F468605

General Info

Members Datasets Scaffolds Average Seq Length
606 378 521 269

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10006445|Ga0265331_100064455
Length 324
Sequence MPRTLQQVLTQDTARLIEALALDASSARIEVQTLLQHVLNVSRAYLLAYPERRLNDSEQIRYAELFQRRLQGEPIAYLLGEREFFGLMFKVTPATLIPRPETELLVELALQHIPSPPAGCAPLATLSPLAGEGGRQTGRGSLFRVLDLGTGSGAIALSIAHARPDIEVVAVDAAIEALAVARENAQRLGTSNVAFVQSDWYTVLAAQRFDLIVSNPPYVAAGDPHLQQGDLRFEPPSALASGNDGLEDIRHIVAEATAYLQPGGWLLLEHGYDQAAQVRDILRQAKFGEVFSAQDLAGIERVSGGRLDLTGFTPLKYPTQSLGI

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
5 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
6 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
7 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
8 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
9 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
10 2547132181 Kosakonia sacchari SP1 Isolate Stem
11 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
12 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
13 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
14 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
15 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
16 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
17 2643221645 Massilia sp. Root351 Isolate Unclassified
18 2643221664 Massilia sp. Root418 Isolate Unclassified
19 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
20 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
21 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
22 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
23 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
24 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
25 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
26 2738541280 Massilia sp. GV090 Isolate Unclassified
27 2738541300 Massilia sp. GV016 Isolate Unclassified
28 2738543013 Variovorax sp. BT01 Isolate Unclassified
29 2738543018 Massilia sp. GV045 Isolate Unclassified
30 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
31 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
32 2738543030 Massilia sp. GV097 Isolate Unclassified
33 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
34 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
35 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
36 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
37 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
38 2842747753 Variovorax sp. R-72060 Isolate Unclassified
39 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
40 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
41 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
42 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
43 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
44 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
45 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
46 2876601092 Pantoea endophytica 596 Isolate Unclassified
47 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
48 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
49 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
50 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
51 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
52 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
53 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
54 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
55 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
56 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
57 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
58 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
59 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
60 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
61 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
62 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
63 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
64 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
65 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
66 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
67 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
68 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
69 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
70 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
71 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
72 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
73 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
74 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
75 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
76 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
77 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
78 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
79 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
80 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
81 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
82 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
83 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
84 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
85 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
86 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
87 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
88 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
89 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
90 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
91 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
92 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
93 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
94 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
95 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
104 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
105 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
209 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
216 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
233 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
272 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
328 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
350 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
358 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
359 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
362 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
365 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
366 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
367 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
368 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
369 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
370 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
371 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
372 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
373 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
374 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
375 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
376 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
377 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
378 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.97
Metatranscriptomes 0
Isolates 14.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 16.67
Nodule 0.83
Rhizoplane 4.13
Rhizosphere 62.71
Stem 0.17
Stem Tuber 0.99
Unclassified 13.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001449 3300001989 Bacteria 8945
2 JGI25158J39367_1001204 3300002739 Bacteria 4656
3 JGI25150J39212_1014055 3300002774 Bacteria 1369
4 JGI25159J45721_1003511 3300002987 Bacteria 5528
5 JGI25159J45721_1007402 3300002987 Bacteria 3152
6 JGI25151J46595_10002117 3300003187 Bacteria 12382
7 JGI25151J46595_10004389 3300003187 Bacteria 7473
8 rootL2_10092461 3300003322 Bacteria 1899
9 rootL2_10237592 3300003322 Bacteria 1191
10 JGI25160J50197_1001730 3300003354 Bacteria 10587
11 JGI25161J50226_1000606 3300003374 Bacteria 14819
12 JGI25161J50226_1001465 3300003374 Bacteria 7065
13 Ga0055538_1000085 3300003751 Bacteria 81616
14 Ga0055539_1000126 3300003752 Bacteria 81616
15 Ga0055533_1000133 3300003756 Bacteria 81616
16 Ga0055525_1000174 3300003759 Bacteria 81616
17 Ga0055526_1001791 3300003771 Bacteria 14891
18 Ga0055526_1004751 3300003771 Bacteria 8049
19 Ga0055526_1006655 3300003771 Bacteria 6205
20 Ga0055526_1008218 3300003771 Bacteria 5247
21 Ga0055526_1010844 3300003771 Bacteria 4189
22 Ga0055537_1004773 3300003773 Bacteria 3792
23 Ga0055537_1015044 3300003773 Bacteria 1374
24 Ga0055524_1002928 3300003775 Bacteria 8517
25 Ga0055524_1012342 3300003775 Bacteria 3282
26 Ga0055524_1015761 3300003775 Bacteria 2741
27 Ga0055536_1000930 3300003781 Bacteria 18850
28 Ga0055534_1001068 3300003784 Bacteria 11830
29 Ga0055534_1001951 3300003784 Bacteria 7570
30 Ga0055534_1003336 3300003784 Bacteria 5084
31 Ga0055528_1006649 3300003790 Bacteria 5218
32 Ga0055530_10008784 3300003791 Bacteria 3989
33 Ga0055530_10024105 3300003791 Bacteria 1734
34 Ga0055531_10012375 3300003794 Bacteria 4020
35 Ga0055541_1000085 3300003841 Bacteria 81616
36 Ga0055543_1000387 3300004625 Bacteria 28496
37 Ga0065165_1002619 3300005262 Bacteria 14667
38 Ga0070683_100432375 3300005329 Bacteria 1256
39 Ga0070690_100255160 3300005330 Bacteria 1242
40 Ga0070690_100356754 3300005330 Bacteria 1063
41 Ga0070661_100021266 3300005344 Bacteria 4632
42 Ga0070671_100145964 3300005355 Bacteria 1997
43 Ga0070667_100027200 3300005367 Bacteria 4759
44 Ga0070709_10363736 3300005434 Bacteria 1072
45 Ga0070713_100003725 3300005436 Bacteria 10091
46 Ga0070711_100071818 3300005439 Unclassified 2441
47 Ga0070678_100184194 3300005456 Bacteria 1712
48 Ga0068867_100150992 3300005459 Bacteria 1825
49 Ga0068867_100459301 3300005459 Bacteria 1087
50 Ga0070685_10244327 3300005466 Bacteria 1186
51 Ga0070704_100201971 3300005549 Bacteria 1605
52 Ga0068855_100450959 3300005563 Bacteria 1404
53 Ga0070664_100122852 3300005564 Bacteria 2275
54 Ga0068857_100362807 3300005577 Bacteria 1343
55 Ga0070702_100267263 3300005615 Bacteria 1168
56 Ga0068852_100012173 3300005616 Bacteria 6517
57 Ga0068858_100443357 3300005842 Bacteria 1251
58 Ga0068862_100174950 3300005844 Bacteria 1924
59 Ga0081455_10005392 3300005937 Bacteria 14037
60 Ga0075364_10001253 3300006051 Bacteria 13636
61 Ga0075364_10159068 3300006051 Bacteria 1524
62 Ga0075432_10048059 3300006058 Bacteria 1500
63 Ga0075366_10012944 3300006195 Bacteria 4741
64 Ga0075366_10092392 3300006195 Bacteria 1813
65 Ga0075366_10094626 3300006195 Bacteria 1791
66 Ga0075370_10223415 3300006353 Bacteria 1113
67 Ga0075370_10273172 3300006353 Bacteria 1003
68 Ga0099826_10000024 3300006948 Bacteria 148974
69 Ga0105251_10001860 3300009011 Bacteria 17339
70 Ga0105251_10006802 3300009011 Bacteria 7211
71 Ga0105251_10013135 3300009011 Bacteria 4647
72 Ga0105251_10029983 3300009011 Bacteria 2735
73 Ga0105251_10118358 3300009011 Bacteria 1204
74 Ga0105251_10130498 3300009011 Bacteria 1139
75 Ga0105244_10002459 3300009036 Bacteria 13950
76 Ga0105244_10030322 3300009036 Bacteria 2878
77 Ga0105244_10050529 3300009036 Bacteria 2121
78 Ga0105244_10050822 3300009036 Bacteria 2114
79 Ga0105244_10052701 3300009036 Bacteria 2070
80 Ga0105250_10025778 3300009092 Bacteria 2369
81 Ga0105240_10193519 3300009093 Bacteria 2390
82 Ga0105245_10334489 3300009098 Bacteria 1496
83 Ga0105243_10001514 3300009148 Bacteria 20298
84 Ga0105242_10040170 3300009176 Bacteria 3769
85 Ga0105242_10156295 3300009176 Bacteria 1992
86 Ga0105248_10168846 3300009177 Bacteria 2466
87 Ga0105248_10402940 3300009177 Bacteria 1540
88 Ga0105237_10329849 3300009545 Bacteria 1530
89 Ga0105237_10389689 3300009545 Bacteria 1398
90 Ga0105249_10029317 3300009553 Bacteria 4970
91 Ga0105239_10474238 3300010375 Bacteria 1421
92 Ga0157373_10001293 3300013100 Bacteria 19108
93 Ga0157371_10000646 3300013102 Bacteria 41280
94 Ga0157371_10013316 3300013102 Bacteria 6254
95 Ga0157370_10003676 3300013104 Bacteria 17919
96 Ga0157369_10041346 3300013105 Bacteria 5032
97 Ga0157369_10075469 3300013105 Bacteria 3615
98 Ga0157374_10087383 3300013296 Bacteria 2967
99 Ga0163162_10000877 3300013306 Bacteria 28017
100 Ga0163162_10025423 3300013306 Bacteria 5850
101 Ga0157372_10158180 3300013307 Bacteria 2618
102 Ga0157375_10000712 3300013308 Bacteria 29330
103 Ga0157375_10024508 3300013308 Bacteria 5586
104 Ga0157376_10001938 3300014969 Bacteria 13825
105 Ga0182006_1057689 3300015261 Bacteria 1475
106 Ga0163161_10173506 3300017792 Bacteria 1650
107 Ga0213872_10002585 3300021361 Bacteria 10537
108 Ga0213872_10005344 3300021361 Bacteria 6628
109 Ga0209436_101442 3300025208 Bacteria 8316
110 Ga0209436_101963 3300025208 Bacteria 6584
111 Ga0209784_100021 3300025224 Bacteria 408534
112 Ga0209566_100039 3300025225 Bacteria 303368
113 Ga0209674_100036 3300025226 Bacteria 408534
114 Ga0209563_100040 3300025230 Bacteria 408534
115 Ga0207425_1002181 3300025245 Bacteria 7126
116 Ga0209677_100023 3300025253 Bacteria 408534
117 Ga0209565_1000261 3300025263 Bacteria 55346
118 Ga0209565_1000875 3300025263 Bacteria 16585
119 Ga0209565_1000887 3300025263 Bacteria 16310
120 Ga0209565_1002237 3300025263 Bacteria 7216
121 Ga0209565_1005710 3300025263 Bacteria 3586
122 Ga0209565_1009870 3300025263 Bacteria 2392
123 Ga0209673_1010896 3300025273 Bacteria 3795
124 Ga0209673_1019523 3300025273 Bacteria 2430
125 Ga0209130_1000740 3300025284 Bacteria 28631
126 Ga0209130_1002172 3300025284 Bacteria 10338
127 Ga0209130_1002173 3300025284 Bacteria 10338
128 Ga0209675_1000156 3300025291 Bacteria 88813
129 Ga0209675_1001351 3300025291 Bacteria 14481
130 Ga0209675_1006893 3300025291 Bacteria 4467
131 Ga0209675_1009127 3300025291 Bacteria 3537
132 Ga0209675_1016789 3300025291 Bacteria 2117
133 Ga0209676_1000364 3300025292 Bacteria 85375
134 Ga0209676_1006762 3300025292 Bacteria 5573
135 Ga0209025_1000417 3300025294 Bacteria 85342
136 Ga0209025_1000473 3300025294 Bacteria 78078
137 Ga0209025_1000516 3300025294 Bacteria 73496
138 Ga0209025_1000885 3300025294 Bacteria 46908
139 Ga0209564_1000067 3300025295 Bacteria 311242
140 Ga0209564_1000611 3300025295 Bacteria 55354
141 Ga0209564_1000658 3300025295 Bacteria 51441
142 Ga0209564_1000709 3300025295 Bacteria 48568
143 Ga0209564_1003115 3300025295 Bacteria 11707
144 Ga0209758_1026126 3300025297 Bacteria 2538
145 Ga0209050_1000040 3300025298 Bacteria 408492
146 Ga0209050_1000365 3300025298 Bacteria 86866
147 Ga0209050_1005050 3300025298 Bacteria 8542
148 Ga0209256_1001277 3300025299 Bacteria 27307
149 Ga0209256_1001546 3300025299 Bacteria 22955
150 Ga0209256_1001662 3300025299 Bacteria 21619
151 Ga0209256_1004683 3300025299 Bacteria 8390
152 Ga0207426_1005381 3300025302 Bacteria 5867
153 Ga0209051_1026012 3300025303 Bacteria 2368
154 Ga0209257_1000054 3300025304 Bacteria 416957
155 Ga0207696_1000062 3300025711 Bacteria 239603
156 Ga0207696_1027099 3300025711 Bacteria 1769
157 Ga0207655_1008198 3300025728 Bacteria 6665
158 Ga0207713_1005377 3300025735 Bacteria 8033
159 Ga0207713_1073427 3300025735 Bacteria 1255
160 Ga0207680_10034651 3300025903 Bacteria 2890
161 Ga0207680_10057067 3300025903 Bacteria 2361
162 Ga0207647_10012034 3300025904 Bacteria 6038
163 Ga0207699_10179236 3300025906 Bacteria 1423
164 Ga0207699_10188998 3300025906 Bacteria 1389
165 Ga0207705_10131665 3300025909 Bacteria 1862
166 Ga0207654_10080223 3300025911 Bacteria 1962
167 Ga0207695_10075649 3300025913 Bacteria 3425
168 Ga0207663_10090009 3300025916 Unclassified 2034
169 Ga0207649_10175520 3300025920 Bacteria 1496
170 Ga0207681_10167718 3300025923 Bacteria 1661
171 Ga0207659_10330526 3300025926 Bacteria 1260
172 Ga0207700_10006080 3300025928 Bacteria 7271
173 Ga0207644_10308606 3300025931 Bacteria 1277
174 Ga0207690_10050490 3300025932 Bacteria 2777
175 Ga0207686_10069512 3300025934 Bacteria 2259
176 Ga0207709_10000579 3300025935 Bacteria 30727
177 Ga0207711_10236639 3300025941 Bacteria 1674
178 Ga0207661_10305054 3300025944 Bacteria 1428
179 Ga0207679_10151939 3300025945 Bacteria 1886
180 Ga0207667_10062473 3300025949 Bacteria 3894
181 Ga0207667_10196800 3300025949 Bacteria 2068
182 Ga0207668_10132781 3300025972 Bacteria 1903
183 Ga0207658_10124430 3300025986 Bacteria 2061
184 Ga0207658_10346976 3300025986 Bacteria 1292
185 Ga0207678_10041247 3300026067 Bacteria 4002
186 Ga0207648_10007928 3300026089 Bacteria 10354
187 Ga0207676_10236376 3300026095 Bacteria 1636
188 Ga0207674_10003476 3300026116 Bacteria 19265
189 Ga0207674_10365303 3300026116 Bacteria 1395
190 Ga0207675_100244032 3300026118 Bacteria 1736
191 Ga0207683_10021386 3300026121 Bacteria 5538
192 Ga0207683_10199876 3300026121 Bacteria 1816
193 Ga0207698_10051721 3300026142 Bacteria 3142
194 Ga0209282_1000032 3300027666 Bacteria 149218
195 Ga0268266_10185254 3300028379 Bacteria 1898
196 Ga0265336_10000185 3300028666 Bacteria 43870
197 Ga0307515_10000354 3300028794 Bacteria 112621
198 Ga0307515_10007796 3300028794 Bacteria 21069
199 Ga0307515_10009311 3300028794 Bacteria 19001
200 Ga0265324_10000011 3300029957 Bacteria 218521
201 Ga0265324_10048255 3300029957 Bacteria 1464
202 Ga0307512_10113086 3300030522 Bacteria 1778
203 Ga0316181_1030137 3300030744 Bacteria 3669
204 Ga0265328_10000016 3300031239 Bacteria 132959
205 Ga0265325_10000447 3300031241 Bacteria 29700
206 Ga0265331_10006445 3300031250 Bacteria 6935
207 Ga0265327_10004511 3300031251 Bacteria 12286
208 Ga0265327_10053308 3300031251 Bacteria 2100
209 Ga0307513_10010732 3300031456 Bacteria 11453
210 Ga0307509_10024723 3300031507 Bacteria 6722
211 Ga0307408_100003180 3300031548 Bacteria 11317
212 Ga0307408_100011951 3300031548 Bacteria 5745
213 Ga0307408_100273235 3300031548 Bacteria 1404
214 Ga0307408_100464469 3300031548 Bacteria 1101
215 Ga0307408_100469253 3300031548 Bacteria 1095
216 Ga0307508_10000043 3300031616 Bacteria 143889
217 Ga0307514_10078874 3300031649 Bacteria 2443
218 Ga0307514_10086174 3300031649 Bacteria 2306
219 Ga0316579_10079847 3300031691 Bacteria 1557
220 Ga0265314_10018536 3300031711 Bacteria 5424
221 Ga0265314_10119173 3300031711 Bacteria 1664
222 Ga0316576_10026359 3300031727 Bacteria 4079
223 Ga0307516_10013442 3300031730 Bacteria 8723
224 Ga0307406_10003957 3300031901 Bacteria 8050
225 Ga0307412_10000078 3300031911 Bacteria 94880
226 Ga0307507_10061383 3300033179 Bacteria 3500
227 Ga0373959_0039794 3300034820 Bacteria 982
228 Ga0373923_0100472 3300035111 Bacteria 1275
229 Ga0373941_0008136 3300035115 Bacteria 2596
230 Ga0373960_0018787 3300035121 Bacteria 1808
231 Ga0373955_0002705 3300035172 Bacteria 7765
232 Ga0373961_0008029 3300035241 Bacteria 2563
233 Ga0373931_0007581 3300035691 Bacteria 5113
234 Ga0373933_0144079 3300035724 Bacteria 1506
235 Ga0373937_0128978 3300036401 Bacteria 2361
236 Ga0316582_0193553 3300036647 Bacteria 1386
237 Ga0436360_0106361 3300039438 Bacteria 3201
238 Ga0436361_0276775 3300039447 Bacteria 18967
239 Ga0436361_0432344 3300039447 Bacteria 27994
240 Ga0439465_0008062 3300041413 Bacteria 3332
241 Ga0451793_0774530 3300041452 Bacteria 1639
242 Ga0451807_1996062 3300041486 Bacteria 1133
243 Ga0439449_0000072 3300042007 Bacteria 32024
244 Ga0439452_000001 3300042010 Bacteria 1725439
245 Ga0450911_009727 3300042115 Bacteria 1342
246 Ga0451577_0098152 3300042876 Bacteria 2616
247 Ga0451577_0417004 3300042876 Bacteria 1219
248 Ga0466972_0008985 3300044658 Bacteria 5016
249 Ga0466972_0056855 3300044658 Bacteria 1880
250 Ga0453683_0163532 3300044673 Bacteria 1409
251 Ga0466965_0002392 3300044683 Bacteria 7954
252 Ga0466964_0036475 3300044706 Bacteria 1971
253 Ga0453684_0001224 3300044712 Bacteria 78768
254 Ga0453684_0005573 3300044712 Bacteria 24814
255 Ga0466968_0004690 3300044735 Bacteria 5122
256 Ga0451576_0000677 3300045051 Bacteria 69349
257 Ga0451576_0009742 3300045051 Bacteria 11110
258 Ga0451576_0038638 3300045051 Bacteria 5052
259 Ga0451576_0272612 3300045051 Bacteria 1769
260 Ga0451576_0351515 3300045051 Bacteria 1543
261 Ga0495617_004710 3300046452 Bacteria 4934
262 Ga0495590_0006781 3300046457 Bacteria 4451
263 Ga0495590_0007599 3300046457 Bacteria 4168
264 Ga0495590_0011466 3300046457 Bacteria 3314
265 Ga0495591_000007 3300046458 Bacteria 366385
266 Ga0495638_0000875 3300046460 Bacteria 31213
267 Ga0495638_0084453 3300046460 Bacteria 1921
268 Ga0495653_0023473 3300046463 Bacteria 4982
269 Ga0495650_0019444 3300046471 Bacteria 3342
270 Ga0495582_0000964 3300046473 Bacteria 16070
271 Ga0495605_0003074 3300046474 Bacteria 10072
272 Ga0495605_0005630 3300046474 Bacteria 7279
273 Ga0495605_0027728 3300046474 Bacteria 2931
274 Ga0495584_0005537 3300046491 Bacteria 6685
275 Ga0495584_0007112 3300046491 Bacteria 5847
276 Ga0495584_0008704 3300046491 Bacteria 5248
277 Ga0495584_0036117 3300046491 Bacteria 2496
278 Ga0495584_0040001 3300046491 Bacteria 2368
279 Ga0495584_0047766 3300046491 Bacteria 2158
280 Ga0495584_0081926 3300046491 Bacteria 1624
281 Ga0495585_0003733 3300046492 Bacteria 10172
282 Ga0495585_0011370 3300046492 Bacteria 5267
283 Ga0495585_0016609 3300046492 Bacteria 4265
284 Ga0495585_0021113 3300046492 Bacteria 3740
285 Ga0495585_0032238 3300046492 Bacteria 2968
286 Ga0495585_0044887 3300046492 Bacteria 2468
287 Ga0495585_0047179 3300046492 Bacteria 2399
288 Ga0495596_0000367 3300046500 Bacteria 29049
289 Ga0495596_0005631 3300046500 Bacteria 5884
290 Ga0495596_0016351 3300046500 Bacteria 3084
291 Ga0495607_0002495 3300046501 Bacteria 14909
292 Ga0495607_0023352 3300046501 Bacteria 3872
293 Ga0495607_0032627 3300046501 Bacteria 3176
294 Ga0495607_0069310 3300046501 Bacteria 1974
295 Ga0495583_0000099 3300046506 Bacteria 148167
296 Ga0495583_0021534 3300046506 Bacteria 3314
297 Ga0495583_0082262 3300046506 Bacteria 1397
298 Ga0495606_0000314 3300046507 Bacteria 83573
299 Ga0495606_0082035 3300046507 Bacteria 2003
300 Ga0495610_0001046 3300046512 Bacteria 25419
301 Ga0495610_0082249 3300046512 Bacteria 1476
302 Ga0495616_0007675 3300046513 Bacteria 6449
303 Ga0495616_0080131 3300046513 Bacteria 1564
304 Ga0495620_0035857 3300046515 Bacteria 2226
305 Ga0495628_0033791 3300046516 Bacteria 4119
306 Ga0495631_0003567 3300046518 Bacteria 8502
307 Ga0495631_0036378 3300046518 Bacteria 2198
308 Ga0495631_0115215 3300046518 Bacteria 1155
309 Ga0495643_0002757 3300046522 Bacteria 13464
310 Ga0495643_0009145 3300046522 Bacteria 6192
311 Ga0495643_0034891 3300046522 Bacteria 2772
312 Ga0495644_0001980 3300046523 Bacteria 8219
313 Ga0495644_0054541 3300046523 Bacteria 1501
314 Ga0495648_0002571 3300046524 Bacteria 16637
315 Ga0495648_0013334 3300046524 Bacteria 6083
316 Ga0495648_0015309 3300046524 Bacteria 5576
317 Ga0495648_0054436 3300046524 Bacteria 2417
318 Ga0495663_0014702 3300046525 Bacteria 2196
319 Ga0495663_0046829 3300046525 Bacteria 1329
320 Ga0495666_0001332 3300046526 Bacteria 11956
321 Ga0495642_0003493 3300046528 Bacteria 6194
322 Ga0495642_0016071 3300046528 Bacteria 2914
323 Ga0495642_0026488 3300046528 Bacteria 2303
324 Ga0495642_0066718 3300046528 Bacteria 1500
325 Ga0495652_0052830 3300046529 Bacteria 3464
326 Ga0495654_0000007 3300046530 Bacteria 403529
327 Ga0495654_0003376 3300046530 Bacteria 9833
328 Ga0495654_0037963 3300046530 Bacteria 2411
329 Ga0495665_0015305 3300046531 Bacteria 4132
330 Ga0495640_0039917 3300046533 Bacteria 3290
331 Ga0495609_0009946 3300046538 Bacteria 4580
332 Ga0495609_0011758 3300046538 Bacteria 4162
333 Ga0495609_0024920 3300046538 Bacteria 2743
334 Ga0495609_0047481 3300046538 Bacteria 1921
335 Ga0495609_0053503 3300046538 Bacteria 1794
336 Ga0495597_0000372 3300046542 Bacteria 39468
337 Ga0495597_0002800 3300046542 Bacteria 10714
338 Ga0495597_0014646 3300046542 Bacteria 3730
339 Ga0495597_0015156 3300046542 Bacteria 3653
340 Ga0495597_0031013 3300046542 Bacteria 2434
341 Ga0495645_0003820 3300046543 Bacteria 10243
342 Ga0495622_0025750 3300046557 Bacteria 2747
343 Ga0495633_0002768 3300046558 Bacteria 12125
344 Ga0495633_0053185 3300046558 Bacteria 1906
345 Ga0495633_0075337 3300046558 Bacteria 1571
346 Ga0495667_0065328 3300046559 Bacteria 2380
347 Ga0495668_0005614 3300046616 Bacteria 8435
348 Ga0495668_0010491 3300046616 Bacteria 5604
349 Ga0495611_0003774 3300046648 Bacteria 6615
350 Ga0495611_0009669 3300046648 Bacteria 4074
351 Ga0495611_0011658 3300046648 Bacteria 3729
352 Ga0495625_0003495 3300046660 Bacteria 15582
353 Ga0495625_0004095 3300046660 Bacteria 13921
354 Ga0495625_0189081 3300046660 Bacteria 1365
355 Ga0495625_0277827 3300046660 Bacteria 1078
356 Ga0495625_0279132 3300046660 Bacteria 1075
357 Ga0495659_0000072 3300046664 Bacteria 42932
358 Ga0495659_0000462 3300046664 Bacteria 15161
359 Ga0495661_0002151 3300046665 Bacteria 15415
360 Ga0495661_0023405 3300046665 Bacteria 4010
361 Ga0495661_0029346 3300046665 Bacteria 3511
362 Ga0495661_0051408 3300046665 Bacteria 2488
363 Ga0495661_0154952 3300046665 Bacteria 1234
364 Ga0495661_0234909 3300046665 Bacteria 943
365 Ga0495623_0135123 3300046679 Bacteria 1472
366 Ga0495623_0150933 3300046679 Bacteria 1373
367 Ga0495623_0242116 3300046679 Bacteria 1018
368 Ga0495669_0000061 3300046684 Bacteria 72014
369 Ga0495669_0019302 3300046684 Bacteria 2941
370 Ga0495670_0000980 3300046691 Bacteria 13848
371 Ga0495670_0103141 3300046691 Bacteria 1470
372 Ga0495670_0298923 3300046691 Bacteria 862
373 Ga0495671_0000281 3300046692 Bacteria 42628
374 Ga0495671_0002714 3300046692 Bacteria 11077
375 Ga0495671_0109434 3300046692 Bacteria 1349
376 Ga0495671_0198393 3300046692 Bacteria 973
377 Ga0495649_0005692 3300046694 Bacteria 7865
378 Ga0495649_0006153 3300046694 Bacteria 7498
379 Ga0495649_0010368 3300046694 Bacteria 5501
380 Ga0495589_0001288 3300046794 Bacteria 14823
381 Ga0495589_0007740 3300046794 Bacteria 5623
382 Ga0495589_0075772 3300046794 Bacteria 1640
383 Ga0495660_0000355 3300046810 Bacteria 40502
384 Ga0495660_0099940 3300046810 Bacteria 1495
385 Ga0495581_0003008 3300047315 Bacteria 9653
386 Ga0495636_0015212 3300047318 Bacteria 3066
387 Ga0495636_0022380 3300047318 Bacteria 2554
388 Ga0495636_0054269 3300047318 Bacteria 1684
389 Ga0495636_0057185 3300047318 Bacteria 1642
390 Ga0495672_0000026 3300047320 Bacteria 340319
391 Ga0495672_0008932 3300047320 Bacteria 7318
392 Ga0495672_0024235 3300047320 Bacteria 3913
393 Ga0495672_0153549 3300047320 Bacteria 1191
394 Ga0495676_0000025 3300047321 Bacteria 149350
395 Ga0495680_0168764 3300047322 Bacteria 1585
396 Ga0495683_0028552 3300047323 Bacteria 2851
397 Ga0495687_000117 3300047443 Bacteria 122591
398 Ga0495687_000314 3300047443 Bacteria 63156
399 Ga0495687_000687 3300047443 Bacteria 38367
400 Ga0495687_032347 3300047443 Bacteria 2389
401 Ga0495675_0117936 3300047444 Bacteria 1654
402 Ga0495677_0008307 3300047445 Bacteria 3857
403 Ga0495677_0011569 3300047445 Bacteria 3226
404 Ga0495677_0033900 3300047445 Bacteria 1861
405 Ga0495685_000008 3300047447 Bacteria 95629
406 Ga0495685_015798 3300047447 Bacteria 2578
407 Ga0495685_053060 3300047447 Bacteria 1373
408 Ga0495673_0068892 3300047469 Bacteria 1494
409 Ga0495681_0002626 3300047470 Bacteria 12772
410 Ga0495681_0006316 3300047470 Bacteria 7801
411 Ga0495681_0035561 3300047470 Bacteria 2472
412 Ga0495681_0068879 3300047470 Unclassified 1609
413 Ga0495684_0064468 3300047471 Bacteria 2785
414 Ga0495686_0015707 3300047472 Bacteria 5159
415 Ga0495593_0021020 3300047673 Bacteria 3649
416 Ga0495614_0006276 3300048089 Bacteria 5339
417 Ga0496100_0263304 3300048903 Bacteria 1279
418 Ga0496101_0000093 3300048904 Bacteria 95734
419 Ga0496102_0000024 3300048905 Bacteria 227873
420 Ga0496102_0006320 3300048905 Bacteria 10101
421 Ga0496102_0095687 3300048905 Bacteria 2753
422 Ga0496103_0208828 3300048906 Bacteria 1256
423 Ga0496104_0000365 3300048907 Bacteria 40128
424 Ga0496104_0174552 3300048907 Bacteria 2060
425 Ga0496104_0382911 3300048907 Bacteria 1319
426 Ga0496105_0000048 3300048908 Bacteria 96832
427 Ga0496106_0028887 3300048909 Bacteria 4133
428 Ga0496106_0118047 3300048909 Bacteria 2071
429 Ga0496107_0047525 3300048910 Bacteria 3090
430 Ga0496110_0001900 3300048913 Bacteria 15447
431 Ga0496110_0326130 3300048913 Bacteria 1398
432 Ga0496111_0063039 3300048914 Bacteria 2688
433 Ga0496111_0105745 3300048914 Bacteria 2071
434 Ga0496115_0033943 3300048918 Bacteria 4032
435 Ga0496116_0000300 3300048919 Bacteria 83621
436 Ga0496116_0001249 3300048919 Bacteria 29528
437 Ga0496116_0003969 3300048919 Bacteria 14365
438 Ga0496116_0008151 3300048919 Bacteria 9150
439 Ga0496116_0010398 3300048919 Bacteria 7802
440 Ga0496116_0088929 3300048919 Bacteria 1886
441 Ga0496117_0000388 3300048920 Bacteria 75480
442 Ga0496117_0158579 3300048920 Bacteria 1329
443 Ga0496117_0176194 3300048920 Bacteria 1235
444 Ga0496117_0193438 3300048920 Bacteria 1156
445 Ga0496118_0007368 3300048921 Bacteria 11689
446 Ga0496118_0013709 3300048921 Bacteria 7648
447 Ga0496119_0017822 3300048922 Bacteria 5323
448 Ga0496119_0046138 3300048922 Bacteria 2725
449 Ga0496120_0001787 3300048923 Bacteria 24170
450 Ga0496120_0013447 3300048923 Bacteria 5507
451 Ga0496121_0000153 3300048924 Bacteria 150635
452 Ga0496121_0008698 3300048924 Bacteria 11854
453 Ga0496122_0000186 3300048925 Bacteria 144012
454 Ga0496122_0003402 3300048925 Bacteria 20931
455 Ga0496122_0006111 3300048925 Bacteria 14019
456 Ga0496122_0112423 3300048925 Bacteria 1783
457 Ga0496123_0000162 3300048926 Bacteria 134316
458 Ga0496123_0000677 3300048926 Bacteria 56286
459 Ga0496123_0004401 3300048926 Bacteria 14854
460 Ga0496123_0031755 3300048926 Bacteria 3835
461 Ga0496124_0029422 3300048927 Bacteria 4895
462 Ga0496124_0052851 3300048927 Bacteria 3449
463 Ga0496124_0089878 3300048927 Bacteria 2506
464 Ga0496124_0165467 3300048927 Bacteria 1719
465 Ga0496125_0000023 3300048928 Bacteria 449042
466 Ga0496125_0031606 3300048928 Bacteria 4715
467 Ga0496125_0209145 3300048928 Bacteria 1268
468 Ga0496126_0114500 3300048929 Bacteria 2346
469 Ga0496126_0364036 3300048929 Bacteria 1180
470 Ga0495678_012076 3300049459 Bacteria 4105
471 Ga0495682_0002892 3300049460 Bacteria 7893
472 Ga0501032_0012041 3300049569 Bacteria 6193
473 Ga0501032_0146683 3300049569 Bacteria 1553
474 Ga0501033_0085641 3300049570 Bacteria 2308
475 Ga0501034_0000134 3300049571 Bacteria 137745
476 Ga0501034_0042742 3300049571 Bacteria 4587
477 Ga0501034_0153173 3300049571 Bacteria 2280
478 Ga0501034_0249535 3300049571 Bacteria 1719
479 Ga0501036_0034453 3300049572 Bacteria 4283
480 Ga0501037_0001580 3300049573 Bacteria 16609
481 Ga0501038_0009408 3300049574 Bacteria 8967
482 Ga0501038_0087957 3300049574 Bacteria 2608
483 Ga0501039_0069109 3300049575 Bacteria 2743
484 Ga0501040_0015365 3300049576 Bacteria 5063
485 Ga0501043_0103702 3300049579 Bacteria 2234
486 Ga0501047_0269947 3300049581 Bacteria 1547
487 Ga0501047_0294985 3300049581 Bacteria 1465
488 Ga0501048_0260861 3300049582 Bacteria 1231
489 Ga0501067_0030877 3300049583 Bacteria 2973
490 Ga0501068_0012186 3300049584 Bacteria 4863
491 Ga0501070_0363172 3300049586 Bacteria 1174
492 Ga0501071_0000860 3300049587 Bacteria 16338
493 Ga0501072_0013858 3300049588 Bacteria 6177
494 Ga0501075_0010964 3300049591 Bacteria 6393
495 Ga0501080_0000881 3300049742 Bacteria 24572
496 Ga0501080_0014560 3300049742 Bacteria 7244
497 Ga0501081_0028006 3300049743 Bacteria 3800
498 Ga0501081_0053143 3300049743 Bacteria 2797
499 Ga0501083_0222588 3300049744 Bacteria 1229
500 Ga0501280_002240 3300049776 Bacteria 3283
501 Ga0501282_001460 3300049778 Bacteria 2624
502 Ga0501035_0073462 3300049822 Bacteria 3026
503 Ga0501035_0138256 3300049822 Bacteria 2119
504 Ga0501045_0098294 3300049824 Bacteria 2166
505 nmdc:mga00v17_225_c1 3300050491 Bacteria 33638
506 nmdc:mga00v17_34083_c1 3300050491 Bacteria 3022
507 nmdc:mga00v17_70192_c1 3300050491 Bacteria 2169
508 nmdc:mga0k408_232383_c1 3300050493 Bacteria 1101
509 nmdc:mga0k408_251353_c1 3300050493 Bacteria 1056
510 nmdc:mga0k408_9268_c2 3300050493 Bacteria 4067
511 nmdc:mga06z11_117453_c1 3300050494 Bacteria 1480
512 nmdc:mga07m45_186317_c1 3300050496 Bacteria 1207
513 nmdc:mga07m45_202878_c1 3300050496 Bacteria 1154
514 Ga0495601_0045857 3300053077 Bacteria 2750
515 Ga0500635_0113458 3300053080 Bacteria 1009
516 Ga0500559_0005631 3300053136 Bacteria 5739
517 Ga0500622_0000011 3300053156 Bacteria 386096
518 Ga0500645_001181 3300053730 Bacteria 13913
519 Ga0500587_004985 3300053739 Bacteria 1806
520 Ga0501084_0162833 3300054114 Bacteria 1882
521 Ga0530510_0396967 3300061734 Bacteria 1039

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025294 Ga0209025_1000473 Ga0209025_100047338 221
2 3300049571 Ga0501034_0000134 Ga0501034_0000134_100047_100919 221
3 3300031548 Ga0307408_100469253 Ga0307408_1004692531 224
4 3300031901 Ga0307406_10003957 Ga0307406_100039573 224
5 3300053136 Ga0500559_0005631 Ga0500559_0005631_4650_5495 225
6 3300047318 Ga0495636_0015212 Ga0495636_0015212_1048_1941 229
7 3300006948 Ga0099826_10000024 Ga0099826_10000024128 230
8 3300009011 Ga0105251_10013135 Ga0105251_100131353 230
9 3300027666 Ga0209282_1000032 Ga0209282_100003238 230
10 3300046474 Ga0495605_0027728 Ga0495605_0027728_1586_2470 230
11 3300046491 Ga0495584_0036117 Ga0495584_0036117_1033_1917 230
12 3300046500 Ga0495596_0000367 Ga0495596_0000367_2549_3433 230
13 3300046501 Ga0495607_0023352 Ga0495607_0023352_1540_2424 230
14 3300046512 Ga0495610_0001046 Ga0495610_0001046_15851_16735 230
15 3300046524 Ga0495648_0054436 Ga0495648_0054436_839_1723 230
16 3300046528 Ga0495642_0066718 Ga0495642_0066718_296_1180 230
17 3300046542 Ga0495597_0015156 Ga0495597_0015156_601_1485 230
18 3300046665 Ga0495661_0051408 Ga0495661_0051408_37_921 230
19 3300046694 Ga0495649_0006153 Ga0495649_0006153_1704_2588 230
20 3300046810 Ga0495660_0099940 Ga0495660_0099940_202_1086 230
21 3300047320 Ga0495672_0024235 Ga0495672_0024235_826_1710 230
22 3300047447 Ga0495685_015798 Ga0495685_015798_863_1747 230
23 3300048919 Ga0496116_0010398 Ga0496116_0010398_4494_5378 230
24 3300048924 Ga0496121_0008698 Ga0496121_0008698_2584_3468 230
25 3300048925 Ga0496122_0003402 Ga0496122_0003402_14146_15030 230
26 3300048926 Ga0496123_0004401 Ga0496123_0004401_5831_6715 230
27 3300048920 Ga0496117_0176194 Ga0496117_0176194_177_1010 234
28 3300048921 Ga0496118_0013709 Ga0496118_0013709_6042_6875 234
29 3300048922 Ga0496119_0046138 Ga0496119_0046138_162_995 234
30 3300048923 Ga0496120_0013447 Ga0496120_0013447_836_1669 234
31 3300048924 Ga0496121_0000153 Ga0496121_0000153_98842_99675 234
32 3300048925 Ga0496122_0112423 Ga0496122_0112423_59_892 234
33 3300048926 Ga0496123_0031755 Ga0496123_0031755_2764_3597 234
34 3300048928 Ga0496125_0000023 Ga0496125_0000023_107010_107843 234
35 3300048929 Ga0496126_0364036 Ga0496126_0364036_103_936 234
36 3300031911 Ga0307412_10000078 Ga0307412_1000007875 236
37 3300050491 nmdc:mga00v17_70192_c1 nmdc:mga00v17_70192_c1_1369_2124 238
38 3300005844 Ga0068862_100174950 Ga0068862_1001749502 239
39 3300025263 Ga0209565_1002237 Ga0209565_10022376 239
40 3300025291 Ga0209675_1009127 Ga0209675_10091275 239
41 3300025294 Ga0209025_1000885 Ga0209025_100088538 239
42 3300025299 Ga0209256_1001277 Ga0209256_100127717 239
43 3300025932 Ga0207690_10050490 Ga0207690_100504903 239
44 3300030744 Ga0316181_1030137 Ga0316181_10301372 239
45 3300034820 Ga0373959_0039794 Ga0373959_0039794_19_807 239
46 3300035115 Ga0373941_0008136 Ga0373941_0008136_1794_2582 239
47 3300035121 Ga0373960_0018787 Ga0373960_0018787_962_1750 239
48 3300035691 Ga0373931_0007581 Ga0373931_0007581_2636_3424 239
49 3300048919 Ga0496116_0003969 Ga0496116_0003969_12038_12895 239
50 3300003187 JGI25151J46595_10002117 JGI25151J46595_100021173 240
51 3300003771 Ga0055526_1008218 Ga0055526_10082186 240
52 3300003771 Ga0055526_1010844 Ga0055526_10108441 240
53 3300003781 Ga0055536_1000930 Ga0055536_10009306 240
54 3300003784 Ga0055534_1001068 Ga0055534_100106811 240
55 3300005842 Ga0068858_100443357 Ga0068858_1004433572 240
56 3300025291 Ga0209675_1000156 Ga0209675_100015634 240
57 3300025292 Ga0209676_1000364 Ga0209676_100036428 240
58 3300025294 Ga0209025_1000417 Ga0209025_100041728 240
59 3300025295 Ga0209564_1000658 Ga0209564_100065823 240
60 3300025295 Ga0209564_1000709 Ga0209564_100070927 240
61 3300025903 Ga0207680_10057067 Ga0207680_100570672 240
62 3300025904 Ga0207647_10012034 Ga0207647_100120342 240
63 3300025909 Ga0207705_10131665 Ga0207705_101316652 240
64 3300025911 Ga0207654_10080223 Ga0207654_100802232 240
65 3300025913 Ga0207695_10075649 Ga0207695_100756493 240
66 3300025944 Ga0207661_10305054 Ga0207661_103050542 240
67 3300025949 Ga0207667_10062473 Ga0207667_100624733 240
68 3300026116 Ga0207674_10003476 Ga0207674_100034765 240
69 3300031251 Ga0265327_10053308 Ga0265327_100533082 240
70 3300047318 Ga0495636_0057185 Ga0495636_0057185_795_1616 240
71 3300005344 Ga0070661_100021266 Ga0070661_1000212662 241
72 3300009545 Ga0105237_10329849 Ga0105237_103298492 241
73 3300010375 Ga0105239_10474238 Ga0105239_104742381 241
74 3300048905 Ga0496102_0095687 Ga0496102_0095687_1864_2733 241
75 3300005355 Ga0070671_100145964 Ga0070671_1001459642 242
76 3300009093 Ga0105240_10193519 Ga0105240_101935193 242
77 3300013105 Ga0157369_10075469 Ga0157369_100754691 242
78 3300025906 Ga0207699_10188998 Ga0207699_101889982 242
79 3300017792 Ga0163161_10173506 Ga0163161_101735062 243
80 3300042115 Ga0450911_009727 Ga0450911_009727_396_1253 243
81 3300025972 Ga0207668_10132781 Ga0207668_101327812 244
82 3300048919 Ga0496116_0001249 Ga0496116_0001249_28256_29113 244
83 3300013102 Ga0157371_10013316 Ga0157371_100133166 246
84 3300031711 Ga0265314_10119173 Ga0265314_101191732 246
85 3300049582 Ga0501048_0260861 Ga0501048_0260861_146_1036 246
86 3300053080 Ga0500635_0113458 Ga0500635_0113458_83_994 246
87 3300025931 Ga0207644_10308606 Ga0207644_103086061 247
88 3300005937 Ga0081455_10005392 Ga0081455_1000539210 248
89 3300006195 Ga0075366_10094626 Ga0075366_100946262 248
90 3300049581 Ga0501047_0269947 Ga0501047_0269947_274_1164 248
91 3300049581 Ga0501047_0294985 Ga0501047_0294985_113_1003 248
92 3300049744 Ga0501083_0222588 Ga0501083_0222588_36_926 248
93 3300025945 Ga0207679_10151939 Ga0207679_101519392 249
94 3300045051 Ga0451576_0351515 Ga0451576_0351515_388_1137 249
95 3300046507 Ga0495606_0000314 Ga0495606_0000314_31301_32152 249
96 3300046694 Ga0495649_0005692 Ga0495649_0005692_2912_3763 249
97 3300003751 Ga0055538_1000085 Ga0055538_100008518 250
98 3300003752 Ga0055539_1000126 Ga0055539_100012618 250
99 3300003756 Ga0055533_1000133 Ga0055533_100013318 250
100 3300003759 Ga0055525_1000174 Ga0055525_100017418 250
101 3300003841 Ga0055541_1000085 Ga0055541_100008559 250
102 3300005329 Ga0070683_100432375 Ga0070683_1004323751 250
103 3300005564 Ga0070664_100122852 Ga0070664_1001228522 250
104 3300009036 Ga0105244_10050529 Ga0105244_100505292 250
105 3300009148 Ga0105243_10001514 Ga0105243_1000151421 250
106 3300015261 Ga0182006_1057689 Ga0182006_10576891 250
107 3300021361 Ga0213872_10005344 Ga0213872_100053444 250
108 3300025224 Ga0209784_100021 Ga0209784_10002189 250
109 3300025225 Ga0209566_100039 Ga0209566_10003990 250
110 3300025226 Ga0209674_100036 Ga0209674_10003689 250
111 3300025230 Ga0209563_100040 Ga0209563_10004089 250
112 3300025253 Ga0209677_100023 Ga0209677_10002389 250
113 3300025926 Ga0207659_10330526 Ga0207659_103305261 250
114 3300025935 Ga0207709_10000579 Ga0207709_100005796 250
115 3300039447 Ga0436361_0432344 Ga0436361_0432344_11954_12787 250
116 3300046691 Ga0495670_0298923 Ga0495670_0298923_15_809 250
117 3300048928 Ga0496125_0209145 Ga0496125_0209145_361_1218 250
118 3300046512 Ga0495610_0082249 Ga0495610_0082249_184_972 252
119 3300048919 Ga0496116_0008151 Ga0496116_0008151_7150_7977 252
120 3300048925 Ga0496122_0000186 Ga0496122_0000186_43661_44488 252
121 3300048926 Ga0496123_0000162 Ga0496123_0000162_107855_108682 252
122 3300048928 Ga0496125_0031606 Ga0496125_0031606_2047_2874 252
123 3300049573 Ga0501037_0001580 Ga0501037_0001580_15551_16441 252
124 3300049742 Ga0501080_0014560 Ga0501080_0014560_2088_2978 252
125 3300025263 Ga0209565_1009870 Ga0209565_10098702 253
126 3300026121 Ga0207683_10021386 Ga0207683_100213864 253
127 3300046679 Ga0495623_0242116 Ga0495623_0242116_136_993 253
128 3300048907 Ga0496104_0174552 Ga0496104_0174552_1059_1886 253
129 3300002987 JGI25159J45721_1007402 JGI25159J45721_10074021 254
130 3300003374 JGI25161J50226_1000606 JGI25161J50226_10006064 254
131 3300003791 Ga0055530_10008784 Ga0055530_100087841 254
132 3300004625 Ga0055543_1000387 Ga0055543_100038730 254
133 3300005262 Ga0065165_1002619 Ga0065165_100261913 254
134 3300005367 Ga0070667_100027200 Ga0070667_1000272003 254
135 3300005456 Ga0070678_100184194 Ga0070678_1001841942 254
136 3300006051 Ga0075364_10159068 Ga0075364_101590682 254
137 3300009011 Ga0105251_10130498 Ga0105251_101304982 254
138 3300009177 Ga0105248_10168846 Ga0105248_101688462 254
139 3300013308 Ga0157375_10024508 Ga0157375_100245082 254
140 3300025208 Ga0209436_101963 Ga0209436_1019633 254
141 3300025263 Ga0209565_1005710 Ga0209565_10057103 254
142 3300025284 Ga0209130_1000740 Ga0209130_10007404 254
143 3300025291 Ga0209675_1016789 Ga0209675_10167892 254
144 3300025298 Ga0209050_1000365 Ga0209050_100036589 254
145 3300025903 Ga0207680_10034651 Ga0207680_100346513 254
146 3300025941 Ga0207711_10236639 Ga0207711_102366392 254
147 3300025986 Ga0207658_10124430 Ga0207658_101244302 254
148 3300026067 Ga0207678_10041247 Ga0207678_100412474 254
149 3300026121 Ga0207683_10199876 Ga0207683_101998763 254
150 3300028379 Ga0268266_10185254 Ga0268266_101852542 254
151 3300041486 Ga0451807_1996062 Ga0451807_1996062_168_941 254
152 3300046457 Ga0495590_0011466 Ga0495590_0011466_2327_3151 254
153 3300046460 Ga0495638_0000875 Ga0495638_0000875_8273_9109 254
154 3300046471 Ga0495650_0019444 Ga0495650_0019444_1129_1965 254
155 3300046474 Ga0495605_0003074 Ga0495605_0003074_8208_9044 254
156 3300046523 Ga0495644_0054541 Ga0495644_0054541_625_1461 254
157 3300046524 Ga0495648_0015309 Ga0495648_0015309_4679_5494 254
158 3300046528 Ga0495642_0016071 Ga0495642_0016071_1924_2760 254
159 3300046794 Ga0495589_0001288 Ga0495589_0001288_9889_10725 254
160 3300048903 Ga0496100_0263304 Ga0496100_0263304_299_1135 254
161 3300048909 Ga0496106_0028887 Ga0496106_0028887_2514_3350 254
162 3300048918 Ga0496115_0033943 Ga0496115_0033943_189_1025 254
163 3300050491 nmdc:mga00v17_34083_c1 nmdc:mga00v17_34083_c1_1839_2702 254
164 3300053730 Ga0500645_001181 Ga0500645_001181_11055_11939 254
165 3300002739 JGI25158J39367_1001204 JGI25158J39367_10012044 255
166 3300002774 JGI25150J39212_1014055 JGI25150J39212_10140551 255
167 3300002987 JGI25159J45721_1003511 JGI25159J45721_10035114 255
168 3300003354 JGI25160J50197_1001730 JGI25160J50197_10017303 255
169 3300003374 JGI25161J50226_1001465 JGI25161J50226_10014656 255
170 3300003771 Ga0055526_1001791 Ga0055526_100179112 255
171 3300003771 Ga0055526_1004751 Ga0055526_10047515 255
172 3300003773 Ga0055537_1015044 Ga0055537_10150441 255
173 3300003775 Ga0055524_1012342 Ga0055524_10123421 255
174 3300003775 Ga0055524_1015761 Ga0055524_10157613 255
175 3300003784 Ga0055534_1003336 Ga0055534_10033364 255
176 3300003790 Ga0055528_1006649 Ga0055528_10066492 255
177 3300003791 Ga0055530_10024105 Ga0055530_100241053 255
178 3300003794 Ga0055531_10012375 Ga0055531_100123754 255
179 3300025208 Ga0209436_101442 Ga0209436_1014428 255
180 3300025245 Ga0207425_1002181 Ga0207425_10021817 255
181 3300025263 Ga0209565_1000875 Ga0209565_10008757 255
182 3300025263 Ga0209565_1000887 Ga0209565_10008876 255
183 3300025273 Ga0209673_1019523 Ga0209673_10195232 255
184 3300025284 Ga0209130_1002172 Ga0209130_10021727 255
185 3300025284 Ga0209130_1002173 Ga0209130_10021737 255
186 3300025291 Ga0209675_1001351 Ga0209675_100135112 255
187 3300025295 Ga0209564_1000067 Ga0209564_100006792 255
188 3300025295 Ga0209564_1003115 Ga0209564_10031155 255
189 3300025298 Ga0209050_1000040 Ga0209050_1000040204 255
190 3300025298 Ga0209050_1005050 Ga0209050_10050507 255
191 3300025299 Ga0209256_1001662 Ga0209256_100166214 255
192 3300025299 Ga0209256_1004683 Ga0209256_10046834 255
193 3300025302 Ga0207426_1005381 Ga0207426_10053813 255
194 3300025303 Ga0209051_1026012 Ga0209051_10260122 255
195 3300025304 Ga0209257_1000054 Ga0209257_1000054195 255
196 3300025906 Ga0207699_10179236 Ga0207699_101792361 255
197 3300029957 Ga0265324_10048255 Ga0265324_100482552 255
198 3300031251 Ga0265327_10004511 Ga0265327_1000451110 255
199 3300031548 Ga0307408_100003180 Ga0307408_10000318011 255
200 3300031548 Ga0307408_100011951 Ga0307408_1000119518 255
201 3300046506 Ga0495583_0082262 Ga0495583_0082262_281_1108 255
202 3300046525 Ga0495663_0014702 Ga0495663_0014702_348_1169 255
203 3300046528 Ga0495642_0026488 Ga0495642_0026488_680_1501 255
204 3300047318 Ga0495636_0022380 Ga0495636_0022380_1345_2166 255
205 3300047447 Ga0495685_053060 Ga0495685_053060_122_943 255
206 3300048905 Ga0496102_0000024 Ga0496102_0000024_91703_92533 255
207 3300048906 Ga0496103_0208828 Ga0496103_0208828_103_930 255
208 3300048907 Ga0496104_0382911 Ga0496104_0382911_327_1196 255
209 3300005563 Ga0068855_100450959 Ga0068855_1004509592 256
210 3300013306 Ga0163162_10025423 Ga0163162_100254233 256
211 3300013308 Ga0157375_10000712 Ga0157375_1000071214 256
212 3300014969 Ga0157376_10001938 Ga0157376_100019384 256
213 3300025934 Ga0207686_10069512 Ga0207686_100695123 256
214 3300025949 Ga0207667_10196800 Ga0207667_101968002 256
215 3300026089 Ga0207648_10007928 Ga0207648_100079285 256
216 3300046458 Ga0495591_000007 Ga0495591_000007_355877_356710 256
217 3300046474 Ga0495605_0005630 Ga0495605_0005630_3668_4516 256
218 3300046491 Ga0495584_0007112 Ga0495584_0007112_851_1690 256
219 3300046491 Ga0495584_0008704 Ga0495584_0008704_1112_1960 256
220 3300046528 Ga0495642_0003493 Ga0495642_0003493_2035_2883 256
221 3300046530 Ga0495654_0000007 Ga0495654_0000007_393008_393847 256
222 3300046530 Ga0495654_0003376 Ga0495654_0003376_1833_2681 256
223 3300046538 Ga0495609_0024920 Ga0495609_0024920_1026_1868 256
224 3300046542 Ga0495597_0002800 Ga0495597_0002800_4238_5086 256
225 3300046616 Ga0495668_0005614 Ga0495668_0005614_436_1284 256
226 3300046794 Ga0495589_0075772 Ga0495589_0075772_447_1295 256
227 3300046810 Ga0495660_0000355 Ga0495660_0000355_38626_39468 256
228 3300047320 Ga0495672_0008932 Ga0495672_0008932_6007_6855 256
229 3300047472 Ga0495686_0015707 Ga0495686_0015707_1151_1993 256
230 3300048907 Ga0496104_0000365 Ga0496104_0000365_35483_36346 256
231 3300048908 Ga0496105_0000048 Ga0496105_0000048_35483_36346 256
232 3300048913 Ga0496110_0001900 Ga0496110_0001900_5132_5959 256
233 3300048914 Ga0496111_0105745 Ga0496111_0105745_761_1588 256
234 3300005330 Ga0070690_100255160 Ga0070690_1002551602 257
235 3300005466 Ga0070685_10244327 Ga0070685_102443272 257
236 3300009011 Ga0105251_10118358 Ga0105251_101183582 257
237 3300009176 Ga0105242_10040170 Ga0105242_100401704 257
238 3300013105 Ga0157369_10041346 Ga0157369_100413462 257
239 3300013296 Ga0157374_10087383 Ga0157374_100873833 257
240 3300013307 Ga0157372_10158180 Ga0157372_101581803 257
241 3300025735 Ga0207713_1073427 Ga0207713_10734272 257
242 3300026095 Ga0207676_10236376 Ga0207676_102363762 257
243 3300031548 Ga0307408_100464469 Ga0307408_1004644692 257
244 3300046538 Ga0495609_0011758 Ga0495609_0011758_969_1796 257
245 3300046542 Ga0495597_0000372 Ga0495597_0000372_1401_2228 257
246 3300049569 Ga0501032_0012041 Ga0501032_0012041_2958_3749 257
247 3300049571 Ga0501034_0042742 Ga0501034_0042742_1294_2085 257
248 3300049574 Ga0501038_0009408 Ga0501038_0009408_5891_6682 257
249 3300003322 rootL2_10092461 rootL2_100924611 258
250 3300053156 Ga0500622_0000011 Ga0500622_0000011_25259_26119 258
251 3300005549 Ga0070704_100201971 Ga0070704_1002019712 259
252 3300005615 Ga0070702_100267263 Ga0070702_1002672632 259
253 3300009036 Ga0105244_10030322 Ga0105244_100303222 259
254 3300031239 Ga0265328_10000016 Ga0265328_1000001693 259
255 3300035241 Ga0373961_0008029 Ga0373961_0008029_1384_2172 259
256 3300046522 Ga0495643_0002757 Ga0495643_0002757_5673_6524 259
257 3300046522 Ga0495643_0009145 Ga0495643_0009145_2702_3553 259
258 3300046660 Ga0495625_0189081 Ga0495625_0189081_439_1290 259
259 3300046692 Ga0495671_0002714 Ga0495671_0002714_9508_10359 259
260 3300046694 Ga0495649_0010368 Ga0495649_0010368_3305_4156 259
261 3300047470 Ga0495681_0035561 Ga0495681_0035561_1377_2228 259
262 3300049584 Ga0501068_0012186 Ga0501068_0012186_1636_2430 259
263 3300049587 Ga0501071_0000860 Ga0501071_0000860_6346_7140 259
264 3300049588 Ga0501072_0013858 Ga0501072_0013858_3744_4538 259
265 3300049591 Ga0501075_0010964 Ga0501075_0010964_466_1260 259
266 3300049742 Ga0501080_0000881 Ga0501080_0000881_9629_10423 259
267 3300049743 Ga0501081_0028006 Ga0501081_0028006_1502_2296 259
268 3300049824 Ga0501045_0098294 Ga0501045_0098294_220_1014 259
269 3300054114 Ga0501084_0162833 Ga0501084_0162833_797_1591 259
270 3300061734 Ga0530510_0396967 Ga0530510_0396967_120_914 259
271 3300025292 Ga0209676_1006762 Ga0209676_10067622 260
272 3300031548 Ga0307408_100273235 Ga0307408_1002732352 260
273 3300046501 Ga0495607_0002495 Ga0495607_0002495_13662_14492 260
274 3300046665 Ga0495661_0234909 Ga0495661_0234909_11_799 260
275 3300048929 Ga0496126_0114500 Ga0496126_0114500_106_945 260
276 3300049586 Ga0501070_0363172 Ga0501070_0363172_252_1106 260
277 iso_pu_bacteria 2585428062 2587754080 260
278 iso_pu_bacteria 2919704043 2919707137 260
279 3300003187 JGI25151J46595_10004389 JGI25151J46595_100043891 261
280 3300003771 Ga0055526_1006655 Ga0055526_10066556 261
281 3300003773 Ga0055537_1004773 Ga0055537_10047733 261
282 3300003775 Ga0055524_1002928 Ga0055524_10029286 261
283 3300003784 Ga0055534_1001951 Ga0055534_10019517 261
284 3300005439 Ga0070711_100071818 Ga0070711_1000718182 261
285 3300009011 Ga0105251_10029983 Ga0105251_100299832 261
286 3300009036 Ga0105244_10050822 Ga0105244_100508222 261
287 3300009176 Ga0105242_10156295 Ga0105242_101562952 261
288 3300009177 Ga0105248_10402940 Ga0105248_104029402 261
289 3300025263 Ga0209565_1000261 Ga0209565_10002613 261
290 3300025273 Ga0209673_1010896 Ga0209673_10108963 261
291 3300025291 Ga0209675_1006893 Ga0209675_10068934 261
292 3300025294 Ga0209025_1000516 Ga0209025_100051618 261
293 3300025295 Ga0209564_1000611 Ga0209564_10006113 261
294 3300025297 Ga0209758_1026126 Ga0209758_10261263 261
295 3300025299 Ga0209256_1001546 Ga0209256_10015464 261
296 3300025916 Ga0207663_10090009 Ga0207663_100900092 261
297 3300048905 Ga0496102_0006320 Ga0496102_0006320_7087_7902 261
298 3300048920 Ga0496117_0193438 Ga0496117_0193438_69_914 261
299 iso_pu_bacteria 2738543013 2739248279 261
300 3300003322 rootL2_10237592 rootL2_102375921 262
301 3300005330 Ga0070690_100356754 Ga0070690_1003567542 262
302 3300005434 Ga0070709_10363736 Ga0070709_103637362 262
303 3300005459 Ga0068867_100150992 Ga0068867_1001509922 262
304 3300006195 Ga0075366_10012944 Ga0075366_100129443 262
305 3300006195 Ga0075366_10092392 Ga0075366_100923922 262
306 3300006353 Ga0075370_10223415 Ga0075370_102234152 262
307 3300006353 Ga0075370_10273172 Ga0075370_102731721 262
308 3300009092 Ga0105250_10025778 Ga0105250_100257782 262
309 3300025711 Ga0207696_1027099 Ga0207696_10270993 262
310 3300025920 Ga0207649_10175520 Ga0207649_101755201 262
311 3300025923 Ga0207681_10167718 Ga0207681_101677182 262
312 3300028794 Ga0307515_10000354 Ga0307515_1000035452 262
313 3300028794 Ga0307515_10007796 Ga0307515_100077964 262
314 3300028794 Ga0307515_10009311 Ga0307515_100093116 262
315 3300030522 Ga0307512_10113086 Ga0307512_101130862 262
316 3300031456 Ga0307513_10010732 Ga0307513_100107328 262
317 3300031507 Ga0307509_10024723 Ga0307509_100247233 262
318 3300031616 Ga0307508_10000043 Ga0307508_1000004381 262
319 3300031649 Ga0307514_10078874 Ga0307514_100788743 262
320 3300031649 Ga0307514_10086174 Ga0307514_100861742 262
321 3300031730 Ga0307516_10013442 Ga0307516_100134428 262
322 3300033179 Ga0307507_10061383 Ga0307507_100613832 262
323 3300035111 Ga0373923_0100472 Ga0373923_0100472_11_832 262
324 3300035172 Ga0373955_0002705 Ga0373955_0002705_25_846 262
325 3300036401 Ga0373937_0128978 Ga0373937_0128978_1293_2114 262
326 3300041452 Ga0451793_0774530 Ga0451793_0774530_498_1316 262
327 3300042876 Ga0451577_0098152 Ga0451577_0098152_734_1594 262
328 3300044658 Ga0466972_0008985 Ga0466972_0008985_1634_2464 262
329 3300044673 Ga0453683_0163532 Ga0453683_0163532_176_1045 262
330 3300044712 Ga0453684_0005573 Ga0453684_0005573_15653_16513 262
331 3300045051 Ga0451576_0009742 Ga0451576_0009742_5231_6100 262
332 3300045051 Ga0451576_0272612 Ga0451576_0272612_316_1137 262
333 3300046463 Ga0495653_0023473 Ga0495653_0023473_3154_3975 262
334 3300046515 Ga0495620_0035857 Ga0495620_0035857_628_1446 262
335 3300046516 Ga0495628_0033791 Ga0495628_0033791_683_1504 262
336 3300046522 Ga0495643_0034891 Ga0495643_0034891_1873_2691 262
337 3300046525 Ga0495663_0046829 Ga0495663_0046829_368_1225 262
338 3300046529 Ga0495652_0052830 Ga0495652_0052830_397_1218 262
339 3300046543 Ga0495645_0003820 Ga0495645_0003820_1670_2491 262
340 3300046559 Ga0495667_0065328 Ga0495667_0065328_1112_1933 262
341 3300046660 Ga0495625_0003495 Ga0495625_0003495_12340_13158 262
342 3300046679 Ga0495623_0135123 Ga0495623_0135123_97_918 262
343 3300047322 Ga0495680_0168764 Ga0495680_0168764_134_955 262
344 3300047471 Ga0495684_0064468 Ga0495684_0064468_1458_2279 262
345 3300048927 Ga0496124_0165467 Ga0496124_0165467_255_1118 262
346 3300049571 Ga0501034_0249535 Ga0501034_0249535_26_847 262
347 3300050493 nmdc:mga0k408_232383_c1 nmdc:mga0k408_232383_c1_113_931 262
348 3300050493 nmdc:mga0k408_251353_c1 nmdc:mga0k408_251353_c1_106_924 262
349 3300050493 nmdc:mga0k408_9268_c2 nmdc:mga0k408_9268_c2_1057_1884 262
350 3300050494 nmdc:mga06z11_117453_c1 nmdc:mga06z11_117453_c1_497_1315 262
351 3300050496 nmdc:mga07m45_186317_c1 nmdc:mga07m45_186317_c1_152_970 262
352 3300050496 nmdc:mga07m45_202878_c1 nmdc:mga07m45_202878_c1_106_924 262
353 3300053077 Ga0495601_0045857 Ga0495601_0045857_129_950 262
354 3300053739 Ga0500587_004985 Ga0500587_004985_116_934 262
355 iso_pu_bacteria 2842747753 2842748869 262
356 iso_pu_bacteria 2945972063 2945975658 262
357 3300005436 Ga0070713_100003725 Ga0070713_1000037258 263
358 3300005577 Ga0068857_100362807 Ga0068857_1003628072 263
359 3300009098 Ga0105245_10334489 Ga0105245_103344892 263
360 3300025928 Ga0207700_10006080 Ga0207700_100060805 263
361 3300025986 Ga0207658_10346976 Ga0207658_103469761 263
362 3300026116 Ga0207674_10365303 Ga0207674_103653032 263
363 3300035724 Ga0373933_0144079 Ga0373933_0144079_275_1162 263
364 3300047470 Ga0495681_0068879 Ga0495681_0068879_98_916 263
365 3300049569 Ga0501032_0146683 Ga0501032_0146683_328_1218 263
366 iso_pu_bacteria 2904479285 2904481652 263
367 3300005459 Ga0068867_100459301 Ga0068867_1004593012 264
368 3300036647 Ga0316582_0193553 Ga0316582_0193553_18_872 264
369 3300046557 Ga0495622_0025750 Ga0495622_0025750_218_1045 264
370 3300047321 Ga0495676_0000025 Ga0495676_0000025_103024_103851 264
371 3300048927 Ga0496124_0052851 Ga0496124_0052851_1017_1850 264
372 3300046452 Ga0495617_004710 Ga0495617_004710_115_933 265
373 3300046457 Ga0495590_0006781 Ga0495590_0006781_1448_2266 265
374 3300046460 Ga0495638_0084453 Ga0495638_0084453_592_1410 265
375 3300046491 Ga0495584_0005537 Ga0495584_0005537_159_977 265
376 3300046491 Ga0495584_0081926 Ga0495584_0081926_115_933 265
377 3300046492 Ga0495585_0021113 Ga0495585_0021113_646_1464 265
378 3300046492 Ga0495585_0032238 Ga0495585_0032238_338_1156 265
379 3300046492 Ga0495585_0044887 Ga0495585_0044887_1430_2248 265
380 3300046501 Ga0495607_0032627 Ga0495607_0032627_2256_3074 265
381 3300046506 Ga0495583_0000099 Ga0495583_0000099_34504_35322 265
382 3300046513 Ga0495616_0007675 Ga0495616_0007675_674_1492 265
383 3300046523 Ga0495644_0001980 Ga0495644_0001980_5097_5915 265
384 3300046524 Ga0495648_0002571 Ga0495648_0002571_164_982 265
385 3300046538 Ga0495609_0009946 Ga0495609_0009946_1461_2279 265
386 3300046538 Ga0495609_0053503 Ga0495609_0053503_457_1275 265
387 3300046558 Ga0495633_0002768 Ga0495633_0002768_5620_6438 265
388 3300046558 Ga0495633_0075337 Ga0495633_0075337_592_1410 265
389 3300046648 Ga0495611_0003774 Ga0495611_0003774_182_1000 265
390 3300046648 Ga0495611_0009669 Ga0495611_0009669_1019_1837 265
391 3300046660 Ga0495625_0277827 Ga0495625_0277827_99_917 265
392 3300046660 Ga0495625_0279132 Ga0495625_0279132_162_980 265
393 3300046664 Ga0495659_0000462 Ga0495659_0000462_12738_13556 265
394 3300046665 Ga0495661_0154952 Ga0495661_0154952_260_1078 265
395 3300046691 Ga0495670_0103141 Ga0495670_0103141_104_922 265
396 3300046692 Ga0495671_0109434 Ga0495671_0109434_209_1027 265
397 3300046692 Ga0495671_0198393 Ga0495671_0198393_58_876 265
398 3300047320 Ga0495672_0153549 Ga0495672_0153549_99_917 265
399 3300047323 Ga0495683_0028552 Ga0495683_0028552_99_917 265
400 3300047443 Ga0495687_000687 Ga0495687_000687_6062_6880 265
401 3300047445 Ga0495677_0033900 Ga0495677_0033900_221_1039 265
402 3300047447 Ga0495685_000008 Ga0495685_000008_61637_62455 265
403 3300047469 Ga0495673_0068892 Ga0495673_0068892_147_965 265
404 3300049459 Ga0495678_012076 Ga0495678_012076_360_1178 265
405 3300049460 Ga0495682_0002892 Ga0495682_0002892_544_1362 265
406 3300049570 Ga0501033_0085641 Ga0501033_0085641_811_1701 265
407 3300049571 Ga0501034_0153173 Ga0501034_0153173_787_1677 265
408 3300049572 Ga0501036_0034453 Ga0501036_0034453_328_1218 265
409 3300049574 Ga0501038_0087957 Ga0501038_0087957_602_1492 265
410 3300049575 Ga0501039_0069109 Ga0501039_0069109_486_1376 265
411 3300049579 Ga0501043_0103702 Ga0501043_0103702_1102_1992 265
412 3300049583 Ga0501067_0030877 Ga0501067_0030877_926_1816 265
413 3300049778 Ga0501282_001460 Ga0501282_001460_836_1648 265
414 3300049822 Ga0501035_0138256 Ga0501035_0138256_113_1003 265
415 iso_pu_bacteria 2885080285 2885080390 265
416 iso_pu_bacteria 2941479691 2941484849 265
417 3300005616 Ga0068852_100012173 Ga0068852_1000121735 266
418 3300006058 Ga0075432_10048059 Ga0075432_100480592 266
419 3300009036 Ga0105244_10052701 Ga0105244_100527012 266
420 3300009545 Ga0105237_10389689 Ga0105237_103896892 266
421 3300013100 Ga0157373_10001293 Ga0157373_100012932 266
422 3300013102 Ga0157371_10000646 Ga0157371_1000064636 266
423 3300021361 Ga0213872_10002585 Ga0213872_1000258510 266
424 3300025711 Ga0207696_1000062 Ga0207696_1000062117 266
425 3300026142 Ga0207698_10051721 Ga0207698_100517212 266
426 3300039447 Ga0436361_0276775 Ga0436361_0276775_16525_17412 266
427 3300044658 Ga0466972_0056855 Ga0466972_0056855_419_1270 266
428 3300044683 Ga0466965_0002392 Ga0466965_0002392_6331_7182 266
429 3300044706 Ga0466964_0036475 Ga0466964_0036475_317_1168 266
430 3300044735 Ga0466968_0004690 Ga0466968_0004690_3784_4635 266
431 3300046457 Ga0495590_0007599 Ga0495590_0007599_2792_3619 266
432 3300046473 Ga0495582_0000964 Ga0495582_0000964_6036_6875 266
433 3300046491 Ga0495584_0040001 Ga0495584_0040001_635_1474 266
434 3300046491 Ga0495584_0047766 Ga0495584_0047766_992_1831 266
435 3300046492 Ga0495585_0003733 Ga0495585_0003733_4521_5348 266
436 3300046492 Ga0495585_0011370 Ga0495585_0011370_2602_3438 266
437 3300046492 Ga0495585_0016609 Ga0495585_0016609_3125_3964 266
438 3300046492 Ga0495585_0047179 Ga0495585_0047179_698_1537 266
439 3300046500 Ga0495596_0005631 Ga0495596_0005631_2956_3795 266
440 3300046500 Ga0495596_0016351 Ga0495596_0016351_1413_2240 266
441 3300046501 Ga0495607_0069310 Ga0495607_0069310_310_1149 266
442 3300046506 Ga0495583_0021534 Ga0495583_0021534_202_1038 266
443 3300046507 Ga0495606_0082035 Ga0495606_0082035_66_893 266
444 3300046513 Ga0495616_0080131 Ga0495616_0080131_589_1428 266
445 3300046518 Ga0495631_0003567 Ga0495631_0003567_162_1001 266
446 3300046518 Ga0495631_0036378 Ga0495631_0036378_551_1378 266
447 3300046518 Ga0495631_0115215 Ga0495631_0115215_143_982 266
448 3300046524 Ga0495648_0013334 Ga0495648_0013334_501_1337 266
449 3300046526 Ga0495666_0001332 Ga0495666_0001332_5092_5928 266
450 3300046530 Ga0495654_0037963 Ga0495654_0037963_75_905 266
451 3300046531 Ga0495665_0015305 Ga0495665_0015305_786_1622 266
452 3300046533 Ga0495640_0039917 Ga0495640_0039917_2077_2904 266
453 3300046538 Ga0495609_0047481 Ga0495609_0047481_462_1301 266
454 3300046542 Ga0495597_0014646 Ga0495597_0014646_465_1292 266
455 3300046542 Ga0495597_0031013 Ga0495597_0031013_309_1139 266
456 3300046558 Ga0495633_0053185 Ga0495633_0053185_161_1000 266
457 3300046616 Ga0495668_0010491 Ga0495668_0010491_2009_2848 266
458 3300046648 Ga0495611_0011658 Ga0495611_0011658_568_1407 266
459 3300046660 Ga0495625_0004095 Ga0495625_0004095_6561_7391 266
460 3300046664 Ga0495659_0000072 Ga0495659_0000072_22100_22930 266
461 3300046665 Ga0495661_0002151 Ga0495661_0002151_9316_10155 266
462 3300046665 Ga0495661_0023405 Ga0495661_0023405_2760_3596 266
463 3300046665 Ga0495661_0029346 Ga0495661_0029346_2414_3241 266
464 3300046679 Ga0495623_0150933 Ga0495623_0150933_66_902 266
465 3300046684 Ga0495669_0000061 Ga0495669_0000061_37083_37922 266
466 3300046684 Ga0495669_0019302 Ga0495669_0019302_886_1713 266
467 3300046691 Ga0495670_0000980 Ga0495670_0000980_7503_8342 266
468 3300046692 Ga0495671_0000281 Ga0495671_0000281_19881_20711 266
469 3300046794 Ga0495589_0007740 Ga0495589_0007740_2475_3302 266
470 3300047315 Ga0495581_0003008 Ga0495581_0003008_6016_6855 266
471 3300047318 Ga0495636_0054269 Ga0495636_0054269_56_895 266
472 3300047320 Ga0495672_0000026 Ga0495672_0000026_326013_326843 266
473 3300047443 Ga0495687_000117 Ga0495687_000117_19608_20444 266
474 3300047443 Ga0495687_000314 Ga0495687_000314_45208_46035 266
475 3300047443 Ga0495687_032347 Ga0495687_032347_808_1635 266
476 3300047444 Ga0495675_0117936 Ga0495675_0117936_414_1250 266
477 3300047445 Ga0495677_0008307 Ga0495677_0008307_297_1136 266
478 3300047445 Ga0495677_0011569 Ga0495677_0011569_1419_2258 266
479 3300047470 Ga0495681_0002626 Ga0495681_0002626_634_1458 266
480 3300047470 Ga0495681_0006316 Ga0495681_0006316_746_1585 266
481 3300047673 Ga0495593_0021020 Ga0495593_0021020_638_1477 266
482 3300048089 Ga0495614_0006276 Ga0495614_0006276_697_1536 266
483 3300048904 Ga0496101_0000093 Ga0496101_0000093_7762_8601 266
484 3300048909 Ga0496106_0118047 Ga0496106_0118047_915_1742 266
485 3300048910 Ga0496107_0047525 Ga0496107_0047525_2056_2883 266
486 3300048913 Ga0496110_0326130 Ga0496110_0326130_138_965 266
487 3300048914 Ga0496111_0063039 Ga0496111_0063039_591_1418 266
488 3300048920 Ga0496117_0158579 Ga0496117_0158579_265_1104 266
489 3300048922 Ga0496119_0017822 Ga0496119_0017822_454_1293 266
490 3300048923 Ga0496120_0001787 Ga0496120_0001787_8651_9490 266
491 3300048925 Ga0496122_0006111 Ga0496122_0006111_7584_8423 266
492 3300048926 Ga0496123_0000677 Ga0496123_0000677_41208_42047 266
493 3300048927 Ga0496124_0029422 Ga0496124_0029422_3742_4581 266
494 iso_pu_bacteria 2643221645 2644255055 266
495 iso_pu_bacteria 2643221664 2644359156 266
496 iso_pu_bacteria 2738541280 2738738426 266
497 iso_pu_bacteria 2738541300 2738842775 266
498 iso_pu_bacteria 2738543018 2739273522 266
499 iso_pu_bacteria 2738543030 2739342566 266
500 iso_pu_bacteria 2919046199 2919048906 266
501 3300009011 Ga0105251_10006802 Ga0105251_100068022 267
502 3300048919 Ga0496116_0088929 Ga0496116_0088929_758_1597 267
503 iso_pu_bacteria 2895511927 2895514896 267
504 iso_pu_bacteria 8054357960 8054359780 267
505 3300013306 Ga0163162_10000877 Ga0163162_100008776 268
506 3300041413 Ga0439465_0008062 Ga0439465_0008062_188_1039 268
507 3300042007 Ga0439449_0000072 Ga0439449_0000072_30180_31031 268
508 3300042876 Ga0451577_0417004 Ga0451577_0417004_213_1037 268
509 3300049776 Ga0501280_002240 Ga0501280_002240_2052_2873 268
510 iso_pu_bacteria 2808606418 2809146169 268
511 3300045051 Ga0451576_0038638 Ga0451576_0038638_652_1497 269
512 iso_pu_bacteria 2510065053 2510284579 270
513 iso_pu_bacteria 2510065055 2510295707 270
514 iso_pu_bacteria 2510065058 2510311957 270
515 iso_pu_bacteria 2728369097 2729147188 270
516 iso_pu_bacteria 2773857672 2774130740 270
517 iso_pu_bacteria 2887630918 2887631094 270
518 iso_pu_bacteria 2917832318 2917834445 270
519 iso_pu_bacteria 2919125081 2919128001 270
520 iso_pu_bacteria 2919501602 2919501717 270
521 iso_pu_bacteria 2926063275 2926063390 270
522 iso_pu_bacteria 2974298342 2974298406 270
523 iso_pu_bacteria 2984499530 2984504215 270
524 iso_pu_bacteria 2984504281 2984505911 270
525 iso_pu_bacteria 2990196909 2990200736 270
526 iso_pu_bacteria 3007252601 3007255925 270
527 iso_pu_bacteria 640427133 640489123 270
528 iso_pu_bacteria 651053060 651177218 270
529 iso_pu_bacteria 8016728285 8016732129 270
530 iso_pu_bacteria 8057160832 8057162085 270
531 3300028666 Ga0265336_10000185 Ga0265336_1000018535 271
532 3300029957 Ga0265324_10000011 Ga0265324_10000011132 271
533 3300031241 Ga0265325_10000447 Ga0265325_100004478 271
534 3300031711 Ga0265314_10018536 Ga0265314_100185365 271
535 iso_pu_bacteria 2899803654 2899808232 271
536 3300009553 Ga0105249_10029317 Ga0105249_100293174 272
537 3300026118 Ga0207675_100244032 Ga0207675_1002440323 272
538 3300045051 Ga0451576_0000677 Ga0451576_0000677_16791_17651 272
539 iso_pu_bacteria 2524614729 2525556202 272
540 iso_pu_bacteria 2627854209 2630649432 272
541 iso_pu_bacteria 2643221551 2643776797 272
542 iso_pu_bacteria 2643221555 2643795245 272
543 iso_pu_bacteria 2671180115 2671584787 272
544 iso_pu_bacteria 2854601825 2854602505 272
545 iso_pu_bacteria 2923525760 2923527589 272
546 iso_pu_bacteria 2939602548 2939605671 272
547 iso_pu_bacteria 8002745576 8002746506 272
548 iso_pu_bacteria 8003400568 8003403991 272
549 iso_pu_bacteria 8054844752 8054845538 272
550 3300009011 Ga0105251_10001860 Ga0105251_100018606 273
551 3300025735 Ga0207713_1005377 Ga0207713_10053773 273
552 3300039438 Ga0436360_0106361 Ga0436360_0106361_1899_2771 273
553 3300049576 Ga0501040_0015365 Ga0501040_0015365_2163_3044 273
554 3300049743 Ga0501081_0053143 Ga0501081_0053143_1397_2278 273
555 3300049822 Ga0501035_0073462 Ga0501035_0073462_1366_2220 273
556 iso_pu_bacteria 2513237150 2513956605 273
557 iso_pu_bacteria 2513237165 2514044077 273
558 iso_pu_bacteria 2558860983 2561466922 273
559 iso_pu_bacteria 2738543020 2739289253 273
560 iso_pu_bacteria 2738543021 2739294565 273
561 iso_pu_bacteria 2834641062 2834642502 273
562 iso_pu_bacteria 644736347 644749115 273
563 iso_pu_bacteria 8055431914 8055435766 273
564 3300006051 Ga0075364_10001253 Ga0075364_100012534 274
565 3300044712 Ga0453684_0001224 Ga0453684_0001224_2661_3521 274
566 3300050491 nmdc:mga00v17_225_c1 nmdc:mga00v17_225_c1_21784_22680 274
567 iso_pu_bacteria 2706794495 2707099181 274
568 iso_pu_bacteria 8055693939 8055695822 274
569 3300031727 Ga0316576_10026359 Ga0316576_100263592 275
570 iso_pu_bacteria 2511231025 2511381304 275
571 iso_pu_bacteria 2511231035 2511437239 275
572 iso_pu_bacteria 2547132181 2547695761 275
573 iso_pu_bacteria 2791355010 2792310772 275
574 iso_pu_bacteria 2874220319 2874220324 275
575 iso_pu_bacteria 2876601092 2876603834 275
576 iso_pu_bacteria 2900051742 2900051845 275
577 iso_pu_bacteria 2961047084 2961047089 275
578 iso_pu_bacteria 8016733728 8016735528 275
579 iso_pu_bacteria 8019499862 8019501084 275
580 3300031691 Ga0316579_10079847 Ga0316579_100798472 276
581 iso_pu_bacteria 2537561728 2538424723 276
582 iso_pu_bacteria 2599185299 2599925388 276
583 iso_pu_bacteria 2648501693 2650898723 276
584 iso_pu_bacteria 2684622997 2686353107 276
585 iso_pu_bacteria 2808606414 2809123840 276
586 iso_pu_bacteria 2847797336 2847800113 276
587 iso_pu_bacteria 2855195626 2855197215 276
588 iso_pu_bacteria 2858466076 2858468627 276
589 iso_pu_bacteria 2871272651 2871272946 276
590 iso_pu_bacteria 2871282230 2871283791 276
591 iso_pu_bacteria 2984494565 2984496393 276
592 iso_pu_bacteria 2990261002 2990261814 276
593 iso_pu_bacteria 8054849141 8054852948 276
594 3300031250 Ga0265331_10006445 Ga0265331_100064455 277
595 iso_pu_bacteria 2648501241 2649122528 277
596 iso_pu_bacteria 2651869818 2652976087 277
597 iso_pu_bacteria 2969079654 2969081668 277
598 3300001989 JGI24739J22299_10001449 JGI24739J22299_100014497 280
599 3300009036 Ga0105244_10002459 Ga0105244_100024597 280
600 3300013104 Ga0157370_10003676 Ga0157370_1000367610 280
601 3300025728 Ga0207655_1008198 Ga0207655_10081987 280
602 3300042010 Ga0439452_000001 Ga0439452_000001_571101_571943 280
603 3300048919 Ga0496116_0000300 Ga0496116_0000300_81713_82555 280
604 3300048920 Ga0496117_0000388 Ga0496117_0000388_22452_23294 280
605 3300048921 Ga0496118_0007368 Ga0496118_0007368_7786_8628 280
606 3300048927 Ga0496124_0089878 Ga0496124_0089878_1626_2468 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

138

230

0.95

PF02390

Methyltransf_4

Putative methyltransferase

143

215

0.94

PF08241

Methyltransf_11

Methyltransferase domain

146

217

0.94

PF17827

PrmC_N

PrmC N-terminal domain

7

80

0.91

PF13649

Methyltransf_25

Methyltransferase domain

145

229

0.89

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

140

217

0.88

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

135

228

0.84

PF01170

UPF0020

RMKL-like, methyltransferase domain

137

231

0.84

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

133

216

0.79

PF13847

Methyltransf_31

Methyltransferase domain

140

303

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.969 2 273
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9587 2 273
1vq1-assembly2.cif.gz_B crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.9114 1 272
1nv8-assembly2.cif.gz_B n5-glutamine methyltransferase, hemk 0.91 3 272
1vq1-assembly1.cif.gz_A crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.9027 1 272
ID Description Score Start End Superfamily
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 1.001 1 82 1.10.8.10
2b3tA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9846 1 84 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9771 1 82 1.10.8.10
2b3tA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9732 1 84 1.10.8.10
1t43A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9705 85 273 3.40.50.150
ID Description Score Start End GO Terms
AF-K8CDC3-F1-model_v4 deleted 0.9954 106 276
AF-Q5E6T2-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9919 1 276 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A3B9A882-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.991 63 276 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A3M2ZX95-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9895 69 276 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A800EG60-F1-model_v4 deleted 0.9855 1 177

Feature Viewer

pLDDT pTM Quality
95.16 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map