0.6135 46 127
ID Description Score Start End Superfamily
af_Q54JA5_1223_1954_2.60.40.3440 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6664 35 126 2.60.40.3440
af_A0A0R0HBM9_608_740_2.60.40.2310 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6574 48 125 2.60.40.2310
af_Q10RX3_646_781_2.60.40.2310 Mainly Beta;Sandwich;Immunoglobulin-like; 0.629 48 127 2.60.40.2310
af_Q96JQ0_996_1100_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.6253 64 127 2.60.40.60
af_Q4CV71_237_505_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.6251 100 125 3.40.850.10
ID Description Score Start End GO Terms
AF-A0A4Y9LP98-F1-model_v4 Uncharacterized protein 0.9866 46 127
AF-A0A7Z2PNV7-F1-model_v4 Uncharacterized protein 0.9844 46 127
AF-A0A4Y9LP98-F1-model_v4 Uncharacterized protein 0.9634 46 127
AF-A0A1Y2JQK0-F1-model_v4 Uncharacterized protein 0.9439 36 127
AF-A0A1Y2JQK0-F1-model_v4 Uncharacterized protein 0.9341 36 127

Map