F468634

General Info

Members Datasets Scaffolds Average Seq Length
606 279 1212 230

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0017056|Ga0501067_0017056_216_1001
Length 261
Sequence VARRSNDDDRKPIIGITSYAQPAKWGAWDLPAALVPLDYVTAVTQAGGRPLLVPPADDGVEETLDALDGIIFSGGSDLGPSIYGAEAHAETDPPQTHRDAAEMALLEAALERDIPTLAICRGFQLLNVVRGGDLVQHLPEAVGDEKHREVRGVFSEHPVEVKEGTLLSELLGERQPGVKSSHHQGVGRVGEGLVETAWAEDGTLEGLEDPSRRFALGVLWHPEAGEDRRLFEGLVAEARRYRAGRADAAGADVLAKSSRSS

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.22
Rhizosphere 88.45
Stem 0
Stem Tuber 0
Unclassified 3.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0017056 3300049583 Bacteria 4012
2 Ga0070658_10007621 3300005327 Bacteria 8730
3 Ga0070658_10139938 3300005327 Bacteria 2021
4 Ga0070658_10440682 3300005327 Bacteria 1122
5 Ga0070683_100170706 3300005329 Bacteria 2064
6 Ga0070683_100180651 3300005329 Bacteria 2003
7 Ga0070683_100271672 3300005329 Bacteria 1612
8 Ga0070680_100010146 3300005336 Bacteria 7261
9 Ga0070680_100034355 3300005336 Bacteria 4088
10 Ga0070682_100184772 3300005337 Bacteria 1459
11 Ga0070682_100256144 3300005337 Bacteria 1264
12 Ga0070660_100030461 3300005339 Bacteria 4048
13 Ga0070660_100031498 3300005339 Bacteria 3983
14 Ga0070660_100065379 3300005339 Bacteria 2830
15 Ga0070660_100356267 3300005339 Bacteria 1205
16 Ga0070661_100007380 3300005344 Bacteria 7579
17 Ga0070661_100019288 3300005344 Bacteria 4860
18 Ga0070661_100093081 3300005344 Bacteria 2234
19 Ga0070661_100122470 3300005344 Bacteria 1949
20 Ga0070675_100982121 3300005354 Bacteria 775
21 Ga0070671_100146367 3300005355 Bacteria 1994
22 Ga0070673_100434449 3300005364 Bacteria 1179
23 Ga0070659_100010779 3300005366 Bacteria 6740
24 Ga0070659_100071509 3300005366 Bacteria 2758
25 Ga0070709_10058787 3300005434 Bacteria 2439
26 Ga0070709_10363593 3300005434 Bacteria 1072
27 Ga0070714_100042078 3300005435 Bacteria 3858
28 Ga0070714_100079375 3300005435 Bacteria 2853
29 Ga0070714_100855757 3300005435 Bacteria 882
30 Ga0070713_100001075 3300005436 Bacteria 17478
31 Ga0070710_10107126 3300005437 Bacteria 1673
32 Ga0070711_100117929 3300005439 Bacteria 1958
33 Ga0070705_100480984 3300005440 Bacteria 938
34 Ga0070694_100313575 3300005444 Bacteria 1205
35 Ga0070708_100576536 3300005445 Bacteria 1061
36 Ga0070681_10003984 3300005458 Bacteria 13931
37 Ga0070681_10024040 3300005458 Bacteria 6135
38 Ga0070681_10077991 3300005458 Bacteria 3269
39 Ga0070681_10086323 3300005458 Bacteria 3091
40 Ga0070681_10116002 3300005458 Bacteria 2615
41 Ga0070681_10124481 3300005458 Bacteria 2510
42 Ga0070681_10258201 3300005458 Bacteria 1654
43 Ga0070706_100001966 3300005467 Bacteria 21177
44 Ga0070706_100152167 3300005467 Bacteria 2160
45 Ga0070707_100001545 3300005468 Bacteria 22379
46 Ga0070707_100303228 3300005468 Bacteria 1552
47 Ga0070698_100144571 3300005471 Bacteria 2328
48 Ga0070698_100396272 3300005471 Bacteria 1313
49 Ga0070679_100017891 3300005530 Bacteria 6865
50 Ga0070679_100090219 3300005530 Bacteria 3053
51 Ga0070679_100124522 3300005530 Bacteria 2560
52 Ga0070679_100226981 3300005530 Unclassified 1827
53 Ga0070679_100243755 3300005530 Bacteria 1754
54 Ga0070679_100275238 3300005530 Bacteria 1637
55 Ga0070679_100357126 3300005530 Bacteria 1409
56 Ga0070679_100371435 3300005530 Bacteria 1377
57 Ga0070679_100439179 3300005530 Bacteria 1250
58 Ga0070684_100060858 3300005535 Bacteria 3304
59 Ga0070684_100073809 3300005535 Bacteria 3006
60 Ga0070684_100330097 3300005535 Bacteria 1402
61 Ga0070684_100360166 3300005535 Bacteria 1339
62 Ga0070697_100819274 3300005536 Bacteria 824
63 Ga0068853_100118378 3300005539 Bacteria 2360
64 Ga0068853_100158488 3300005539 Bacteria 2041
65 Ga0068853_100377774 3300005539 Bacteria 1323
66 Ga0070686_100036147 3300005544 Bacteria 3057
67 Ga0070686_100120214 3300005544 Bacteria 1803
68 Ga0070695_100000003 3300005545 Bacteria 111545
69 Ga0070695_100070973 3300005545 Unclassified 2280
70 Ga0070696_100029164 3300005546 Bacteria 3769
71 Ga0070696_100369160 3300005546 Bacteria 1116
72 Ga0070665_100008385 3300005548 Bacteria 10454
73 Ga0070704_100033689 3300005549 Bacteria 3466
74 Ga0070704_100233705 3300005549 Bacteria 1501
75 Ga0068855_100007771 3300005563 Bacteria 12952
76 Ga0068855_100131387 3300005563 Bacteria 2859
77 Ga0068855_100183512 3300005563 Bacteria 2365
78 Ga0068855_100210807 3300005563 Bacteria 2183
79 Ga0068855_100365919 3300005563 Bacteria 1586
80 Ga0068855_100637334 3300005563 Bacteria 1146
81 Ga0070664_100056009 3300005564 Bacteria 3350
82 Ga0070664_100803328 3300005564 Bacteria 880
83 Ga0068857_100020899 3300005577 Bacteria 5758
84 Ga0068857_100034647 3300005577 Bacteria 4465
85 Ga0068857_100258227 3300005577 Bacteria 1599
86 Ga0068854_100196632 3300005578 Bacteria 1583
87 Ga0068854_100477148 3300005578 Bacteria 1046
88 Ga0068856_100042947 3300005614 Bacteria 4448
89 Ga0068856_100085883 3300005614 Bacteria 3126
90 Ga0068852_100159522 3300005616 Bacteria 2105
91 Ga0068852_100165163 3300005616 Bacteria 2071
92 Ga0068860_100449539 3300005843 Bacteria 1281
93 Ga0068862_100121581 3300005844 Bacteria 2302
94 Ga0081455_10014810 3300005937 Bacteria 7610
95 Ga0081455_10184311 3300005937 Bacteria 1578
96 Ga0081538_10036429 3300005981 Bacteria 3210
97 Ga0081539_10000068 3300005985 Bacteria 240998
98 Ga0081539_10000883 3300005985 Bacteria 57339
99 Ga0070717_10006950 3300006028 Bacteria 8362
100 Ga0070717_10023363 3300006028 Bacteria 4897
101 Ga0070715_10002011 3300006163 Bacteria 6131
102 Ga0070716_100029331 3300006173 Bacteria 2973
103 Ga0070712_100087276 3300006175 Bacteria 2276
104 Ga0097621_100505894 3300006237 Bacteria 1095
105 Ga0068871_100406539 3300006358 Bacteria 1213
106 Ga0068871_100449352 3300006358 Bacteria 1155
107 Ga0075428_100207075 3300006844 Bacteria 2120
108 Ga0075431_100076127 3300006847 Bacteria 3463
109 Ga0075433_10059835 3300006852 Bacteria 3334
110 Ga0075434_100808573 3300006871 Bacteria 953
111 Ga0075429_100276386 3300006880 Bacteria 1471
112 Ga0105240_10131891 3300009093 Bacteria 2997
113 Ga0105240_10132067 3300009093 Bacteria 2994
114 Ga0105240_10170953 3300009093 Bacteria 2574
115 Ga0111539_10003439 3300009094 Bacteria 20851
116 Ga0111539_10009174 3300009094 Bacteria 12511
117 Ga0111539_10119370 3300009094 Bacteria 3090
118 Ga0111539_10578116 3300009094 Bacteria 1308
119 Ga0111539_10637991 3300009094 Bacteria 1240
120 Ga0105245_10013670 3300009098 Bacteria 7072
121 Ga0105245_10455354 3300009098 Bacteria 1289
122 Ga0105245_10687172 3300009098 Bacteria 1056
123 Ga0114129_10180809 3300009147 Bacteria 2869
124 Ga0114129_10552309 3300009147 Bacteria 1497
125 Ga0105243_10083383 3300009148 Bacteria 2615
126 Ga0105243_10657346 3300009148 Bacteria 1016
127 Ga0105242_10436844 3300009176 Bacteria 1230
128 Ga0105242_10486513 3300009176 Unclassified 1171
129 Ga0105248_10129391 3300009177 Bacteria 2848
130 Ga0105237_10013696 3300009545 Bacteria 8494
131 Ga0105237_10103159 3300009545 Bacteria 2844
132 Ga0105237_10759001 3300009545 Bacteria 976
133 Ga0105238_10085019 3300009551 Bacteria 3153
134 Ga0105238_10203139 3300009551 Bacteria 1958
135 Ga0105249_10042642 3300009553 Bacteria 4128
136 Ga0105239_10170415 3300010375 Bacteria 2434
137 Ga0105239_10225209 3300010375 Bacteria 2103
138 Ga0105239_11088701 3300010375 Bacteria 920
139 Ga0157373_10143256 3300013100 Bacteria 1681
140 Ga0157373_10247541 3300013100 Bacteria 1260
141 Ga0157373_10330459 3300013100 Bacteria 1085
142 Ga0157373_10340104 3300013100 Bacteria 1069
143 Ga0157370_10066889 3300013104 Bacteria 3397
144 Ga0157370_10127593 3300013104 Bacteria 2374
145 Ga0157370_10142022 3300013104 Bacteria 2237
146 Ga0157369_10006848 3300013105 Bacteria 13151
147 Ga0157369_10015177 3300013105 Bacteria 8695
148 Ga0157369_10134192 3300013105 Bacteria 2622
149 Ga0157369_10206935 3300013105 Bacteria 2058
150 Ga0157369_10519596 3300013105 Bacteria 1231
151 Ga0157374_10102971 3300013296 Bacteria 2739
152 Ga0157378_10236153 3300013297 Bacteria 1744
153 Ga0157372_10255393 3300013307 Bacteria 2035
154 Ga0157372_10289697 3300013307 Unclassified 1904
155 Ga0157372_10295238 3300013307 Bacteria 1885
156 Ga0157372_10373902 3300013307 Bacteria 1661
157 Ga0157372_10601423 3300013307 Bacteria 1282
158 Ga0157372_11273023 3300013307 Bacteria 849
159 Ga0157372_11888237 3300013307 Bacteria 687
160 Ga0157375_10113447 3300013308 Bacteria 2811
161 Ga0157375_10838365 3300013308 Unclassified 1066
162 Ga0163163_10756667 3300014325 Bacteria 1035
163 Ga0157380_10155857 3300014326 Bacteria 1979
164 Ga0157380_10610293 3300014326 Unclassified 1081
165 Ga0157379_10333157 3300014968 Bacteria 1387
166 Ga0197907_10712769 3300020069 Bacteria 1332
167 Ga0197907_11264549 3300020069 Bacteria 1620
168 Ga0206356_10291375 3300020070 Bacteria 881
169 Ga0206356_10407665 3300020070 Bacteria 1926
170 Ga0206356_11346550 3300020070 Bacteria 2775
171 Ga0206354_10762076 3300020081 Bacteria 1378
172 Ga0206353_10310209 3300020082 Bacteria 2253
173 Ga0206353_10701962 3300020082 Bacteria 3716
174 Ga0206353_10734125 3300020082 Bacteria 1916
175 Ga0207692_10025141 3300025898 Bacteria 2777
176 Ga0207699_10119317 3300025906 Bacteria 1703
177 Ga0207643_10023294 3300025908 Bacteria 3414
178 Ga0207705_10053829 3300025909 Bacteria 2900
179 Ga0207705_10119785 3300025909 Bacteria 1952
180 Ga0207705_10155889 3300025909 Bacteria 1713
181 Ga0207684_10016922 3300025910 Bacteria 6262
182 Ga0207684_10225763 3300025910 Bacteria 1616
183 Ga0207707_10008162 3300025912 Bacteria 9085
184 Ga0207707_10047516 3300025912 Bacteria 3737
185 Ga0207695_10191597 3300025913 Bacteria 1962
186 Ga0207695_10223203 3300025913 Bacteria 1791
187 Ga0207695_10520123 3300025913 Bacteria 1072
188 Ga0207693_10012103 3300025915 Bacteria 6975
189 Ga0207693_10013795 3300025915 Bacteria 6505
190 Ga0207693_10080403 3300025915 Bacteria 2552
191 Ga0207663_10559216 3300025916 Bacteria 895
192 Ga0207660_10008664 3300025917 Bacteria 6579
193 Ga0207660_10018115 3300025917 Bacteria 4690
194 Ga0207660_10277766 3300025917 Bacteria 1328
195 Ga0207657_10000184 3300025919 Bacteria 64813
196 Ga0207657_10004061 3300025919 Bacteria 15537
197 Ga0207657_10038853 3300025919 Bacteria 4232
198 Ga0207657_10039483 3300025919 Bacteria 4194
199 Ga0207657_10078456 3300025919 Bacteria 2781
200 Ga0207657_10240296 3300025919 Bacteria 1446
201 Ga0207649_10008763 3300025920 Bacteria 5522
202 Ga0207652_10017450 3300025921 Bacteria 5875
203 Ga0207652_10034639 3300025921 Bacteria 4256
204 Ga0207652_10137646 3300025921 Bacteria 2182
205 Ga0207652_10191329 3300025921 Unclassified 1840
206 Ga0207652_10205307 3300025921 Bacteria 1773
207 Ga0207652_10332873 3300025921 Bacteria 1371
208 Ga0207646_10003800 3300025922 Bacteria 16799
209 Ga0207646_10219818 3300025922 Bacteria 1716
210 Ga0207681_10151831 3300025923 Bacteria 1737
211 Ga0207687_10011724 3300025927 Bacteria 5734
212 Ga0207687_10236145 3300025927 Bacteria 1446
213 Ga0207700_10174093 3300025928 Bacteria 1797
214 Ga0207664_10044998 3300025929 Bacteria 3459
215 Ga0207664_10048810 3300025929 Bacteria 3330
216 Ga0207664_10089855 3300025929 Bacteria 2516
217 Ga0207644_10018222 3300025931 Bacteria 4748
218 Ga0207690_10081053 3300025932 Bacteria 2266
219 Ga0207709_10274300 3300025935 Bacteria 1243
220 Ga0207665_10000716 3300025939 Bacteria 22500
221 Ga0207691_10131499 3300025940 Bacteria 2210
222 Ga0207661_10097241 3300025944 Bacteria 2465
223 Ga0207661_10262872 3300025944 Bacteria 1538
224 Ga0207661_10321049 3300025944 Bacteria 1392
225 Ga0207661_10498945 3300025944 Bacteria 1112
226 Ga0207679_10324606 3300025945 Bacteria 1334
227 Ga0207667_10047169 3300025949 Bacteria 4560
228 Ga0207667_10077738 3300025949 Bacteria 3441
229 Ga0207667_10165234 3300025949 Bacteria 2275
230 Ga0207667_10231724 3300025949 Bacteria 1891
231 Ga0207667_10732402 3300025949 Bacteria 989
232 Ga0207651_10319669 3300025960 Bacteria 1297
233 Ga0207712_10276197 3300025961 Bacteria 1369
234 Ga0207640_10050843 3300025981 Bacteria 2691
235 Ga0207640_10099704 3300025981 Bacteria 2033
236 Ga0207640_10575359 3300025981 Bacteria 950
237 Ga0207677_10287892 3300026023 Bacteria 1352
238 Ga0207677_10656001 3300026023 Bacteria 927
239 Ga0207639_10108495 3300026041 Bacteria 2257
240 Ga0207678_10694456 3300026067 Bacteria 895
241 Ga0207702_10365915 3300026078 Bacteria 1383
242 Ga0207702_10530128 3300026078 Bacteria 1150
243 Ga0207648_10294996 3300026089 Bacteria 1453
244 Ga0207676_10238658 3300026095 Bacteria 1629
245 Ga0207674_10004486 3300026116 Bacteria 16777
246 Ga0207674_10026669 3300026116 Bacteria 6130
247 Ga0207674_10067234 3300026116 Bacteria 3608
248 Ga0207674_10279003 3300026116 Bacteria 1619
249 Ga0207675_100043673 3300026118 Bacteria 4186
250 Ga0207698_10067872 3300026142 Bacteria 2814
251 Ga0207698_10318424 3300026142 Bacteria 1455
252 Ga0207428_10045360 3300027907 Bacteria 3541
253 Ga0207428_10059012 3300027907 Bacteria 3043
254 Ga0207428_10276290 3300027907 Bacteria 1248
255 Ga0268265_10099967 3300028380 Bacteria 2340
256 Ga0265326_10036091 3300028558 Bacteria 1405
257 Ga0265319_1003565 3300028563 Bacteria 8072
258 Ga0265334_10004621 3300028573 Bacteria 6084
259 Ga0265334_10017295 3300028573 Bacteria 2980
260 Ga0265334_10061620 3300028573 Bacteria 1413
261 Ga0265318_10000371 3300028577 Bacteria 35311
262 Ga0265318_10002892 3300028577 Bacteria 8937
263 Ga0265323_10009887 3300028653 Bacteria 3880
264 Ga0265322_10010173 3300028654 Bacteria 2727
265 Ga0265322_10024287 3300028654 Bacteria 1733
266 Ga0265338_10009157 3300028800 Bacteria 11878
267 Ga0265338_10013411 3300028800 Bacteria 9258
268 Ga0265338_10024297 3300028800 Bacteria 6195
269 Ga0265338_10034370 3300028800 Bacteria 4900
270 Ga0265338_10113257 3300028800 Bacteria 2179
271 Ga0265330_10029455 3300031235 Bacteria 2469
272 Ga0265332_10010891 3300031238 Bacteria 4040
273 Ga0265328_10009941 3300031239 Bacteria 3847
274 Ga0265320_10019757 3300031240 Bacteria 3672
275 Ga0265325_10133544 3300031241 Bacteria 1186
276 Ga0265329_10007467 3300031242 Bacteria 4220
277 Ga0265329_10031404 3300031242 Bacteria 1725
278 Ga0265329_10035091 3300031242 Bacteria 1619
279 Ga0265340_10008900 3300031247 Bacteria 5410
280 Ga0265340_10021922 3300031247 Bacteria 3272
281 Ga0265340_10029217 3300031247 Bacteria 2769
282 Ga0265339_10059108 3300031249 Bacteria 2068
283 Ga0265331_10094552 3300031250 Bacteria 1379
284 Ga0265327_10027773 3300031251 Bacteria 3250
285 Ga0265327_10051586 3300031251 Bacteria 2147
286 Ga0265316_10023432 3300031344 Bacteria 5186
287 Ga0265316_10041321 3300031344 Bacteria 3691
288 Ga0307408_100056249 3300031548 Bacteria 2852
289 Ga0307408_100170435 3300031548 Bacteria 1738
290 Ga0265313_10044687 3300031595 Bacteria 2160
291 Ga0265314_10009136 3300031711 Bacteria 8412
292 Ga0265342_10072503 3300031712 Bacteria 2004
293 Ga0307405_10578040 3300031731 Bacteria 913
294 Ga0307413_10005683 3300031824 Bacteria 5599
295 Ga0307410_10000555 3300031852 Bacteria 15328
296 Ga0307410_10217781 3300031852 Bacteria 1467
297 Ga0307410_10571353 3300031852 Bacteria 940
298 Ga0307406_10372247 3300031901 Bacteria 1123
299 Ga0307407_10002786 3300031903 Bacteria 6968
300 Ga0307407_10398771 3300031903 Bacteria 986
301 Ga0307412_10026318 3300031911 Bacteria 3614
302 Ga0307409_100006847 3300031995 Bacteria 6751
303 Ga0307416_100001279 3300032002 Bacteria 13551
304 Ga0307416_100001663 3300032002 Bacteria 12281
305 Ga0307414_10113897 3300032004 Bacteria 2065
306 Ga0307415_100000129 3300032126 Bacteria 32651
307 Ga0307415_100065693 3300032126 Bacteria 2529
308 Ga0316583_10134307 3300032133 Bacteria 862
309 Ga0373944_0030924 3300035089 Unclassified 1608
310 Ga0373956_0060824 3300035119 Bacteria 1711
311 Ga0373960_0056762 3300035121 Bacteria 1177
312 Ga0373943_0007713 3300035170 Bacteria 4833
313 Ga0373935_0040924 3300035692 Bacteria 2910
314 Ga0373933_0374328 3300035724 Bacteria 927
315 Ga0373937_0054384 3300036401 Bacteria 3673
316 Ga0373937_0458032 3300036401 Unclassified 1211
317 Ga0395899_0008224 3300037312 Bacteria 8035
318 Ga0395899_0102945 3300037312 Bacteria 2060
319 Ga0395900_0010485 3300037418 Bacteria 9479
320 Ga0395900_0022999 3300037418 Bacteria 6379
321 Ga0395900_0024420 3300037418 Bacteria 6189
322 Ga0395900_0094672 3300037418 Bacteria 3068
323 Ga0395900_0109156 3300037418 Bacteria 2842
324 Ga0395900_0193401 3300037418 Bacteria 2062
325 Ga0395900_0459434 3300037418 Bacteria 1228
326 Ga0395900_0494397 3300037418 Bacteria 1174
327 Ga0395900_0624114 3300037418 Archaea 1016
328 Ga0395898_0003445 3300037466 Bacteria 17691
329 Ga0395898_0025046 3300037466 Bacteria 6015
330 Ga0395898_0037880 3300037466 Bacteria 4780
331 Ga0395898_0045937 3300037466 Bacteria 4291
332 Ga0395898_0062626 3300037466 Bacteria 3612
333 Ga0395898_0279475 3300037466 Bacteria 1592
334 Ga0395905_0047148 3300037471 Bacteria 4040
335 Ga0395905_0055681 3300037471 Bacteria 3701
336 Ga0395901_0011295 3300038443 Bacteria 9047
337 Ga0395901_0070137 3300038443 Bacteria 3651
338 Ga0395901_0077129 3300038443 Bacteria 3478
339 Ga0395901_0088003 3300038443 Bacteria 3248
340 Ga0395901_0559808 3300038443 Bacteria 1158
341 Ga0395901_0834470 3300038443 Unclassified 908
342 Ga0436360_0579655 3300039438 Bacteria 2870
343 Ga0436363_0495592 3300039450 Bacteria 2446
344 Ga0436362_0502902 3300039453 Bacteria 5790
345 Ga0439439_0001355 3300041406 Bacteria 4830
346 Ga0451853_3342724 3300041512 Bacteria 1080
347 Ga0439433_0006167 3300041999 Bacteria 2578
348 Ga0439449_0068369 3300042007 Unclassified 1310
349 Ga0439462_0010842 3300042015 Bacteria 2313
350 Ga0439446_0010393 3300042156 Bacteria 2504
351 Ga0439434_0080795 3300042435 Unclassified 1031
352 Ga0450918_004517 3300042531 Bacteria 2532
353 Ga0466969_0122752 3300044656 Bacteria 1208
354 Ga0466972_0122148 3300044658 Bacteria 1228
355 Ga0466965_0028228 3300044683 Bacteria 2726
356 Ga0466965_0171162 3300044683 Bacteria 1143
357 Ga0466965_0228568 3300044683 Unclassified 993
358 Ga0466966_0016683 3300044684 Bacteria 4851
359 Ga0466961_0007855 3300044693 Bacteria 6793
360 Ga0466961_0255035 3300044693 Bacteria 1076
361 Ga0466963_0002109 3300044694 Bacteria 10999
362 Ga0466963_0004267 3300044694 Bacteria 8291
363 Ga0466963_0013758 3300044694 Bacteria 4977
364 Ga0466963_0014056 3300044694 Bacteria 4931
365 Ga0466963_0034515 3300044694 Bacteria 3291
366 Ga0466963_0039912 3300044694 Bacteria 3076
367 Ga0466963_0158824 3300044694 Bacteria 1573
368 Ga0466964_0002138 3300044706 Bacteria 6969
369 Ga0466971_0000862 3300044719 Bacteria 12396
370 Ga0466971_0033349 3300044719 Bacteria 2307
371 Ga0466968_0002523 3300044735 Bacteria 6728
372 Ga0466968_0011071 3300044735 Bacteria 3509
373 Ga0466968_0105545 3300044735 Bacteria 1262
374 Ga0466968_0183470 3300044735 Bacteria 974
375 Ga0466957_0008515 3300044842 Bacteria 5836
376 Ga0466957_0034328 3300044842 Bacteria 3043
377 Ga0466957_0052784 3300044842 Bacteria 2476
378 Ga0466957_0328626 3300044842 Bacteria 1033
379 Ga0466957_0332608 3300044842 Unclassified 1027
380 Ga0466960_0006924 3300044901 Bacteria 4573
381 Ga0466960_0251044 3300044901 Bacteria 983
382 Ga0466960_0322866 3300044901 Bacteria 875
383 Ga0466959_0078060 3300045049 Bacteria 2388
384 Ga0466959_0132342 3300045049 Bacteria 1767
385 Ga0466959_0312957 3300045049 Bacteria 1074
386 Ga0451576_0208274 3300045051 Bacteria 2042
387 Ga0466958_0007973 3300045836 Bacteria 5854
388 Ga0466958_0016471 3300045836 Bacteria 4257
389 Ga0466958_0031354 3300045836 Bacteria 3159
390 Ga0466958_0046585 3300045836 Bacteria 2616
391 Ga0466967_0008341 3300045976 Bacteria 7582
392 Ga0466967_0012314 3300045976 Bacteria 6535
393 Ga0466967_0030424 3300045976 Bacteria 4531
394 Ga0466967_0031994 3300045976 Bacteria 4437
395 Ga0466967_0079831 3300045976 Bacteria 2951
396 Ga0466967_0102176 3300045976 Bacteria 2622
397 Ga0466967_0127929 3300045976 Bacteria 2355
398 Ga0466967_0177389 3300045976 Bacteria 2007
399 Ga0466967_0214156 3300045976 Bacteria 1828
400 Ga0466967_0284769 3300045976 Bacteria 1586
401 Ga0466967_0330764 3300045976 Bacteria 1471
402 Ga0466967_0353582 3300045976 Unclassified 1422
403 Ga0495592_0008456 3300046454 Bacteria 7722
404 Ga0495592_0170804 3300046454 Bacteria 1489
405 Ga0495603_0282370 3300046455 Bacteria 954
406 Ga0495629_0161232 3300046459 Bacteria 1558
407 Ga0495629_0375686 3300046459 Unclassified 968
408 Ga0495651_0034507 3300046462 Bacteria 3943
409 Ga0495651_0062521 3300046462 Bacteria 2848
410 Ga0495651_0128208 3300046462 Bacteria 1855
411 Ga0495653_0013446 3300046463 Bacteria 6669
412 Ga0495653_0038992 3300046463 Bacteria 3725
413 Ga0495653_0057961 3300046463 Bacteria 2945
414 Ga0495653_0071801 3300046463 Bacteria 2587
415 Ga0495582_0091143 3300046473 Bacteria 1700
416 Ga0495605_0063777 3300046474 Bacteria 1757
417 Ga0495664_0248894 3300046477 Bacteria 1075
418 Ga0495584_0005105 3300046491 Bacteria 6973
419 Ga0495608_0027337 3300046511 Bacteria 3882
420 Ga0495608_0029178 3300046511 Bacteria 3745
421 Ga0495608_0157281 3300046511 Bacteria 1446
422 Ga0495618_0348186 3300046514 Bacteria 913
423 Ga0495628_0055913 3300046516 Bacteria 3108
424 Ga0495628_0111636 3300046516 Bacteria 2102
425 Ga0495630_0011758 3300046517 Bacteria 6343
426 Ga0495630_0025066 3300046517 Bacteria 4409
427 Ga0495630_0043469 3300046517 Bacteria 3357
428 Ga0495663_0031125 3300046525 Bacteria 1584
429 Ga0495642_0078898 3300046528 Bacteria 1384
430 Ga0495652_0013274 3300046529 Bacteria 7414
431 Ga0495652_0368272 3300046529 Bacteria 1025
432 Ga0495586_0202368 3300046535 Bacteria 1126
433 Ga0495587_0081700 3300046536 Bacteria 1872
434 Ga0495587_0113346 3300046536 Unclassified 1556
435 Ga0495609_0105140 3300046538 Bacteria 1221
436 Ga0495597_0122608 3300046542 Bacteria 1083
437 Ga0495667_0009438 3300046559 Bacteria 6610
438 Ga0495667_0011699 3300046559 Bacteria 5941
439 Ga0495667_0023938 3300046559 Bacteria 4113
440 Ga0495635_0109543 3300046663 Bacteria 1887
441 Ga0495635_0113733 3300046663 Bacteria 1847
442 Ga0495657_0019019 3300046675 Bacteria 4962
443 Ga0495657_0141325 3300046675 Bacteria 1500
444 Ga0495599_0421899 3300046678 Unclassified 792
445 Ga0495623_0158204 3300046679 Bacteria 1333
446 Ga0495658_0013939 3300046683 Bacteria 4099
447 Ga0495613_0102330 3300046689 Bacteria 2068
448 Ga0495624_0083182 3300046690 Unclassified 1980
449 Ga0495670_0088623 3300046691 Bacteria 1582
450 Ga0495600_0048456 3300046809 Bacteria 2772
451 Ga0495600_0098104 3300046809 Unclassified 1910
452 Ga0495604_0033770 3300047317 Bacteria 4049
453 Ga0495604_0035910 3300047317 Bacteria 3911
454 Ga0495674_0002574 3300047319 Bacteria 17681
455 Ga0495674_0167378 3300047319 Bacteria 1836
456 Ga0495674_0214347 3300047319 Bacteria 1594
457 Ga0495680_0011824 3300047322 Bacteria 7708
458 Ga0495680_0035493 3300047322 Bacteria 4016
459 Ga0495675_0007324 3300047444 Bacteria 6799
460 Ga0495684_0032341 3300047471 Bacteria 4016
461 Ga0495602_0046139 3300048088 Bacteria 3938
462 Ga0496100_0023949 3300048903 Bacteria 3716
463 Ga0496100_0206860 3300048903 Bacteria 1433
464 Ga0496100_0220217 3300048903 Bacteria 1392
465 Ga0496101_0016384 3300048904 Bacteria 5007
466 Ga0496101_0050034 3300048904 Bacteria 3006
467 Ga0496101_0139925 3300048904 Bacteria 1844
468 Ga0496101_0302933 3300048904 Bacteria 1252
469 Ga0496102_0032493 3300048905 Bacteria 4688
470 Ga0496102_0040915 3300048905 Bacteria 4195
471 Ga0496102_0255687 3300048905 Bacteria 1651
472 Ga0496102_0532631 3300048905 Bacteria 1097
473 Ga0496103_0022493 3300048906 Bacteria 3797
474 Ga0496103_0212002 3300048906 Bacteria 1245
475 Ga0496104_0014337 3300048907 Bacteria 7158
476 Ga0496104_0023192 3300048907 Bacteria 5705
477 Ga0496104_0034543 3300048907 Bacteria 4716
478 Ga0496104_0165961 3300048907 Bacteria 2118
479 Ga0496105_0024639 3300048908 Bacteria 4890
480 Ga0496105_0059941 3300048908 Bacteria 3140
481 Ga0496106_0041603 3300048909 Bacteria 3444
482 Ga0496106_0098211 3300048909 Bacteria 2268
483 Ga0496106_0364145 3300048909 Bacteria 1161
484 Ga0496107_0068309 3300048910 Bacteria 2579
485 Ga0496107_0090482 3300048910 Bacteria 2235
486 Ga0496107_0360483 3300048910 Bacteria 1082
487 Ga0496108_0008904 3300048911 Bacteria 8137
488 Ga0496108_0023385 3300048911 Bacteria 5085
489 Ga0496108_0036091 3300048911 Bacteria 4111
490 Ga0496108_0044737 3300048911 Bacteria 3696
491 Ga0496108_0160343 3300048911 Bacteria 1943
492 Ga0496109_0023714 3300048912 Bacteria 5447
493 Ga0496109_0038452 3300048912 Bacteria 4326
494 Ga0496109_0042609 3300048912 Bacteria 4112
495 Ga0496109_0125548 3300048912 Bacteria 2392
496 Ga0496109_0741738 3300048912 Bacteria 920
497 Ga0496110_0003926 3300048913 Bacteria 11441
498 Ga0496110_0060402 3300048913 Bacteria 3343
499 Ga0496110_0172034 3300048913 Bacteria 1965
500 Ga0496110_0275304 3300048913 Bacteria 1533
501 Ga0496111_0019813 3300048914 Bacteria 4677
502 Ga0496111_0043464 3300048914 Bacteria 3229
503 Ga0496111_0144807 3300048914 Bacteria 1761
504 Ga0496111_0399638 3300048914 Bacteria 1015
505 Ga0496111_0413283 3300048914 Bacteria 997
506 Ga0496112_0008488 3300048915 Bacteria 9208
507 Ga0496112_0010528 3300048915 Bacteria 8396
508 Ga0496112_0017043 3300048915 Bacteria 6820
509 Ga0496112_0021702 3300048915 Bacteria 6108
510 Ga0496112_0062725 3300048915 Bacteria 3667
511 Ga0496112_0089016 3300048915 Bacteria 3054
512 Ga0496112_0226591 3300048915 Bacteria 1824
513 Ga0496112_0510012 3300048915 Bacteria 1138
514 Ga0496112_0614095 3300048915 Unclassified 1019
515 Ga0496113_0001694 3300048916 Bacteria 12490
516 Ga0496113_0169497 3300048916 Bacteria 1729
517 Ga0496113_0171905 3300048916 Bacteria 1716
518 Ga0496113_0586782 3300048916 Bacteria 893
519 Ga0496114_0004135 3300048917 Bacteria 11226
520 Ga0496114_0009742 3300048917 Bacteria 7634
521 Ga0496114_0025462 3300048917 Bacteria 4837
522 Ga0496114_0054086 3300048917 Bacteria 3347
523 Ga0496114_0080222 3300048917 Bacteria 2756
524 Ga0496114_0101636 3300048917 Bacteria 2455
525 Ga0496114_0172472 3300048917 Bacteria 1886
526 Ga0496114_0893996 3300048917 Bacteria 769
527 Ga0496115_0002852 3300048918 Bacteria 12444
528 Ga0496115_0201826 3300048918 Bacteria 1642
529 Ga0496115_0321419 3300048918 Bacteria 1266
530 Ga0501032_0010152 3300049569 Bacteria 6795
531 Ga0501034_0717237 3300049571 Bacteria 897
532 Ga0501036_0037785 3300049572 Bacteria 4084
533 Ga0501036_0206908 3300049572 Bacteria 1649
534 Ga0501038_0296649 3300049574 Bacteria 1269
535 Ga0501039_0112239 3300049575 Bacteria 2131
536 Ga0501041_0100134 3300049577 Bacteria 1793
537 Ga0501041_0170232 3300049577 Bacteria 1363
538 Ga0501042_0154539 3300049578 Bacteria 1655
539 Ga0501046_0220878 3300049580 Bacteria 1402
540 Ga0501048_0064484 3300049582 Bacteria 2591
541 Ga0501048_0099121 3300049582 Bacteria 2055
542 Ga0501067_0003148 3300049583 Bacteria 9112
543 Ga0501067_0004011 3300049583 Bacteria 8120
544 Ga0501067_0008858 3300049583 Bacteria 5574
545 Ga0501067_0023790 3300049583 Bacteria 3397
546 Ga0501067_0106203 3300049583 Bacteria 1560
547 Ga0501067_0250341 3300049583 Bacteria 986
548 Ga0501068_0031180 3300049584 Bacteria 3166
549 Ga0501068_0064544 3300049584 Bacteria 2228
550 Ga0501068_0267481 3300049584 Bacteria 1091
551 Ga0501069_0002078 3300049585 Bacteria 10076
552 Ga0501069_0079859 3300049585 Bacteria 1841
553 Ga0501070_0018029 3300049586 Bacteria 5923
554 Ga0501070_0034791 3300049586 Bacteria 4211
555 Ga0501070_0212129 3300049586 Bacteria 1589
556 Ga0501070_0311733 3300049586 Bacteria 1281
557 Ga0501071_0022515 3300049587 Bacteria 4393
558 Ga0501071_0128030 3300049587 Bacteria 1885
559 Ga0501071_0497396 3300049587 Unclassified 935
560 Ga0501072_0011885 3300049588 Bacteria 6650
561 Ga0501072_0046053 3300049588 Bacteria 3431
562 Ga0501072_0137520 3300049588 Bacteria 1948
563 Ga0501072_0180328 3300049588 Bacteria 1685
564 Ga0501073_0025188 3300049589 Bacteria 4269
565 Ga0501073_0067898 3300049589 Bacteria 2485
566 Ga0501074_0058108 3300049590 Bacteria 2786
567 Ga0501076_0213466 3300049592 Bacteria 1577
568 Ga0501077_0066124 3300049593 Bacteria 2293
569 Ga0501079_0041418 3300049741 Bacteria 3555
570 Ga0501079_0209512 3300049741 Bacteria 1522
571 Ga0501080_0017150 3300049742 Bacteria 6690
572 Ga0501080_0033236 3300049742 Bacteria 4814
573 Ga0501080_0230281 3300049742 Bacteria 1694
574 Ga0501081_0038310 3300049743 Bacteria 3274
575 Ga0501081_0084595 3300049743 Bacteria 2225
576 Ga0501083_0000397 3300049744 Bacteria 27678
577 Ga0501083_0120882 3300049744 Bacteria 1718
578 Ga0501035_0008968 3300049822 Bacteria 9303
579 Ga0501044_0072338 3300049823 Bacteria 3505
580 Ga0501045_0042028 3300049824 Bacteria 3327
581 nmdc:mga05p37_820550_c1 3300050507 Unclassified 1014
582 nmdc:mga09592_28873_c1 3300050508 Bacteria 4611
583 nmdc:mga08y16_138776_c1 3300050511 Bacteria 2527
584 nmdc:mga08y16_46711_c1 3300050511 Bacteria 4533
585 nmdc:mga08y16_561838_c1 3300050511 Bacteria 1154
586 nmdc:mga08y16_79190_c1 3300050511 Bacteria 3425
587 nmdc:mga0n895_155201_c1 3300050512 Bacteria 2319
588 nmdc:mga0n895_289619_c1 3300050512 Bacteria 1660
589 nmdc:mga0rr50_170286_c1 3300050513 Bacteria 1774
590 nmdc:mga0rr50_303665_c1 3300050513 Bacteria 1335
591 nmdc:mga08x19_469361_c1 3300050514 Bacteria 887
592 nmdc:mga0a205_130222_c1 3300050515 Bacteria 2416
593 nmdc:mga0a205_314031_c1 3300050515 Bacteria 1439
594 Ga0495595_0069795 3300053084 Bacteria 1659
595 Ga0495595_0076840 3300053084 Bacteria 1585
596 Ga0495619_0017945 3300053085 Bacteria 4486
597 Ga0495619_0071853 3300053085 Bacteria 2316
598 Ga0495619_0108859 3300053085 Bacteria 1892
599 Ga0501082_0248871 3300060353 Bacteria 1547
600 Ga0501082_0281599 3300060353 Bacteria 1447
601 Ga0466962_0000388 3300061719 Bacteria 18980
602 Ga0466962_0033848 3300061719 Bacteria 2445
603 Ga0530510_0059758 3300061734 Bacteria 2758
604 Ga0530510_0122822 3300061734 Bacteria 1907
605 Ga0530510_0284883 3300061734 Bacteria 1235
606 Ga0530510_0324541 3300061734 Unclassified 1154
607 Ga0501067_0017056
608 Ga0070658_10007621
609 Ga0070658_10139938
610 Ga0070658_10440682
611 Ga0070683_100170706
612 Ga0070683_100180651
613 Ga0070683_100271672
614 Ga0070680_100010146
615 Ga0070680_100034355
616 Ga0070682_100184772
617 Ga0070682_100256144
618 Ga0070660_100030461
619 Ga0070660_100031498
620 Ga0070660_100065379
621 Ga0070660_100356267
622 Ga0070661_100007380
623 Ga0070661_100019288
624 Ga0070661_100093081
625 Ga0070661_100122470
626 Ga0070675_100982121
627 Ga0070671_100146367
628 Ga0070673_100434449
629 Ga0070659_100010779
630 Ga0070659_100071509
631 Ga0070709_10058787
632 Ga0070709_10363593
633 Ga0070714_100042078
634 Ga0070714_100079375
635 Ga0070714_100855757
636 Ga0070713_100001075
637 Ga0070710_10107126
638 Ga0070711_100117929
639 Ga0070705_100480984
640 Ga0070694_100313575
641 Ga0070708_100576536
642 Ga0070681_10003984
643 Ga0070681_10024040
644 Ga0070681_10077991
645 Ga0070681_10086323
646 Ga0070681_10116002
647 Ga0070681_10124481
648 Ga0070681_10258201
649 Ga0070706_100001966
650 Ga0070706_100152167
651 Ga0070707_100001545
652 Ga0070707_100303228
653 Ga0070698_100144571
654 Ga0070698_100396272
655 Ga0070679_100017891
656 Ga0070679_100090219
657 Ga0070679_100124522
658 Ga0070679_100226981
659 Ga0070679_100243755
660 Ga0070679_100275238
661 Ga0070679_100357126
662 Ga0070679_100371435
663 Ga0070679_100439179
664 Ga0070684_100060858
665 Ga0070684_100073809
666 Ga0070684_100330097
667 Ga0070684_100360166
668 Ga0070697_100819274
669 Ga0068853_100118378
670 Ga0068853_100158488
671 Ga0068853_100377774
672 Ga0070686_100036147
673 Ga0070686_100120214
674 Ga0070695_100000003
675 Ga0070695_100070973
676 Ga0070696_100029164
677 Ga0070696_100369160
678 Ga0070665_100008385
679 Ga0070704_100033689
680 Ga0070704_100233705
681 Ga0068855_100007771
682 Ga0068855_100131387
683 Ga0068855_100183512
684 Ga0068855_100210807
685 Ga0068855_100365919
686 Ga0068855_100637334
687 Ga0070664_100056009
688 Ga0070664_100803328
689 Ga0068857_100020899
690 Ga0068857_100034647
691 Ga0068857_100258227
692 Ga0068854_100196632
693 Ga0068854_100477148
694 Ga0068856_100042947
695 Ga0068856_100085883
696 Ga0068852_100159522
697 Ga0068852_100165163
698 Ga0068860_100449539
699 Ga0068862_100121581
700 Ga0081455_10014810
701 Ga0081455_10184311
702 Ga0081538_10036429
703 Ga0081539_10000068
704 Ga0081539_10000883
705 Ga0070717_10006950
706 Ga0070717_10023363
707 Ga0070715_10002011
708 Ga0070716_100029331
709 Ga0070712_100087276
710 Ga0097621_100505894
711 Ga0068871_100406539
712 Ga0068871_100449352
713 Ga0075428_100207075
714 Ga0075431_100076127
715 Ga0075433_10059835
716 Ga0075434_100808573
717 Ga0075429_100276386
718 Ga0105240_10131891
719 Ga0105240_10132067
720 Ga0105240_10170953
721 Ga0111539_10003439
722 Ga0111539_10009174
723 Ga0111539_10119370
724 Ga0111539_10578116
725 Ga0111539_10637991
726 Ga0105245_10013670
727 Ga0105245_10455354
728 Ga0105245_10687172
729 Ga0114129_10180809
730 Ga0114129_10552309
731 Ga0105243_10083383
732 Ga0105243_10657346
733 Ga0105242_10436844
734 Ga0105242_10486513
735 Ga0105248_10129391
736 Ga0105237_10013696
737 Ga0105237_10103159
738 Ga0105237_10759001
739 Ga0105238_10085019
740 Ga0105238_10203139
741 Ga0105249_10042642
742 Ga0105239_10170415
743 Ga0105239_10225209
744 Ga0105239_11088701
745 Ga0157373_10143256
746 Ga0157373_10247541
747 Ga0157373_10330459
748 Ga0157373_10340104
749 Ga0157370_10066889
750 Ga0157370_10127593
751 Ga0157370_10142022
752 Ga0157369_10006848
753 Ga0157369_10015177
754 Ga0157369_10134192
755 Ga0157369_10206935
756 Ga0157369_10519596
757 Ga0157374_10102971
758 Ga0157378_10236153
759 Ga0157372_10255393
760 Ga0157372_10289697
761 Ga0157372_10295238
762 Ga0157372_10373902
763 Ga0157372_10601423
764 Ga0157372_11273023
765 Ga0157372_11888237
766 Ga0157375_10113447
767 Ga0157375_10838365
768 Ga0163163_10756667
769 Ga0157380_10155857
770 Ga0157380_10610293
771 Ga0157379_10333157
772 Ga0197907_10712769
773 Ga0197907_11264549
774 Ga0206356_10291375
775 Ga0206356_10407665
776 Ga0206356_11346550
777 Ga0206354_10762076
778 Ga0206353_10310209
779 Ga0206353_10701962
780 Ga0206353_10734125
781 Ga0207692_10025141
782 Ga0207699_10119317
783 Ga0207643_10023294
784 Ga0207705_10053829
785 Ga0207705_10119785
786 Ga0207705_10155889
787 Ga0207684_10016922
788 Ga0207684_10225763
789 Ga0207707_10008162
790 Ga0207707_10047516
791 Ga0207695_10191597
792 Ga0207695_10223203
793 Ga0207695_10520123
794 Ga0207693_10012103
795 Ga0207693_10013795
796 Ga0207693_10080403
797 Ga0207663_10559216
798 Ga0207660_10008664
799 Ga0207660_10018115
800 Ga0207660_10277766
801 Ga0207657_10000184
802 Ga0207657_10004061
803 Ga0207657_10038853
804 Ga0207657_10039483
805 Ga0207657_10078456
806 Ga0207657_10240296
807 Ga0207649_10008763
808 Ga0207652_10017450
809 Ga0207652_10034639
810 Ga0207652_10137646
811 Ga0207652_10191329
812 Ga0207652_10205307
813 Ga0207652_10332873
814 Ga0207646_10003800
815 Ga0207646_10219818
816 Ga0207681_10151831
817 Ga0207687_10011724
818 Ga0207687_10236145
819 Ga0207700_10174093
820 Ga0207664_10044998
821 Ga0207664_10048810
822 Ga0207664_10089855
823 Ga0207644_10018222
824 Ga0207690_10081053
825 Ga0207709_10274300
826 Ga0207665_10000716
827 Ga0207691_10131499
828 Ga0207661_10097241
829 Ga0207661_10262872
830 Ga0207661_10321049
831 Ga0207661_10498945
832 Ga0207679_10324606
833 Ga0207667_10047169
834 Ga0207667_10077738
835 Ga0207667_10165234
836 Ga0207667_10231724
837 Ga0207667_10732402
838 Ga0207651_10319669
839 Ga0207712_10276197
840 Ga0207640_10050843
841 Ga0207640_10099704
842 Ga0207640_10575359
843 Ga0207677_10287892
844 Ga0207677_10656001
845 Ga0207639_10108495
846 Ga0207678_10694456
847 Ga0207702_10365915
848 Ga0207702_10530128
849 Ga0207648_10294996
850 Ga0207676_10238658
851 Ga0207674_10004486
852 Ga0207674_10026669
853 Ga0207674_10067234
854 Ga0207674_10279003
855 Ga0207675_100043673
856 Ga0207698_10067872
857 Ga0207698_10318424
858 Ga0207428_10045360
859 Ga0207428_10059012
860 Ga0207428_10276290
861 Ga0268265_10099967
862 Ga0265326_10036091
863 Ga0265319_1003565
864 Ga0265334_10004621
865 Ga0265334_10017295
866 Ga0265334_10061620
867 Ga0265318_10000371
868 Ga0265318_10002892
869 Ga0265323_10009887
870 Ga0265322_10010173
871 Ga0265322_10024287
872 Ga0265338_10009157
873 Ga0265338_10013411
874 Ga0265338_10024297
875 Ga0265338_10034370
876 Ga0265338_10113257
877 Ga0265330_10029455
878 Ga0265332_10010891
879 Ga0265328_10009941
880 Ga0265320_10019757
881 Ga0265325_10133544
882 Ga0265329_10007467
883 Ga0265329_10031404
884 Ga0265329_10035091
885 Ga0265340_10008900
886 Ga0265340_10021922
887 Ga0265340_10029217
888 Ga0265339_10059108
889 Ga0265331_10094552
890 Ga0265327_10027773
891 Ga0265327_10051586
892 Ga0265316_10023432
893 Ga0265316_10041321
894 Ga0307408_100056249
895 Ga0307408_100170435
896 Ga0265313_10044687
897 Ga0265314_10009136
898 Ga0265342_10072503
899 Ga0307405_10578040
900 Ga0307413_10005683
901 Ga0307410_10000555
902 Ga0307410_10217781
903 Ga0307410_10571353
904 Ga0307406_10372247
905 Ga0307407_10002786
906 Ga0307407_10398771
907 Ga0307412_10026318
908 Ga0307409_100006847
909 Ga0307416_100001279
910 Ga0307416_100001663
911 Ga0307414_10113897
912 Ga0307415_100000129
913 Ga0307415_100065693
914 Ga0316583_10134307
915 Ga0373944_0030924
916 Ga0373956_0060824
917 Ga0373960_0056762
918 Ga0373943_0007713
919 Ga0373935_0040924
920 Ga0373933_0374328
921 Ga0373937_0054384
922 Ga0373937_0458032
923 Ga0395899_0008224
924 Ga0395899_0102945
925 Ga0395900_0010485
926 Ga0395900_0022999
927 Ga0395900_0024420
928 Ga0395900_0094672
929 Ga0395900_0109156
930 Ga0395900_0193401
931 Ga0395900_0459434
932 Ga0395900_0494397
933 Ga0395900_0624114
934 Ga0395898_0003445
935 Ga0395898_0025046
936 Ga0395898_0037880
937 Ga0395898_0045937
938 Ga0395898_0062626
939 Ga0395898_0279475
940 Ga0395905_0047148
941 Ga0395905_0055681
942 Ga0395901_0011295
943 Ga0395901_0070137
944 Ga0395901_0077129
945 Ga0395901_0088003
946 Ga0395901_0559808
947 Ga0395901_0834470
948 Ga0436360_0579655
949 Ga0436363_0495592
950 Ga0436362_0502902
951 Ga0439439_0001355
952 Ga0451853_3342724
953 Ga0439433_0006167
954 Ga0439449_0068369
955 Ga0439462_0010842
956 Ga0439446_0010393
957 Ga0439434_0080795
958 Ga0450918_004517
959 Ga0466969_0122752
960 Ga0466972_0122148
961 Ga0466965_0028228
962 Ga0466965_0171162
963 Ga0466965_0228568
964 Ga0466966_0016683
965 Ga0466961_0007855
966 Ga0466961_0255035
967 Ga0466963_0002109
968 Ga0466963_0004267
969 Ga0466963_0013758
970 Ga0466963_0014056
971 Ga0466963_0034515
972 Ga0466963_0039912
973 Ga0466963_0158824
974 Ga0466964_0002138
975 Ga0466971_0000862
976 Ga0466971_0033349
977 Ga0466968_0002523
978 Ga0466968_0011071
979 Ga0466968_0105545
980 Ga0466968_0183470
981 Ga0466957_0008515
982 Ga0466957_0034328
983 Ga0466957_0052784
984 Ga0466957_0328626
985 Ga0466957_0332608
986 Ga0466960_0006924
987 Ga0466960_0251044
988 Ga0466960_0322866
989 Ga0466959_0078060
990 Ga0466959_0132342
991 Ga0466959_0312957
992 Ga0451576_0208274
993 Ga0466958_0007973
994 Ga0466958_0016471
995 Ga0466958_0031354
996 Ga0466958_0046585
997 Ga0466967_0008341
998 Ga0466967_0012314
999 Ga0466967_0030424
1000 Ga0466967_0031994
1001 Ga0466967_0079831
1002 Ga0466967_0102176
1003 Ga0466967_0127929
1004 Ga0466967_0177389
1005 Ga0466967_0214156
1006 Ga0466967_0284769
1007 Ga0466967_0330764
1008 Ga0466967_0353582
1009 Ga0495592_0008456
1010 Ga0495592_0170804
1011 Ga0495603_0282370
1012 Ga0495629_0161232
1013 Ga0495629_0375686
1014 Ga0495651_0034507
1015 Ga0495651_0062521
1016 Ga0495651_0128208
1017 Ga0495653_0013446
1018 Ga0495653_0038992
1019 Ga0495653_0057961
1020 Ga0495653_0071801
1021 Ga0495582_0091143
1022 Ga0495605_0063777
1023 Ga0495664_0248894
1024 Ga0495584_0005105
1025 Ga0495608_0027337
1026 Ga0495608_0029178
1027 Ga0495608_0157281
1028 Ga0495618_0348186
1029 Ga0495628_0055913
1030 Ga0495628_0111636
1031 Ga0495630_0011758
1032 Ga0495630_0025066
1033 Ga0495630_0043469
1034 Ga0495663_0031125
1035 Ga0495642_0078898
1036 Ga0495652_0013274
1037 Ga0495652_0368272
1038 Ga0495586_0202368
1039 Ga0495587_0081700
1040 Ga0495587_0113346
1041 Ga0495609_0105140
1042 Ga0495597_0122608
1043 Ga0495667_0009438
1044 Ga0495667_0011699
1045 Ga0495667_0023938
1046 Ga0495635_0109543
1047 Ga0495635_0113733
1048 Ga0495657_0019019
1049 Ga0495657_0141325
1050 Ga0495599_0421899
1051 Ga0495623_0158204
1052 Ga0495658_0013939
1053 Ga0495613_0102330
1054 Ga0495624_0083182
1055 Ga0495670_0088623
1056 Ga0495600_0048456
1057 Ga0495600_0098104
1058 Ga0495604_0033770
1059 Ga0495604_0035910
1060 Ga0495674_0002574
1061 Ga0495674_0167378
1062 Ga0495674_0214347
1063 Ga0495680_0011824
1064 Ga0495680_0035493
1065 Ga0495675_0007324
1066 Ga0495684_0032341
1067 Ga0495602_0046139
1068 Ga0496100_0023949
1069 Ga0496100_0206860
1070 Ga0496100_0220217
1071 Ga0496101_0016384
1072 Ga0496101_0050034
1073 Ga0496101_0139925
1074 Ga0496101_0302933
1075 Ga0496102_0032493
1076 Ga0496102_0040915
1077 Ga0496102_0255687
1078 Ga0496102_0532631
1079 Ga0496103_0022493
1080 Ga0496103_0212002
1081 Ga0496104_0014337
1082 Ga0496104_0023192
1083 Ga0496104_0034543
1084 Ga0496104_0165961
1085 Ga0496105_0024639
1086 Ga0496105_0059941
1087 Ga0496106_0041603
1088 Ga0496106_0098211
1089 Ga0496106_0364145
1090 Ga0496107_0068309
1091 Ga0496107_0090482
1092 Ga0496107_0360483
1093 Ga0496108_0008904
1094 Ga0496108_0023385
1095 Ga0496108_0036091
1096 Ga0496108_0044737
1097 Ga0496108_0160343
1098 Ga0496109_0023714
1099 Ga0496109_0038452
1100 Ga0496109_0042609
1101 Ga0496109_0125548
1102 Ga0496109_0741738
1103 Ga0496110_0003926
1104 Ga0496110_0060402
1105 Ga0496110_0172034
1106 Ga0496110_0275304
1107 Ga0496111_0019813
1108 Ga0496111_0043464
1109 Ga0496111_0144807
1110 Ga0496111_0399638
1111 Ga0496111_0413283
1112 Ga0496112_0008488
1113 Ga0496112_0010528
1114 Ga0496112_0017043
1115 Ga0496112_0021702
1116 Ga0496112_0062725
1117 Ga0496112_0089016
1118 Ga0496112_0226591
1119 Ga0496112_0510012
1120 Ga0496112_0614095
1121 Ga0496113_0001694
1122 Ga0496113_0169497
1123 Ga0496113_0171905
1124 Ga0496113_0586782
1125 Ga0496114_0004135
1126 Ga0496114_0009742
1127 Ga0496114_0025462
1128 Ga0496114_0054086
1129 Ga0496114_0080222
1130 Ga0496114_0101636
1131 Ga0496114_0172472
1132 Ga0496114_0893996
1133 Ga0496115_0002852
1134 Ga0496115_0201826
1135 Ga0496115_0321419
1136 Ga0501032_0010152
1137 Ga0501034_0717237
1138 Ga0501036_0037785
1139 Ga0501036_0206908
1140 Ga0501038_0296649
1141 Ga0501039_0112239
1142 Ga0501041_0100134
1143 Ga0501041_0170232
1144 Ga0501042_0154539
1145 Ga0501046_0220878
1146 Ga0501048_0064484
1147 Ga0501048_0099121
1148 Ga0501067_0003148
1149 Ga0501067_0004011
1150 Ga0501067_0008858
1151 Ga0501067_0023790
1152 Ga0501067_0106203
1153 Ga0501067_0250341
1154 Ga0501068_0031180
1155 Ga0501068_0064544
1156 Ga0501068_0267481
1157 Ga0501069_0002078
1158 Ga0501069_0079859
1159 Ga0501070_0018029
1160 Ga0501070_0034791
1161 Ga0501070_0212129
1162 Ga0501070_0311733
1163 Ga0501071_0022515
1164 Ga0501071_0128030
1165 Ga0501071_0497396
1166 Ga0501072_0011885
1167 Ga0501072_0046053
1168 Ga0501072_0137520
1169 Ga0501072_0180328
1170 Ga0501073_0025188
1171 Ga0501073_0067898
1172 Ga0501074_0058108
1173 Ga0501076_0213466
1174 Ga0501077_0066124
1175 Ga0501079_0041418
1176 Ga0501079_0209512
1177 Ga0501080_0017150
1178 Ga0501080_0033236
1179 Ga0501080_0230281
1180 Ga0501081_0038310
1181 Ga0501081_0084595
1182 Ga0501083_0000397
1183 Ga0501083_0120882
1184 Ga0501035_0008968
1185 Ga0501044_0072338
1186 Ga0501045_0042028
1187 nmdc:mga05p37_820550_c1
1188 nmdc:mga09592_28873_c1
1189 nmdc:mga08y16_138776_c1
1190 nmdc:mga08y16_46711_c1
1191 nmdc:mga08y16_561838_c1
1192 nmdc:mga08y16_79190_c1
1193 nmdc:mga0n895_155201_c1
1194 nmdc:mga0n895_289619_c1
1195 nmdc:mga0rr50_170286_c1
1196 nmdc:mga0rr50_303665_c1
1197 nmdc:mga08x19_469361_c1
1198 nmdc:mga0a205_130222_c1
1199 nmdc:mga0a205_314031_c1
1200 Ga0495595_0069795
1201 Ga0495595_0076840
1202 Ga0495619_0017945
1203 Ga0495619_0071853
1204 Ga0495619_0108859
1205 Ga0501082_0248871
1206 Ga0501082_0281599
1207 Ga0466962_0000388
1208 Ga0466962_0033848
1209 Ga0530510_0059758
1210 Ga0530510_0122822
1211 Ga0530510_0284883
1212 Ga0530510_0324541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07722

Peptidase_C26

Peptidase C26

12

223

0.97

PF00117

GATase

Glutamine amidotransferase class-I

40

230

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vtv-assembly1.cif.gz_A crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. coli 0.8832 2 214
7d4r-assembly1.cif.gz_A spua native structure 0.8719 1 214
6vtv-assembly1.cif.gz_A crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. coli 0.8715 2 214
7d53-assembly1.cif.gz_B spua mutant - h221n with glu 0.8659 4 214
7d4r-assembly1.cif.gz_A spua native structure 0.8646 1 214
ID Description Score Start End Superfamily
af_O33341_63_305_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9403 1 214 3.40.50.880
af_O33341_63_305_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9318 1 214 3.40.50.880
af_P76038_5_253_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8961 1 214 3.40.50.880
af_P76038_5_253_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8881 1 214 3.40.50.880
af_K7UQ67_12_290_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8571 4 213 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A535D6J7-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9915 1 68 GO:0016787
AF-A0A5S4HKE0-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9841 2 214 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A5D0UBB3-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9819 6 214 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A538L500-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9817 2 214 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A7J9YKA8-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9803 2 212 GO:0005829
GO:0006541
GO:0006598
GO:0033969

Map