F468638

General Info

Members Datasets Scaffolds Average Seq Length
606 412 1212 103

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237102|2513701981
Length 119
Sequence RRARSAMIRLHVRRFDMALQLRPNCEFCDRDLPPSSTDARICSYECTFCADCVETKLFNVCPNCGGGFTPRPIRPAQEWRPGVCTAKQAPSDKRVHLKYSVEDVAAHCARIKDVPPERR

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
86 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
87 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
88 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
144 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
145 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
270 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
273 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
278 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
279 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
280 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
281 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
282 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
283 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
284 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
287 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
288 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
289 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
290 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
294 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
295 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
296 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
297 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
298 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
299 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
300 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
301 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
302 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
303 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
306 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
307 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
308 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
309 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
312 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
313 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
314 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
315 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
316 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
317 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
318 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
319 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
320 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
321 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
322 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
323 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
324 2643221610 Ensifer sp. Root74 Isolate Unclassified
325 2643221675 Ensifer sp. Root1298 Isolate Unclassified
326 2643221680 Ensifer sp. Root1312 Isolate Unclassified
327 2643221726 Ensifer sp. Root954 Isolate Unclassified
328 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
329 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
330 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
331 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
332 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
333 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
334 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
335 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
336 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
337 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
338 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
339 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
340 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
341 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
342 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
343 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
344 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
345 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
346 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
347 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
348 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
349 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
350 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
351 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
352 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
353 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
354 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
355 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
356 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
357 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
358 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
359 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
360 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
361 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
362 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
363 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
364 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
365 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
366 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
367 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
368 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
369 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
370 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
371 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
372 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
373 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
374 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
375 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
376 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
377 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
378 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
379 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
380 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
381 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
382 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
383 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
384 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
385 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
386 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
387 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
388 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
389 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
390 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
391 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
392 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
393 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
394 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
395 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
396 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
397 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
398 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
399 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
400 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
401 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
402 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
403 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
404 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
405 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
406 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
407 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
408 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
409 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
410 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
411 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
412 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.17
Metatranscriptomes 0
Isolates 16.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.14
Nodule 11.55
Rhizoplane 4.95
Rhizosphere 51.16
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10046582 3300001990 Bacteria 1323
2 JGI24735J21928_10075293 3300002067 Bacteria 966
3 JGI25165J46597_1016116 3300003214 Bacteria 1003
4 JGI25153J46596_10001684 3300003215 Bacteria 13110
5 JGI25153J46596_10004047 3300003215 Bacteria 7991
6 JGI25160J50197_1011137 3300003354 Bacteria 3207
7 JGI25160J50197_1013294 3300003354 Bacteria 2815
8 JGI25160J50197_1026844 3300003354 Bacteria 1579
9 Ga0055539_1004056 3300003752 Bacteria 1977
10 Ga0055529_1045079 3300003763 Bacteria 531
11 Ga0055524_1053098 3300003775 Bacteria 900
12 Ga0055524_1062460 3300003775 Bacteria 763
13 Ga0055531_10007272 3300003794 Bacteria 6078
14 Ga0055543_1001860 3300004625 Bacteria 7683
15 Ga0065165_1001256 3300005262 Bacteria 28720
16 Ga0065165_1001882 3300005262 Bacteria 20268
17 Ga0065165_1005779 3300005262 Bacteria 6766
18 Ga0070690_100515396 3300005330 Bacteria 897
19 Ga0070670_100097179 3300005331 Bacteria 2533
20 Ga0070670_100172059 3300005331 Bacteria 1879
21 Ga0070670_100973047 3300005331 Bacteria 771
22 Ga0070677_10020400 3300005333 Bacteria 2414
23 Ga0070666_10965000 3300005335 Bacteria 631
24 Ga0070682_100012860 3300005337 Bacteria 4803
25 Ga0068868_100383637 3300005338 Bacteria 1210
26 Ga0068868_100558671 3300005338 Bacteria 1009
27 Ga0070689_100981524 3300005340 Bacteria 751
28 Ga0070687_100743900 3300005343 Bacteria 689
29 Ga0070692_10273420 3300005345 Bacteria 1021
30 Ga0070668_101178008 3300005347 Bacteria 694
31 Ga0070669_100783482 3300005353 Bacteria 810
32 Ga0070675_100142908 3300005354 Bacteria 2047
33 Ga0070671_101333339 3300005355 Bacteria 633
34 Ga0070674_100184600 3300005356 Bacteria 1600
35 Ga0070659_101980614 3300005366 Bacteria 523
36 Ga0070659_102051576 3300005366 Bacteria 514
37 Ga0070709_11693109 3300005434 Bacteria 516
38 Ga0070701_10439346 3300005438 Bacteria 835
39 Ga0070700_101387054 3300005441 Bacteria 594
40 Ga0070663_100111925 3300005455 Bacteria 2052
41 Ga0070678_100603717 3300005456 Bacteria 980
42 Ga0070662_100352417 3300005457 Bacteria 1206
43 Ga0070662_100388053 3300005457 Bacteria 1150
44 Ga0068867_100856298 3300005459 Bacteria 815
45 Ga0068867_101617243 3300005459 Bacteria 606
46 Ga0070679_101397811 3300005530 Bacteria 646
47 Ga0070684_100542412 3300005535 Bacteria 1079
48 Ga0068853_100570092 3300005539 Bacteria 1073
49 Ga0068853_100968943 3300005539 Bacteria 818
50 Ga0070686_100016475 3300005544 Bacteria 4301
51 Ga0070686_100225859 3300005544 Bacteria 1355
52 Ga0070686_100542488 3300005544 Bacteria 908
53 Ga0070693_100999642 3300005547 Bacteria 633
54 Ga0070665_100295050 3300005548 Bacteria 1624
55 Ga0070665_101007585 3300005548 Bacteria 845
56 Ga0070704_100354745 3300005549 Bacteria 1239
57 Ga0068855_102057820 3300005563 Bacteria 576
58 Ga0070664_100152282 3300005564 Bacteria 2042
59 Ga0068857_100485000 3300005577 Bacteria 1159
60 Ga0068857_100816993 3300005577 Bacteria 891
61 Ga0068857_102560936 3300005577 Bacteria 501
62 Ga0068854_100266082 3300005578 Bacteria 1374
63 Ga0068854_101971131 3300005578 Bacteria 538
64 Ga0068856_100001018 3300005614 Bacteria 29855
65 Ga0068856_100174988 3300005614 Bacteria 2159
66 Ga0068856_102303358 3300005614 Bacteria 547
67 Ga0070702_100080617 3300005615 Bacteria 1948
68 Ga0068852_100109065 3300005616 Bacteria 2513
69 Ga0068852_100349385 3300005616 Bacteria 1443
70 Ga0068852_102350639 3300005616 Bacteria 554
71 Ga0068864_100204416 3300005618 Bacteria 1816
72 Ga0068861_100640570 3300005719 Bacteria 981
73 Ga0068858_101402843 3300005842 Bacteria 688
74 Ga0068858_102367250 3300005842 Bacteria 525
75 Ga0081455_10726983 3300005937 Bacteria 630
76 Ga0081540_1065525 3300005983 Bacteria 1708
77 Ga0081539_10177786 3300005985 Bacteria 1001
78 Ga0081539_10247039 3300005985 Bacteria 795
79 Ga0070717_10743134 3300006028 Bacteria 892
80 Ga0070717_11592134 3300006028 Bacteria 592
81 Ga0070717_11751131 3300006028 Bacteria 562
82 Ga0070717_11821359 3300006028 Bacteria 550
83 Ga0075365_10067475 3300006038 Bacteria 2402
84 Ga0075368_10044366 3300006042 Bacteria 1754
85 Ga0075363_100330349 3300006048 Bacteria 888
86 Ga0075364_10160606 3300006051 Bacteria 1517
87 Ga0075362_10531100 3300006177 Bacteria 604
88 Ga0075367_10908201 3300006178 Bacteria 562
89 Ga0075369_10051554 3300006186 Bacteria 1782
90 Ga0075369_10117974 3300006186 Bacteria 1200
91 Ga0075369_10363863 3300006186 Bacteria 679
92 Ga0075366_10351528 3300006195 Bacteria 904
93 Ga0075370_10373609 3300006353 Bacteria 854
94 Ga0075370_10819940 3300006353 Bacteria 568
95 Ga0068865_100304375 3300006881 Bacteria 1277
96 Ga0099824_1006343 3300006942 Bacteria 16282
97 Ga0105240_10007216 3300009093 Bacteria 16185
98 Ga0105245_10052034 3300009098 Bacteria 3672
99 Ga0105245_10766137 3300009098 Bacteria 1002
100 Ga0105245_12723272 3300009098 Bacteria 547
101 Ga0114129_10336597 3300009147 Bacteria 2003
102 Ga0105243_10118786 3300009148 Bacteria 2225
103 Ga0105241_10032122 3300009174 Bacteria 3933
104 Ga0105241_10075669 3300009174 Bacteria 2623
105 Ga0105248_10630498 3300009177 Bacteria 1209
106 Ga0105248_10810488 3300009177 Bacteria 1057
107 Ga0105237_10397184 3300009545 Bacteria 1383
108 Ga0105238_11068384 3300009551 Bacteria 829
109 Ga0105249_10116986 3300009553 Bacteria 2528
110 Ga0105239_10313582 3300010375 Bacteria 1768
111 Ga0105239_10405087 3300010375 Bacteria 1544
112 Ga0105239_10456070 3300010375 Bacteria 1451
113 Ga0105239_10877154 3300010375 Bacteria 1029
114 Ga0105239_11108255 3300010375 Bacteria 911
115 Ga0105239_11812455 3300010375 Bacteria 707
116 Ga0105239_12221831 3300010375 Bacteria 638
117 Ga0105246_11391967 3300011119 Bacteria 654
118 Ga0105246_11760366 3300011119 Bacteria 591
119 Ga0157369_10807334 3300013105 Bacteria 964
120 Ga0157374_10224327 3300013296 Bacteria 1845
121 Ga0163162_10378498 3300013306 Bacteria 1549
122 Ga0163163_10643053 3300014325 Bacteria 1124
123 Ga0157380_11897928 3300014326 Bacteria 656
124 Ga0157377_11018671 3300014745 Bacteria 628
125 Ga0157376_10385252 3300014969 Bacteria 1352
126 Ga0182006_1258542 3300015261 Bacteria 571
127 Ga0214544_1000344 3300021320 Bacteria 81005
128 Ga0214544_1021169 3300021320 Bacteria 4337
129 Ga0214542_1000018 3300021321 Bacteria 202226
130 Ga0214545_1000009 3300021324 Bacteria 202915
131 Ga0214545_1017688 3300021324 Bacteria 6794
132 Ga0214543_1000037 3300021327 Bacteria 182113
133 Ga0214543_1024841 3300021327 Bacteria 3603
134 Ga0214543_1042017 3300021327 Bacteria 1157
135 Ga0214543_1056659 3300021327 Bacteria 680
136 Ga0213876_10359139 3300021384 Bacteria 775
137 Ga0209563_101178 3300025230 Bacteria 7343
138 Ga0207425_1044820 3300025245 Bacteria 829
139 Ga0209677_100686 3300025253 Bacteria 17323
140 Ga0209148_1000192 3300025254 Bacteria 115724
141 Ga0209148_1032767 3300025254 Bacteria 763
142 Ga0209233_1007921 3300025261 Bacteria 3328
143 Ga0209233_1013080 3300025261 Bacteria 2381
144 Ga0209233_1030031 3300025261 Bacteria 1284
145 Ga0209233_1060331 3300025261 Bacteria 734
146 Ga0209455_1000892 3300025272 Bacteria 15629
147 Ga0209673_1073000 3300025273 Bacteria 810
148 Ga0209564_1002767 3300025295 Bacteria 13171
149 Ga0209564_1021206 3300025295 Bacteria 2346
150 Ga0209564_1030887 3300025295 Bacteria 1650
151 Ga0209758_1000030 3300025297 Bacteria 509217
152 Ga0209758_1000963 3300025297 Bacteria 38837
153 Ga0209758_1001374 3300025297 Bacteria 29041
154 Ga0209758_1002540 3300025297 Bacteria 18393
155 Ga0209758_1080397 3300025297 Bacteria 988
156 Ga0209256_1007102 3300025299 Bacteria 5650
157 Ga0209256_1034462 3300025299 Bacteria 1347
158 Ga0207426_1001611 3300025302 Bacteria 17898
159 Ga0207426_1002230 3300025302 Bacteria 12929
160 Ga0207426_1012454 3300025302 Bacteria 3192
161 Ga0207426_1014771 3300025302 Bacteria 2854
162 Ga0207426_1015565 3300025302 Bacteria 2755
163 Ga0207426_1130522 3300025302 Bacteria 609
164 Ga0209051_1109280 3300025303 Bacteria 725
165 Ga0209257_1000778 3300025304 Bacteria 47189
166 Ga0209257_1042949 3300025304 Bacteria 1329
167 Ga0207692_10086193 3300025898 Bacteria 1692
168 Ga0207710_10169227 3300025900 Bacteria 1068
169 Ga0207688_10072803 3300025901 Bacteria 1952
170 Ga0207647_10126370 3300025904 Bacteria 1505
171 Ga0207647_10318436 3300025904 Bacteria 884
172 Ga0207645_10226548 3300025907 Bacteria 1233
173 Ga0207645_10943224 3300025907 Bacteria 586
174 Ga0207654_10014405 3300025911 Bacteria 4086
175 Ga0207654_10075407 3300025911 Bacteria 2015
176 Ga0207695_10000059 3300025913 Bacteria 363920
177 Ga0207695_11401622 3300025913 Bacteria 579
178 Ga0207671_10018495 3300025914 Bacteria 5343
179 Ga0207671_10364606 3300025914 Bacteria 1147
180 Ga0207662_10557910 3300025918 Bacteria 794
181 Ga0207652_11399767 3300025921 Bacteria 603
182 Ga0207681_10227301 3300025923 Bacteria 1447
183 Ga0207694_10756444 3300025924 Bacteria 820
184 Ga0207659_10306868 3300025926 Bacteria 1305
185 Ga0207687_10097677 3300025927 Bacteria 2155
186 Ga0207687_10838581 3300025927 Bacteria 785
187 Ga0207687_10947957 3300025927 Bacteria 737
188 Ga0207687_11121898 3300025927 Bacteria 676
189 Ga0207644_10045102 3300025931 Bacteria 3135
190 Ga0207644_11169987 3300025931 Bacteria 646
191 Ga0207690_10493862 3300025932 Bacteria 989
192 Ga0207690_11126909 3300025932 Bacteria 654
193 Ga0207690_11249402 3300025932 Bacteria 620
194 Ga0207706_10417949 3300025933 Bacteria 1162
195 Ga0207706_10504747 3300025933 Bacteria 1044
196 Ga0207706_10508072 3300025933 Bacteria 1040
197 Ga0207686_10085102 3300025934 Bacteria 2073
198 Ga0207686_10097716 3300025934 Bacteria 1953
199 Ga0207709_10159649 3300025935 Bacteria 1571
200 Ga0207670_11404010 3300025936 Bacteria 593
201 Ga0207669_10444234 3300025937 Bacteria 1026
202 Ga0207704_10143788 3300025938 Bacteria 1672
203 Ga0207691_10079231 3300025940 Bacteria 2957
204 Ga0207689_10552804 3300025942 Bacteria 967
205 Ga0207689_11559021 3300025942 Bacteria 550
206 Ga0207661_11786824 3300025944 Bacteria 560
207 Ga0207679_10061929 3300025945 Bacteria 2787
208 Ga0207712_10105715 3300025961 Bacteria 2101
209 Ga0207640_10701424 3300025981 Bacteria 868
210 Ga0207640_10708662 3300025981 Bacteria 864
211 Ga0207677_10285974 3300026023 Bacteria 1356
212 Ga0207677_10367271 3300026023 Bacteria 1211
213 Ga0207703_12048695 3300026035 Bacteria 548
214 Ga0207639_10400265 3300026041 Bacteria 1237
215 Ga0207678_10149080 3300026067 Bacteria 1997
216 Ga0207708_10316813 3300026075 Bacteria 1272
217 Ga0207702_10000589 3300026078 Bacteria 40161
218 Ga0207702_10142238 3300026078 Bacteria 2172
219 Ga0207702_10296019 3300026078 Bacteria 1534
220 Ga0207641_12119501 3300026088 Bacteria 563
221 Ga0207648_10066198 3300026089 Bacteria 3151
222 Ga0207648_10545785 3300026089 Bacteria 1064
223 Ga0207674_10277252 3300026116 Bacteria 1624
224 Ga0207674_10860002 3300026116 Bacteria 874
225 Ga0207675_100241667 3300026118 Bacteria 1745
226 Ga0207683_10395555 3300026121 Bacteria 1271
227 Ga0207698_10903866 3300026142 Bacteria 890
228 Ga0207698_11747073 3300026142 Bacteria 637
229 Ga0209389_1000064 3300027296 Bacteria 102177
230 Ga0209389_1000104 3300027296 Bacteria 75132
231 Ga0209589_1000159 3300027357 Bacteria 75132
232 Ga0209489_100194 3300027361 Bacteria 97679
233 Ga0209489_104884 3300027361 Bacteria 24104
234 Ga0209700_100014 3300027363 Bacteria 299349
235 Ga0268266_10104132 3300028379 Bacteria 2505
236 Ga0268265_11030732 3300028380 Bacteria 814
237 Ga0265332_10300129 3300031238 Bacteria 663
238 Ga0265332_10384652 3300031238 Bacteria 579
239 Ga0307508_10850185 3300031616 Bacteria 534
240 Ga0265314_10146690 3300031711 Bacteria 1452
241 Ga0307516_10890847 3300031730 Bacteria 556
242 Ga0307518_10505612 3300031838 Bacteria 620
243 Ga0307410_10755271 3300031852 Bacteria 824
244 Ga0307510_10002191 3300033180 Bacteria 22082
245 Ga0307510_10095530 3300033180 Bacteria 2792
246 Ga0307510_10266948 3300033180 Bacteria 1189
247 Ga0373923_0125929 3300035111 Bacteria 1148
248 Ga0373953_0030790 3300035117 Bacteria 2083
249 Ga0373924_0213515 3300035410 Bacteria 852
250 Ga0373935_1061928 3300035692 Bacteria 602
251 Ga0373935_1183878 3300035692 Bacteria 570
252 Ga0373933_1037663 3300035724 Bacteria 540
253 Ga0373947_0387996 3300035725 Bacteria 941
254 Ga0373937_0032722 3300036401 Bacteria 4717
255 Ga0373937_0842008 3300036401 Bacteria 865
256 Ga0395899_0047886 3300037312 Bacteria 3182
257 Ga0395900_0000787 3300037418 Bacteria 41944
258 Ga0395900_0170949 3300037418 Bacteria 2213
259 Ga0395898_0081842 3300037466 Bacteria 3113
260 Ga0395898_0082704 3300037466 Bacteria 3095
261 Ga0395898_1077266 3300037466 Bacteria 738
262 Ga0395905_0003015 3300037471 Bacteria 18245
263 Ga0395905_0133408 3300037471 Bacteria 2336
264 Ga0395905_0306405 3300037471 Bacteria 1476
265 Ga0395905_0825594 3300037471 Bacteria 830
266 Ga0395905_1232215 3300037471 Bacteria 652
267 Ga0436364_1106352 3300037853 Bacteria 718
268 Ga0436364_1346714 3300037853 Bacteria 574
269 Ga0436364_1442550 3300037853 Bacteria 688
270 Ga0395901_0097163 3300038443 Bacteria 3087
271 Ga0395901_0187237 3300038443 Bacteria 2171
272 Ga0395901_0566131 3300038443 Bacteria 1150
273 Ga0436365_0620569 3300039437 Bacteria 1972
274 Ga0436365_0655992 3300039437 Bacteria 592
275 Ga0436363_0152928 3300039450 Bacteria 554
276 Ga0436363_1520254 3300039450 Bacteria 893
277 Ga0451804_0354715 3300041463 Bacteria 723
278 Ga0439458_0160157 3300042157 Bacteria 606
279 Ga0466969_0042762 3300044656 Bacteria 2260
280 Ga0466972_0000286 3300044658 Bacteria 31359
281 Ga0466972_0022198 3300044658 Bacteria 3160
282 Ga0466965_0102525 3300044683 Bacteria 1464
283 Ga0466966_0005407 3300044684 Bacteria 8394
284 Ga0466961_0000446 3300044693 Bacteria 26385
285 Ga0466963_0005316 3300044694 Bacteria 7528
286 Ga0466964_0042269 3300044706 Bacteria 1846
287 Ga0466964_0044715 3300044706 Bacteria 1800
288 Ga0466964_0729861 3300044706 Bacteria 554
289 Ga0466971_0682778 3300044719 Bacteria 516
290 Ga0466968_0033827 3300044735 Bacteria 2131
291 Ga0466968_0186986 3300044735 Bacteria 965
292 Ga0466968_0694962 3300044735 Bacteria 519
293 Ga0466970_0286808 3300044765 Bacteria 926
294 Ga0466970_0706843 3300044765 Bacteria 588
295 Ga0466957_0145061 3300044842 Bacteria 1532
296 Ga0466960_0206762 3300044901 Bacteria 1075
297 Ga0466960_0426284 3300044901 Bacteria 767
298 Ga0466959_0058183 3300045049 Bacteria 2815
299 Ga0466959_0269188 3300045049 Bacteria 1171
300 Ga0466959_0425700 3300045049 Bacteria 901
301 Ga0466967_0056366 3300045976 Bacteria 3464
302 Ga0466967_0430700 3300045976 Bacteria 1287
303 Ga0495592_0002892 3300046454 Bacteria 12210
304 Ga0495592_0227598 3300046454 Bacteria 1243
305 Ga0495592_0587375 3300046454 Bacteria 681
306 Ga0495651_0025119 3300046462 Bacteria 4636
307 Ga0495651_0216545 3300046462 Bacteria 1329
308 Ga0495653_0028596 3300046463 Bacteria 4457
309 Ga0495653_0376252 3300046463 Bacteria 908
310 Ga0495605_0340954 3300046474 Bacteria 630
311 Ga0495664_0002198 3300046477 Bacteria 10448
312 Ga0495664_0025870 3300046477 Bacteria 3417
313 Ga0495664_0520539 3300046477 Bacteria 710
314 Ga0495607_0100139 3300046501 Bacteria 1554
315 Ga0495607_0191928 3300046501 Bacteria 1017
316 Ga0495606_0024071 3300046507 Bacteria 4399
317 Ga0495608_0014344 3300046511 Bacteria 5499
318 Ga0495608_0112275 3300046511 Bacteria 1752
319 Ga0495608_0116756 3300046511 Bacteria 1712
320 Ga0495610_0151094 3300046512 Bacteria 991
321 Ga0495610_0230292 3300046512 Bacteria 744
322 Ga0495618_0028555 3300046514 Bacteria 3478
323 Ga0495628_0003575 3300046516 Bacteria 13912
324 Ga0495628_0032961 3300046516 Bacteria 4178
325 Ga0495628_0325459 3300046516 Bacteria 1134
326 Ga0495631_0491395 3300046518 Bacteria 523
327 Ga0495648_0028247 3300046524 Bacteria 3740
328 Ga0495648_0222005 3300046524 Bacteria 931
329 Ga0495652_0031103 3300046529 Bacteria 4677
330 Ga0495652_0105038 3300046529 Bacteria 2283
331 Ga0495652_0215880 3300046529 Bacteria 1444
332 Ga0495652_0237645 3300046529 Bacteria 1358
333 Ga0495640_0006226 3300046533 Bacteria 9444
334 Ga0495640_0069156 3300046533 Bacteria 2375
335 Ga0495640_0082012 3300046533 Bacteria 2143
336 Ga0495587_0019034 3300046536 Bacteria 4254
337 Ga0495587_0135666 3300046536 Bacteria 1406
338 Ga0495645_0007441 3300046543 Bacteria 7621
339 Ga0495645_0027196 3300046543 Bacteria 4154
340 Ga0495622_0012669 3300046557 Bacteria 3908
341 Ga0495667_0005381 3300046559 Bacteria 8656
342 Ga0495667_0006624 3300046559 Bacteria 7864
343 Ga0495667_0566877 3300046559 Bacteria 709
344 Ga0495668_0347781 3300046616 Bacteria 814
345 Ga0495634_0097944 3300046642 Bacteria 1898
346 Ga0495634_0188526 3300046642 Bacteria 1288
347 Ga0495625_0172013 3300046660 Bacteria 1446
348 Ga0495635_0067835 3300046663 Bacteria 2446
349 Ga0495635_0294550 3300046663 Bacteria 1088
350 Ga0495661_0045097 3300046665 Bacteria 2698
351 Ga0495657_0026304 3300046675 Bacteria 4121
352 Ga0495657_0094162 3300046675 Bacteria 1916
353 Ga0495657_0146424 3300046675 Bacteria 1469
354 Ga0495599_0009058 3300046678 Bacteria 6065
355 Ga0495599_0030366 3300046678 Bacteria 3391
356 Ga0495623_0020930 3300046679 Bacteria 4226
357 Ga0495623_0038968 3300046679 Bacteria 3038
358 Ga0495646_0001534 3300046680 Bacteria 13777
359 Ga0495646_0058823 3300046680 Bacteria 2297
360 Ga0495646_0202733 3300046680 Bacteria 1080
361 Ga0495613_0362982 3300046689 Bacteria 993
362 Ga0495613_0559579 3300046689 Bacteria 764
363 Ga0495624_0054174 3300046690 Bacteria 2529
364 Ga0495671_0151018 3300046692 Bacteria 1131
365 Ga0495649_0047615 3300046694 Bacteria 2331
366 Ga0495600_0004048 3300046809 Bacteria 8715
367 Ga0495600_0094615 3300046809 Bacteria 1948
368 Ga0495660_0198082 3300046810 Bacteria 961
369 Ga0495604_0018588 3300047317 Bacteria 5567
370 Ga0495604_0026606 3300047317 Bacteria 4604
371 Ga0495674_0011571 3300047319 Bacteria 8324
372 Ga0495674_0024836 3300047319 Bacteria 5501
373 Ga0495672_0262534 3300047320 Bacteria 833
374 Ga0495676_0029476 3300047321 Bacteria 4672
375 Ga0495680_0002856 3300047322 Bacteria 17361
376 Ga0495680_0167522 3300047322 Bacteria 1592
377 Ga0495683_0301998 3300047323 Bacteria 687
378 Ga0495687_145200 3300047443 Bacteria 819
379 Ga0495675_0069242 3300047444 Bacteria 2228
380 Ga0495675_0082626 3300047444 Bacteria 2022
381 Ga0495673_0223827 3300047469 Bacteria 695
382 Ga0495684_1014912 3300047471 Bacteria 526
383 Ga0495686_0214792 3300047472 Bacteria 1097
384 Ga0495602_0001212 3300048088 Bacteria 25377
385 Ga0495602_0010096 3300048088 Bacteria 9800
386 Ga0495602_0370704 3300048088 Bacteria 1028
387 Ga0496100_0131490 3300048903 Bacteria 1763
388 Ga0496101_0000889 3300048904 Bacteria 17599
389 Ga0496101_0284389 3300048904 Bacteria 1293
390 Ga0496101_0886036 3300048904 Bacteria 703
391 Ga0496102_0001545 3300048905 Bacteria 20325
392 Ga0496102_1418511 3300048905 Bacteria 613
393 Ga0496103_0017419 3300048906 Bacteria 4300
394 Ga0496104_0022194 3300048907 Bacteria 5830
395 Ga0496104_0253488 3300048907 Bacteria 1673
396 Ga0496104_0387031 3300048907 Bacteria 1311
397 Ga0496104_0930058 3300048907 Bacteria 774
398 Ga0496105_0024309 3300048908 Bacteria 4923
399 Ga0496105_0068691 3300048908 Bacteria 2927
400 Ga0496105_0287427 3300048908 Bacteria 1324
401 Ga0496106_0000655 3300048909 Bacteria 24775
402 Ga0496107_0004539 3300048910 Bacteria 9400
403 Ga0496108_0073546 3300048911 Bacteria 2885
404 Ga0496108_1137269 3300048911 Bacteria 662
405 Ga0496109_0493822 3300048912 Bacteria 1155
406 Ga0496109_1076567 3300048912 Bacteria 741
407 Ga0496110_0931528 3300048913 Bacteria 775
408 Ga0496110_1462823 3300048913 Bacteria 593
409 Ga0496111_0102724 3300048914 Bacteria 2102
410 Ga0496111_0833583 3300048914 Bacteria 666
411 Ga0496112_0376291 3300048915 Bacteria 1361
412 Ga0496112_0931455 3300048915 Bacteria 790
413 Ga0496112_1133556 3300048915 Bacteria 700
414 Ga0496114_0003726 3300048917 Bacteria 11741
415 Ga0496114_0174911 3300048917 Bacteria 1873
416 Ga0496118_0056829 3300048921 Bacteria 2938
417 Ga0496119_0078144 3300048922 Bacteria 1915
418 Ga0496119_0197223 3300048922 Bacteria 1044
419 Ga0496119_0222360 3300048922 Bacteria 965
420 Ga0496120_0040652 3300048923 Bacteria 2730
421 Ga0496121_0273882 3300048924 Bacteria 1158
422 Ga0496121_0275540 3300048924 Bacteria 1154
423 Ga0496121_0408766 3300048924 Bacteria 886
424 Ga0496123_0243379 3300048926 Bacteria 892
425 Ga0496124_0146201 3300048927 Bacteria 1860
426 Ga0496125_0175748 3300048928 Bacteria 1433
427 Ga0496125_0228732 3300048928 Bacteria 1191
428 Ga0496125_0525888 3300048928 Bacteria 660
429 Ga0496126_0007151 3300048929 Bacteria 12291
430 Ga0496126_0270966 3300048929 Bacteria 1409
431 Ga0496126_0528287 3300048929 Bacteria 939
432 Ga0496126_0529060 3300048929 Bacteria 938
433 Ga0496126_0558102 3300048929 Bacteria 908
434 Ga0496126_0949662 3300048929 Bacteria 648
435 Ga0495682_0014400 3300049460 Bacteria 2999
436 Ga0501067_0143081 3300049583 Bacteria 1332
437 Ga0501072_0147374 3300049588 Unclassified 1877
438 nmdc:mga03n38_83936_c1 3300050490 Bacteria 1503
439 nmdc:mga00v17_90163_c1 3300050491 Bacteria 1924
440 nmdc:mga0yw44_682970_c1 3300050492 Bacteria 698
441 nmdc:mga04h51_215317_c1 3300050495 Bacteria 759
442 nmdc:mga07m45_352637_c1 3300050496 Bacteria 855
443 nmdc:mga07m45_60413_c1 3300050496 Bacteria 2145
444 nmdc:mga07m45_872513_c1 3300050496 Bacteria 515
445 nmdc:mga05p37_462818_c1 3300050507 Bacteria 1465
446 nmdc:mga0qj67_555603_c1 3300050509 Bacteria 920
447 nmdc:mga08y16_771317_c1 3300050511 Bacteria 956
448 nmdc:mga0sz30_7339_c1 3300050516 Bacteria 4129
449 Ga0495601_0000719 3300053077 Bacteria 17776
450 Ga0495612_0000161 3300053078 Bacteria 28312
451 Ga0500635_0033029 3300053080 Bacteria 1686
452 Ga0495655_0056885 3300053083 Bacteria 1054
453 Ga0495619_0016270 3300053085 Bacteria 4708
454 Ga0500578_0072919 3300053086 Bacteria 2187
455 Ga0500578_0458522 3300053086 Bacteria 724
456 Ga0500643_000270 3300053087 Bacteria 45829
457 Ga0500583_0376514 3300053092 Bacteria 684
458 Ga0500651_0309920 3300053093 Bacteria 904
459 Ga0500566_0001227 3300053094 Bacteria 14989
460 Ga0500566_0073103 3300053094 Bacteria 1922
461 Ga0500640_077156 3300053095 Bacteria 1420
462 Ga0500650_0078805 3300053098 Bacteria 1540
463 Ga0500555_002818 3300053103 Bacteria 4985
464 Ga0500556_0270983 3300053104 Bacteria 666
465 Ga0500557_000026 3300053105 Bacteria 81867
466 Ga0500569_000797 3300053109 Bacteria 5533
467 Ga0500569_327682 3300053109 Bacteria 512
468 Ga0500572_042187 3300053111 Bacteria 1328
469 Ga0500593_124311 3300053117 Bacteria 1041
470 Ga0500595_027261 3300053119 Bacteria 1958
471 Ga0500595_037996 3300053119 Bacteria 1567
472 Ga0500607_258356 3300053121 Bacteria 685
473 Ga0500608_271688 3300053122 Bacteria 647
474 Ga0500614_284491 3300053123 Bacteria 518
475 Ga0500642_0000091 3300053130 Bacteria 45704
476 Ga0500642_0227528 3300053130 Bacteria 862
477 Ga0500652_071835 3300053131 Bacteria 1435
478 Ga0500658_0081876 3300053134 Bacteria 1382
479 Ga0500658_0182220 3300053134 Bacteria 956
480 Ga0500559_0037464 3300053136 Bacteria 2102
481 Ga0500561_0262573 3300053137 Bacteria 550
482 Ga0500564_214782 3300053138 Bacteria 781
483 Ga0500568_0044992 3300053139 Bacteria 1758
484 Ga0500568_0048056 3300053139 Bacteria 1688
485 Ga0500577_0076956 3300053142 Bacteria 1322
486 Ga0500590_143809 3300053148 Bacteria 1085
487 Ga0500590_147854 3300053148 Bacteria 1064
488 Ga0500620_026553 3300053155 Bacteria 1794
489 Ga0500638_065902 3300053162 Bacteria 1736
490 Ga0500638_077489 3300053162 Bacteria 1582
491 Ga0500639_077586 3300053163 Bacteria 1680
492 Ga0500639_184930 3300053163 Bacteria 916
493 Ga0500636_0009769 3300053177 Bacteria 5588
494 Ga0500636_0050452 3300053177 Bacteria 2448
495 Ga0500637_0141622 3300053178 Bacteria 1392
496 Ga0500625_003257 3300053729 Bacteria 6367
497 Ga0500645_029330 3300053730 Bacteria 1661
498 Ga0500645_121483 3300053730 Bacteria 729
499 Ga0500552_104336 3300053733 Bacteria 541
500 Ga0500596_002953 3300053735 Bacteria 3290
501 Ga0500599_016604 3300053736 Bacteria 1017
502 Ga0500601_000864 3300053737 Bacteria 3680
503 Ga0500661_001555 3300055283 Bacteria 4323
504 Ga0466962_0060955 3300061719 Bacteria 1801
505 2513701981 2513237102 Bacteria 7703324
506 2507505554 2507262055 Bacteria 8048963
507 2508695771 2508501042 Bacteria 8719808
508 2511397656 2511231028 Bacteria 8046582
509 2513642341 2513237094 Bacteria 8789602
510 2513652569 2513237095 Bacteria 8976980
511 2513721872 2513237104 Bacteria 10034502
512 2513879319 2513237139 Bacteria 8737671
513 2514016861 2513237161 Bacteria 8871253
514 2517107935 2517093001 Bacteria 9002274
515 2524441998 2524023205 Bacteria 8918781
516 2617353671 2617270735 Bacteria 9163226
517 2617377363 2617270741 Bacteria 8201522
518 2644063589 2643221610 Bacteria 7480339
519 2644414352 2643221675 Bacteria 7473456
520 2644447880 2643221680 Bacteria 7473610
521 2644690353 2643221726 Bacteria 7455827
522 2745082384 2744054633 Bacteria 8678936
523 2793065674 2791355196 Bacteria 7323613
524 2805921534 2802429603 Bacteria 8777136
525 2818239069 2816332527 Bacteria 8933356
526 2824603004 2824600985 Bacteria 8488197
527 2824615478 2824609381 Bacteria 8672835
528 2824623930 2824617872 Bacteria 8814715
529 2824632591 2824626560 Bacteria 8813858
530 2824639455 2824635225 Bacteria 8785348
531 2824649453 2824644064 Bacteria 8743947
532 2824660317 2824653114 Bacteria 8493680
533 2824675361 2824671348 Bacteria 8369588
534 2824684678 2824679649 Bacteria 8248951
535 2824691579 2824687955 Bacteria 8360029
536 2824700506 2824696289 Bacteria 8335049
537 2824707350 2824704595 Bacteria 9667483
538 2824719335 2824714736 Bacteria 8717648
539 2824727959 2824723954 Bacteria 8758240
540 2824736169 2824732956 Bacteria 7810675
541 2824750240 2824746037 Bacteria 7911610
542 2824758726 2824753945 Bacteria 9787441
543 2824769196 2824763712 Bacteria 9792355
544 2841947878 2841941048 Bacteria 8688029
545 2841965066 2841957949 Bacteria 8652217
546 2841977436 2841974524 Bacteria 8931498
547 2842041288 2842038055 Bacteria 8002051
548 2842049330 2842045827 Bacteria 8006841
549 2844315765 2844315083 Bacteria 8138177
550 2847931367 2847930680 Bacteria 9342022
551 2847942458 2847939898 Bacteria 8606328
552 2857516482 2857509624 Bacteria 7472071
553 2874619067 2874612657 Bacteria 8252029
554 2874623032 2874620515 Bacteria 8290088
555 2874636841 2874628541 Bacteria 8630250
556 2876763731 2876761206 Bacteria 10111113
557 2879087596 2879083081 Bacteria 8587928
558 2881365451 2881364244 Bacteria 7710352
559 2881671507 2881665667 Bacteria 8175609
560 2885368598 2885366525 Bacteria 8326213
561 2885413200 2885409591 Bacteria 9235467
562 2888379282 2888378607 Bacteria 9652610
563 2888390397 2888388044 Bacteria 7304136
564 2888419961 2888419890 Bacteria 7857137
565 2903730936 2903727486 Bacteria 8281579
566 2904666656 2904666416 Bacteria 8226587
567 2904714073 2904711408 Bacteria 9771557
568 2906603758 2906602504 Bacteria 8295279
569 2906650508 2906643746 Bacteria 8722424
570 2908775883 2908775508 Bacteria 8092255
571 2922394699 2922393267 Bacteria 8285685
572 2932799996 2932794094 Bacteria 7915132
573 2932809007 2932801729 Bacteria 7987968
574 2935614613 2935608549 Bacteria 8203142
575 2935774187 2935769743 Bacteria 7878163
576 2935782356 2935777560 Bacteria 8077691
577 2935789097 2935785616 Bacteria 7962367
578 2935796847 2935793552 Bacteria 8012592
579 2935826355 2935819856 Bacteria 8261050
580 2935853842 2935847175 Bacteria 8228321
581 2935888208 2935883170 Bacteria 7964738
582 2935985265 2935984226 Bacteria 8302647
583 2941537987 2941531003 Bacteria 7653939
584 3005489261 3005483717 Bacteria 7877331
585 3005511498 3005506211 Bacteria 6943378
586 3005592291 3005587118 Bacteria 7794411
587 3005595352 3005594810 Bacteria 8716512
588 3005711311 3005710791 Bacteria 7622528
589 3005718593 3005718088 Bacteria 8283608
590 8016525899 8016522445 Bacteria 8156687
591 8016539502 8016530956 Bacteria 8155261
592 8016543792 8016539877 Bacteria 8155419
593 8016549504 8016548790 Bacteria 8155074
594 8016557926 8016557553 Bacteria 8154380
595 8016569191 8016566248 Bacteria 8158151
596 8016581832 8016575299 Bacteria 8154085
597 8016586029 8016583857 Bacteria 10421953
598 8016595946 8016595262 Bacteria 8149947
599 8016606816 8016603502 Bacteria 8731218
600 8016618722 8016613128 Bacteria 8794220
601 8016622808 8016622563 Bacteria 7999408
602 8019530781 8019530166 Bacteria 8155624
603 8019540803 8019538911 Bacteria 7872763
604 8019549811 8019547302 Bacteria 7996444
605 8019652084 8019648815 Bacteria 10014479
606 8056975745 8056967851 Bacteria 9038162
607 JGI24737J22298_10046582
608 JGI24735J21928_10075293
609 JGI25165J46597_1016116
610 JGI25153J46596_10001684
611 JGI25153J46596_10004047
612 JGI25160J50197_1011137
613 JGI25160J50197_1013294
614 JGI25160J50197_1026844
615 Ga0055539_1004056
616 Ga0055529_1045079
617 Ga0055524_1053098
618 Ga0055524_1062460
619 Ga0055531_10007272
620 Ga0055543_1001860
621 Ga0065165_1001256
622 Ga0065165_1001882
623 Ga0065165_1005779
624 Ga0070690_100515396
625 Ga0070670_100097179
626 Ga0070670_100172059
627 Ga0070670_100973047
628 Ga0070677_10020400
629 Ga0070666_10965000
630 Ga0070682_100012860
631 Ga0068868_100383637
632 Ga0068868_100558671
633 Ga0070689_100981524
634 Ga0070687_100743900
635 Ga0070692_10273420
636 Ga0070668_101178008
637 Ga0070669_100783482
638 Ga0070675_100142908
639 Ga0070671_101333339
640 Ga0070674_100184600
641 Ga0070659_101980614
642 Ga0070659_102051576
643 Ga0070709_11693109
644 Ga0070701_10439346
645 Ga0070700_101387054
646 Ga0070663_100111925
647 Ga0070678_100603717
648 Ga0070662_100352417
649 Ga0070662_100388053
650 Ga0068867_100856298
651 Ga0068867_101617243
652 Ga0070679_101397811
653 Ga0070684_100542412
654 Ga0068853_100570092
655 Ga0068853_100968943
656 Ga0070686_100016475
657 Ga0070686_100225859
658 Ga0070686_100542488
659 Ga0070693_100999642
660 Ga0070665_100295050
661 Ga0070665_101007585
662 Ga0070704_100354745
663 Ga0068855_102057820
664 Ga0070664_100152282
665 Ga0068857_100485000
666 Ga0068857_100816993
667 Ga0068857_102560936
668 Ga0068854_100266082
669 Ga0068854_101971131
670 Ga0068856_100001018
671 Ga0068856_100174988
672 Ga0068856_102303358
673 Ga0070702_100080617
674 Ga0068852_100109065
675 Ga0068852_100349385
676 Ga0068852_102350639
677 Ga0068864_100204416
678 Ga0068861_100640570
679 Ga0068858_101402843
680 Ga0068858_102367250
681 Ga0081455_10726983
682 Ga0081540_1065525
683 Ga0081539_10177786
684 Ga0081539_10247039
685 Ga0070717_10743134
686 Ga0070717_11592134
687 Ga0070717_11751131
688 Ga0070717_11821359
689 Ga0075365_10067475
690 Ga0075368_10044366
691 Ga0075363_100330349
692 Ga0075364_10160606
693 Ga0075362_10531100
694 Ga0075367_10908201
695 Ga0075369_10051554
696 Ga0075369_10117974
697 Ga0075369_10363863
698 Ga0075366_10351528
699 Ga0075370_10373609
700 Ga0075370_10819940
701 Ga0068865_100304375
702 Ga0099824_1006343
703 Ga0105240_10007216
704 Ga0105245_10052034
705 Ga0105245_10766137
706 Ga0105245_12723272
707 Ga0114129_10336597
708 Ga0105243_10118786
709 Ga0105241_10032122
710 Ga0105241_10075669
711 Ga0105248_10630498
712 Ga0105248_10810488
713 Ga0105237_10397184
714 Ga0105238_11068384
715 Ga0105249_10116986
716 Ga0105239_10313582
717 Ga0105239_10405087
718 Ga0105239_10456070
719 Ga0105239_10877154
720 Ga0105239_11108255
721 Ga0105239_11812455
722 Ga0105239_12221831
723 Ga0105246_11391967
724 Ga0105246_11760366
725 Ga0157369_10807334
726 Ga0157374_10224327
727 Ga0163162_10378498
728 Ga0163163_10643053
729 Ga0157380_11897928
730 Ga0157377_11018671
731 Ga0157376_10385252
732 Ga0182006_1258542
733 Ga0214544_1000344
734 Ga0214544_1021169
735 Ga0214542_1000018
736 Ga0214545_1000009
737 Ga0214545_1017688
738 Ga0214543_1000037
739 Ga0214543_1024841
740 Ga0214543_1042017
741 Ga0214543_1056659
742 Ga0213876_10359139
743 Ga0209563_101178
744 Ga0207425_1044820
745 Ga0209677_100686
746 Ga0209148_1000192
747 Ga0209148_1032767
748 Ga0209233_1007921
749 Ga0209233_1013080
750 Ga0209233_1030031
751 Ga0209233_1060331
752 Ga0209455_1000892
753 Ga0209673_1073000
754 Ga0209564_1002767
755 Ga0209564_1021206
756 Ga0209564_1030887
757 Ga0209758_1000030
758 Ga0209758_1000963
759 Ga0209758_1001374
760 Ga0209758_1002540
761 Ga0209758_1080397
762 Ga0209256_1007102
763 Ga0209256_1034462
764 Ga0207426_1001611
765 Ga0207426_1002230
766 Ga0207426_1012454
767 Ga0207426_1014771
768 Ga0207426_1015565
769 Ga0207426_1130522
770 Ga0209051_1109280
771 Ga0209257_1000778
772 Ga0209257_1042949
773 Ga0207692_10086193
774 Ga0207710_10169227
775 Ga0207688_10072803
776 Ga0207647_10126370
777 Ga0207647_10318436
778 Ga0207645_10226548
779 Ga0207645_10943224
780 Ga0207654_10014405
781 Ga0207654_10075407
782 Ga0207695_10000059
783 Ga0207695_11401622
784 Ga0207671_10018495
785 Ga0207671_10364606
786 Ga0207662_10557910
787 Ga0207652_11399767
788 Ga0207681_10227301
789 Ga0207694_10756444
790 Ga0207659_10306868
791 Ga0207687_10097677
792 Ga0207687_10838581
793 Ga0207687_10947957
794 Ga0207687_11121898
795 Ga0207644_10045102
796 Ga0207644_11169987
797 Ga0207690_10493862
798 Ga0207690_11126909
799 Ga0207690_11249402
800 Ga0207706_10417949
801 Ga0207706_10504747
802 Ga0207706_10508072
803 Ga0207686_10085102
804 Ga0207686_10097716
805 Ga0207709_10159649
806 Ga0207670_11404010
807 Ga0207669_10444234
808 Ga0207704_10143788
809 Ga0207691_10079231
810 Ga0207689_10552804
811 Ga0207689_11559021
812 Ga0207661_11786824
813 Ga0207679_10061929
814 Ga0207712_10105715
815 Ga0207640_10701424
816 Ga0207640_10708662
817 Ga0207677_10285974
818 Ga0207677_10367271
819 Ga0207703_12048695
820 Ga0207639_10400265
821 Ga0207678_10149080
822 Ga0207708_10316813
823 Ga0207702_10000589
824 Ga0207702_10142238
825 Ga0207702_10296019
826 Ga0207641_12119501
827 Ga0207648_10066198
828 Ga0207648_10545785
829 Ga0207674_10277252
830 Ga0207674_10860002
831 Ga0207675_100241667
832 Ga0207683_10395555
833 Ga0207698_10903866
834 Ga0207698_11747073
835 Ga0209389_1000064
836 Ga0209389_1000104
837 Ga0209589_1000159
838 Ga0209489_100194
839 Ga0209489_104884
840 Ga0209700_100014
841 Ga0268266_10104132
842 Ga0268265_11030732
843 Ga0265332_10300129
844 Ga0265332_10384652
845 Ga0307508_10850185
846 Ga0265314_10146690
847 Ga0307516_10890847
848 Ga0307518_10505612
849 Ga0307410_10755271
850 Ga0307510_10002191
851 Ga0307510_10095530
852 Ga0307510_10266948
853 Ga0373923_0125929
854 Ga0373953_0030790
855 Ga0373924_0213515
856 Ga0373935_1061928
857 Ga0373935_1183878
858 Ga0373933_1037663
859 Ga0373947_0387996
860 Ga0373937_0032722
861 Ga0373937_0842008
862 Ga0395899_0047886
863 Ga0395900_0000787
864 Ga0395900_0170949
865 Ga0395898_0081842
866 Ga0395898_0082704
867 Ga0395898_1077266
868 Ga0395905_0003015
869 Ga0395905_0133408
870 Ga0395905_0306405
871 Ga0395905_0825594
872 Ga0395905_1232215
873 Ga0436364_1106352
874 Ga0436364_1346714
875 Ga0436364_1442550
876 Ga0395901_0097163
877 Ga0395901_0187237
878 Ga0395901_0566131
879 Ga0436365_0620569
880 Ga0436365_0655992
881 Ga0436363_0152928
882 Ga0436363_1520254
883 Ga0451804_0354715
884 Ga0439458_0160157
885 Ga0466969_0042762
886 Ga0466972_0000286
887 Ga0466972_0022198
888 Ga0466965_0102525
889 Ga0466966_0005407
890 Ga0466961_0000446
891 Ga0466963_0005316
892 Ga0466964_0042269
893 Ga0466964_0044715
894 Ga0466964_0729861
895 Ga0466971_0682778
896 Ga0466968_0033827
897 Ga0466968_0186986
898 Ga0466968_0694962
899 Ga0466970_0286808
900 Ga0466970_0706843
901 Ga0466957_0145061
902 Ga0466960_0206762
903 Ga0466960_0426284
904 Ga0466959_0058183
905 Ga0466959_0269188
906 Ga0466959_0425700
907 Ga0466967_0056366
908 Ga0466967_0430700
909 Ga0495592_0002892
910 Ga0495592_0227598
911 Ga0495592_0587375
912 Ga0495651_0025119
913 Ga0495651_0216545
914 Ga0495653_0028596
915 Ga0495653_0376252
916 Ga0495605_0340954
917 Ga0495664_0002198
918 Ga0495664_0025870
919 Ga0495664_0520539
920 Ga0495607_0100139
921 Ga0495607_0191928
922 Ga0495606_0024071
923 Ga0495608_0014344
924 Ga0495608_0112275
925 Ga0495608_0116756
926 Ga0495610_0151094
927 Ga0495610_0230292
928 Ga0495618_0028555
929 Ga0495628_0003575
930 Ga0495628_0032961
931 Ga0495628_0325459
932 Ga0495631_0491395
933 Ga0495648_0028247
934 Ga0495648_0222005
935 Ga0495652_0031103
936 Ga0495652_0105038
937 Ga0495652_0215880
938 Ga0495652_0237645
939 Ga0495640_0006226
940 Ga0495640_0069156
941 Ga0495640_0082012
942 Ga0495587_0019034
943 Ga0495587_0135666
944 Ga0495645_0007441
945 Ga0495645_0027196
946 Ga0495622_0012669
947 Ga0495667_0005381
948 Ga0495667_0006624
949 Ga0495667_0566877
950 Ga0495668_0347781
951 Ga0495634_0097944
952 Ga0495634_0188526
953 Ga0495625_0172013
954 Ga0495635_0067835
955 Ga0495635_0294550
956 Ga0495661_0045097
957 Ga0495657_0026304
958 Ga0495657_0094162
959 Ga0495657_0146424
960 Ga0495599_0009058
961 Ga0495599_0030366
962 Ga0495623_0020930
963 Ga0495623_0038968
964 Ga0495646_0001534
965 Ga0495646_0058823
966 Ga0495646_0202733
967 Ga0495613_0362982
968 Ga0495613_0559579
969 Ga0495624_0054174
970 Ga0495671_0151018
971 Ga0495649_0047615
972 Ga0495600_0004048
973 Ga0495600_0094615
974 Ga0495660_0198082
975 Ga0495604_0018588
976 Ga0495604_0026606
977 Ga0495674_0011571
978 Ga0495674_0024836
979 Ga0495672_0262534
980 Ga0495676_0029476
981 Ga0495680_0002856
982 Ga0495680_0167522
983 Ga0495683_0301998
984 Ga0495687_145200
985 Ga0495675_0069242
986 Ga0495675_0082626
987 Ga0495673_0223827
988 Ga0495684_1014912
989 Ga0495686_0214792
990 Ga0495602_0001212
991 Ga0495602_0010096
992 Ga0495602_0370704
993 Ga0496100_0131490
994 Ga0496101_0000889
995 Ga0496101_0284389
996 Ga0496101_0886036
997 Ga0496102_0001545
998 Ga0496102_1418511
999 Ga0496103_0017419
1000 Ga0496104_0022194
1001 Ga0496104_0253488
1002 Ga0496104_0387031
1003 Ga0496104_0930058
1004 Ga0496105_0024309
1005 Ga0496105_0068691
1006 Ga0496105_0287427
1007 Ga0496106_0000655
1008 Ga0496107_0004539
1009 Ga0496108_0073546
1010 Ga0496108_1137269
1011 Ga0496109_0493822
1012 Ga0496109_1076567
1013 Ga0496110_0931528
1014 Ga0496110_1462823
1015 Ga0496111_0102724
1016 Ga0496111_0833583
1017 Ga0496112_0376291
1018 Ga0496112_0931455
1019 Ga0496112_1133556
1020 Ga0496114_0003726
1021 Ga0496114_0174911
1022 Ga0496118_0056829
1023 Ga0496119_0078144
1024 Ga0496119_0197223
1025 Ga0496119_0222360
1026 Ga0496120_0040652
1027 Ga0496121_0273882
1028 Ga0496121_0275540
1029 Ga0496121_0408766
1030 Ga0496123_0243379
1031 Ga0496124_0146201
1032 Ga0496125_0175748
1033 Ga0496125_0228732
1034 Ga0496125_0525888
1035 Ga0496126_0007151
1036 Ga0496126_0270966
1037 Ga0496126_0528287
1038 Ga0496126_0529060
1039 Ga0496126_0558102
1040 Ga0496126_0949662
1041 Ga0495682_0014400
1042 Ga0501067_0143081
1043 Ga0501072_0147374
1044 nmdc:mga03n38_83936_c1
1045 nmdc:mga00v17_90163_c1
1046 nmdc:mga0yw44_682970_c1
1047 nmdc:mga04h51_215317_c1
1048 nmdc:mga07m45_352637_c1
1049 nmdc:mga07m45_60413_c1
1050 nmdc:mga07m45_872513_c1
1051 nmdc:mga05p37_462818_c1
1052 nmdc:mga0qj67_555603_c1
1053 nmdc:mga08y16_771317_c1
1054 nmdc:mga0sz30_7339_c1
1055 Ga0495601_0000719
1056 Ga0495612_0000161
1057 Ga0500635_0033029
1058 Ga0495655_0056885
1059 Ga0495619_0016270
1060 Ga0500578_0072919
1061 Ga0500578_0458522
1062 Ga0500643_000270
1063 Ga0500583_0376514
1064 Ga0500651_0309920
1065 Ga0500566_0001227
1066 Ga0500566_0073103
1067 Ga0500640_077156
1068 Ga0500650_0078805
1069 Ga0500555_002818
1070 Ga0500556_0270983
1071 Ga0500557_000026
1072 Ga0500569_000797
1073 Ga0500569_327682
1074 Ga0500572_042187
1075 Ga0500593_124311
1076 Ga0500595_027261
1077 Ga0500595_037996
1078 Ga0500607_258356
1079 Ga0500608_271688
1080 Ga0500614_284491
1081 Ga0500642_0000091
1082 Ga0500642_0227528
1083 Ga0500652_071835
1084 Ga0500658_0081876
1085 Ga0500658_0182220
1086 Ga0500559_0037464
1087 Ga0500561_0262573
1088 Ga0500564_214782
1089 Ga0500568_0044992
1090 Ga0500568_0048056
1091 Ga0500577_0076956
1092 Ga0500590_143809
1093 Ga0500590_147854
1094 Ga0500620_026553
1095 Ga0500638_065902
1096 Ga0500638_077489
1097 Ga0500639_077586
1098 Ga0500639_184930
1099 Ga0500636_0009769
1100 Ga0500636_0050452
1101 Ga0500637_0141622
1102 Ga0500625_003257
1103 Ga0500645_029330
1104 Ga0500645_121483
1105 Ga0500552_104336
1106 Ga0500596_002953
1107 Ga0500599_016604
1108 Ga0500601_000864
1109 Ga0500661_001555
1110 Ga0466962_0060955
1111 2513701981
1112 2507505554
1113 2508695771
1114 2511397656
1115 2513642341
1116 2513652569
1117 2513721872
1118 2513879319
1119 2514016861
1120 2517107935
1121 2524441998
1122 2617353671
1123 2617377363
1124 2644063589
1125 2644414352
1126 2644447880
1127 2644690353
1128 2745082384
1129 2793065674
1130 2805921534
1131 2818239069
1132 2824603004
1133 2824615478
1134 2824623930
1135 2824632591
1136 2824639455
1137 2824649453
1138 2824660317
1139 2824675361
1140 2824684678
1141 2824691579
1142 2824700506
1143 2824707350
1144 2824719335
1145 2824727959
1146 2824736169
1147 2824750240
1148 2824758726
1149 2824769196
1150 2841947878
1151 2841965066
1152 2841977436
1153 2842041288
1154 2842049330
1155 2844315765
1156 2847931367
1157 2847942458
1158 2857516482
1159 2874619067
1160 2874623032
1161 2874636841
1162 2876763731
1163 2879087596
1164 2881365451
1165 2881671507
1166 2885368598
1167 2885413200
1168 2888379282
1169 2888390397
1170 2888419961
1171 2903730936
1172 2904666656
1173 2904714073
1174 2906603758
1175 2906650508
1176 2908775883
1177 2922394699
1178 2932799996
1179 2932809007
1180 2935614613
1181 2935774187
1182 2935782356
1183 2935789097
1184 2935796847
1185 2935826355
1186 2935853842
1187 2935888208
1188 2935985265
1189 2941537987
1190 3005489261
1191 3005511498
1192 3005592291
1193 3005595352
1194 3005711311
1195 3005718593
1196 8016525899
1197 8016539502
1198 8016543792
1199 8016549504
1200 8016557926
1201 8016569191
1202 8016581832
1203 8016586029
1204 8016595946
1205 8016606816
1206 8016618722
1207 8016622808
1208 8019530781
1209 8019540803
1210 8019549811
1211 8019652084
1212 8056975745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06906

DUF1272

Protein of unknown function (DUF1272)

18

74

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h2g-assembly1.cif.gz_A the structural basis of sirtuin substrate affinity 0.7259 32 68
3knv-assembly1.cif.gz_A crystal structure of the ring and first zinc finger domains of traf2 0.6841 12 52
4txa-assembly1.cif.gz_A crystal structure of n-terminus of roquin 0.6768 17 63
1zbd-assembly1.cif.gz_B structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a 0.6681 12 46
3jr3-assembly1.cif.gz_A sir2 bound to acetylated peptide 0.6671 32 72
ID Description Score Start End Superfamily
af_Q6E2N3_126_194_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7887 17 46 3.30.40.10
af_Q559R2_9_109_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7285 17 65 3.30.40.10
af_Q54FC5_8_88_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7238 17 61 3.30.40.10
af_Q54FB2_9_111_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7143 17 61 3.30.40.10
af_Q9N3H1_231_309_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6972 17 63 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A527GJD8-F1-model_v4 DUF1272 domain-containing protein 0.9626 15 62
AF-A0A7W4UHV1-F1-model_v4 DUF1272 domain-containing protein 0.9296 16 68
AF-A0A2S6VQ25-F1-model_v4 deleted 0.9104 17 70
AF-A0A3D4C896-F1-model_v4 deleted 0.9064 16 63
AF-A0A162JIZ8-F1-model_v4 DUF1272 domain-containing protein 0.8964 16 70

Map