F468605
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 606 | 378 | 521 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300031250|Ga0265331_10006445|Ga0265331_100064455 |
| Length | 324 |
| Sequence | MPRTLQQVLTQDTARLIEALALDASSARIEVQTLLQHVLNVSRAYLLAYPERRLNDSEQIRYAELFQRRLQGEPIAYLLGEREFFGLMFKVTPATLIPRPETELLVELALQHIPSPPAGCAPLATLSPLAGEGGRQTGRGSLFRVLDLGTGSGAIALSIAHARPDIEVVAVDAAIEALAVARENAQRLGTSNVAFVQSDWYTVLAAQRFDLIVSNPPYVAAGDPHLQQGDLRFEPPSALASGNDGLEDIRHIVAEATAYLQPGGWLLLEHGYDQAAQVRDILRQAKFGEVFSAQDLAGIERVSGGRLDLTGFTPLKYPTQSLGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 2 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 3 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 4 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 5 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 6 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 7 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 8 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 9 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 10 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 11 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 12 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 13 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 14 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 15 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 16 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 17 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 18 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 19 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 20 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 21 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 22 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 23 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 24 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 25 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 26 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 27 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 28 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 29 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 30 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 31 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 32 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 33 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 34 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 35 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 36 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 37 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 38 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 39 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 40 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 41 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 42 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 43 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 44 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 45 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 46 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 47 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 48 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 49 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 50 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 51 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 52 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 53 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 54 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 55 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 56 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 57 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 58 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 59 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 60 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 61 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 62 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 63 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 64 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 65 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 66 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 67 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 68 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 69 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 70 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 71 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 72 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 73 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 74 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 75 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 76 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 77 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 78 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 79 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 83 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 86 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 87 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 88 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 89 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 90 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 91 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 92 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 93 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 94 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 104 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 107 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 109 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 111 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 115 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 142 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 199 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 200 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 209 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 216 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 231 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 232 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 233 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 236 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 350 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 359 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 360 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 361 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 365 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 366 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 367 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 368 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 369 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 370 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 371 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 372 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 373 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 374 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 375 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 376 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 377 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 378 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.97 |
| Metatranscriptomes | 0 |
| Isolates | 14.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.66 |
| Bulb | 0 |
| Endosphere | 16.67 |
| Nodule | 0.83 |
| Rhizoplane | 4.13 |
| Rhizosphere | 62.71 |
| Stem | 0.17 |
| Stem Tuber | 0.99 |
| Unclassified | 13.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10001449 | 3300001989 | Bacteria | 8945 |
| 2 | JGI25158J39367_1001204 | 3300002739 | Bacteria | 4656 |
| 3 | JGI25150J39212_1014055 | 3300002774 | Bacteria | 1369 |
| 4 | JGI25159J45721_1003511 | 3300002987 | Bacteria | 5528 |
| 5 | JGI25159J45721_1007402 | 3300002987 | Bacteria | 3152 |
| 6 | JGI25151J46595_10002117 | 3300003187 | Bacteria | 12382 |
| 7 | JGI25151J46595_10004389 | 3300003187 | Bacteria | 7473 |
| 8 | rootL2_10092461 | 3300003322 | Bacteria | 1899 |
| 9 | rootL2_10237592 | 3300003322 | Bacteria | 1191 |
| 10 | JGI25160J50197_1001730 | 3300003354 | Bacteria | 10587 |
| 11 | JGI25161J50226_1000606 | 3300003374 | Bacteria | 14819 |
| 12 | JGI25161J50226_1001465 | 3300003374 | Bacteria | 7065 |
| 13 | Ga0055538_1000085 | 3300003751 | Bacteria | 81616 |
| 14 | Ga0055539_1000126 | 3300003752 | Bacteria | 81616 |
| 15 | Ga0055533_1000133 | 3300003756 | Bacteria | 81616 |
| 16 | Ga0055525_1000174 | 3300003759 | Bacteria | 81616 |
| 17 | Ga0055526_1001791 | 3300003771 | Bacteria | 14891 |
| 18 | Ga0055526_1004751 | 3300003771 | Bacteria | 8049 |
| 19 | Ga0055526_1006655 | 3300003771 | Bacteria | 6205 |
| 20 | Ga0055526_1008218 | 3300003771 | Bacteria | 5247 |
| 21 | Ga0055526_1010844 | 3300003771 | Bacteria | 4189 |
| 22 | Ga0055537_1004773 | 3300003773 | Bacteria | 3792 |
| 23 | Ga0055537_1015044 | 3300003773 | Bacteria | 1374 |
| 24 | Ga0055524_1002928 | 3300003775 | Bacteria | 8517 |
| 25 | Ga0055524_1012342 | 3300003775 | Bacteria | 3282 |
| 26 | Ga0055524_1015761 | 3300003775 | Bacteria | 2741 |
| 27 | Ga0055536_1000930 | 3300003781 | Bacteria | 18850 |
| 28 | Ga0055534_1001068 | 3300003784 | Bacteria | 11830 |
| 29 | Ga0055534_1001951 | 3300003784 | Bacteria | 7570 |
| 30 | Ga0055534_1003336 | 3300003784 | Bacteria | 5084 |
| 31 | Ga0055528_1006649 | 3300003790 | Bacteria | 5218 |
| 32 | Ga0055530_10008784 | 3300003791 | Bacteria | 3989 |
| 33 | Ga0055530_10024105 | 3300003791 | Bacteria | 1734 |
| 34 | Ga0055531_10012375 | 3300003794 | Bacteria | 4020 |
| 35 | Ga0055541_1000085 | 3300003841 | Bacteria | 81616 |
| 36 | Ga0055543_1000387 | 3300004625 | Bacteria | 28496 |
| 37 | Ga0065165_1002619 | 3300005262 | Bacteria | 14667 |
| 38 | Ga0070683_100432375 | 3300005329 | Bacteria | 1256 |
| 39 | Ga0070690_100255160 | 3300005330 | Bacteria | 1242 |
| 40 | Ga0070690_100356754 | 3300005330 | Bacteria | 1063 |
| 41 | Ga0070661_100021266 | 3300005344 | Bacteria | 4632 |
| 42 | Ga0070671_100145964 | 3300005355 | Bacteria | 1997 |
| 43 | Ga0070667_100027200 | 3300005367 | Bacteria | 4759 |
| 44 | Ga0070709_10363736 | 3300005434 | Bacteria | 1072 |
| 45 | Ga0070713_100003725 | 3300005436 | Bacteria | 10091 |
| 46 | Ga0070711_100071818 | 3300005439 | Unclassified | 2441 |
| 47 | Ga0070678_100184194 | 3300005456 | Bacteria | 1712 |
| 48 | Ga0068867_100150992 | 3300005459 | Bacteria | 1825 |
| 49 | Ga0068867_100459301 | 3300005459 | Bacteria | 1087 |
| 50 | Ga0070685_10244327 | 3300005466 | Bacteria | 1186 |
| 51 | Ga0070704_100201971 | 3300005549 | Bacteria | 1605 |
| 52 | Ga0068855_100450959 | 3300005563 | Bacteria | 1404 |
| 53 | Ga0070664_100122852 | 3300005564 | Bacteria | 2275 |
| 54 | Ga0068857_100362807 | 3300005577 | Bacteria | 1343 |
| 55 | Ga0070702_100267263 | 3300005615 | Bacteria | 1168 |
| 56 | Ga0068852_100012173 | 3300005616 | Bacteria | 6517 |
| 57 | Ga0068858_100443357 | 3300005842 | Bacteria | 1251 |
| 58 | Ga0068862_100174950 | 3300005844 | Bacteria | 1924 |
| 59 | Ga0081455_10005392 | 3300005937 | Bacteria | 14037 |
| 60 | Ga0075364_10001253 | 3300006051 | Bacteria | 13636 |
| 61 | Ga0075364_10159068 | 3300006051 | Bacteria | 1524 |
| 62 | Ga0075432_10048059 | 3300006058 | Bacteria | 1500 |
| 63 | Ga0075366_10012944 | 3300006195 | Bacteria | 4741 |
| 64 | Ga0075366_10092392 | 3300006195 | Bacteria | 1813 |
| 65 | Ga0075366_10094626 | 3300006195 | Bacteria | 1791 |
| 66 | Ga0075370_10223415 | 3300006353 | Bacteria | 1113 |
| 67 | Ga0075370_10273172 | 3300006353 | Bacteria | 1003 |
| 68 | Ga0099826_10000024 | 3300006948 | Bacteria | 148974 |
| 69 | Ga0105251_10001860 | 3300009011 | Bacteria | 17339 |
| 70 | Ga0105251_10006802 | 3300009011 | Bacteria | 7211 |
| 71 | Ga0105251_10013135 | 3300009011 | Bacteria | 4647 |
| 72 | Ga0105251_10029983 | 3300009011 | Bacteria | 2735 |
| 73 | Ga0105251_10118358 | 3300009011 | Bacteria | 1204 |
| 74 | Ga0105251_10130498 | 3300009011 | Bacteria | 1139 |
| 75 | Ga0105244_10002459 | 3300009036 | Bacteria | 13950 |
| 76 | Ga0105244_10030322 | 3300009036 | Bacteria | 2878 |
| 77 | Ga0105244_10050529 | 3300009036 | Bacteria | 2121 |
| 78 | Ga0105244_10050822 | 3300009036 | Bacteria | 2114 |
| 79 | Ga0105244_10052701 | 3300009036 | Bacteria | 2070 |
| 80 | Ga0105250_10025778 | 3300009092 | Bacteria | 2369 |
| 81 | Ga0105240_10193519 | 3300009093 | Bacteria | 2390 |
| 82 | Ga0105245_10334489 | 3300009098 | Bacteria | 1496 |
| 83 | Ga0105243_10001514 | 3300009148 | Bacteria | 20298 |
| 84 | Ga0105242_10040170 | 3300009176 | Bacteria | 3769 |
| 85 | Ga0105242_10156295 | 3300009176 | Bacteria | 1992 |
| 86 | Ga0105248_10168846 | 3300009177 | Bacteria | 2466 |
| 87 | Ga0105248_10402940 | 3300009177 | Bacteria | 1540 |
| 88 | Ga0105237_10329849 | 3300009545 | Bacteria | 1530 |
| 89 | Ga0105237_10389689 | 3300009545 | Bacteria | 1398 |
| 90 | Ga0105249_10029317 | 3300009553 | Bacteria | 4970 |
| 91 | Ga0105239_10474238 | 3300010375 | Bacteria | 1421 |
| 92 | Ga0157373_10001293 | 3300013100 | Bacteria | 19108 |
| 93 | Ga0157371_10000646 | 3300013102 | Bacteria | 41280 |
| 94 | Ga0157371_10013316 | 3300013102 | Bacteria | 6254 |
| 95 | Ga0157370_10003676 | 3300013104 | Bacteria | 17919 |
| 96 | Ga0157369_10041346 | 3300013105 | Bacteria | 5032 |
| 97 | Ga0157369_10075469 | 3300013105 | Bacteria | 3615 |
| 98 | Ga0157374_10087383 | 3300013296 | Bacteria | 2967 |
| 99 | Ga0163162_10000877 | 3300013306 | Bacteria | 28017 |
| 100 | Ga0163162_10025423 | 3300013306 | Bacteria | 5850 |
| 101 | Ga0157372_10158180 | 3300013307 | Bacteria | 2618 |
| 102 | Ga0157375_10000712 | 3300013308 | Bacteria | 29330 |
| 103 | Ga0157375_10024508 | 3300013308 | Bacteria | 5586 |
| 104 | Ga0157376_10001938 | 3300014969 | Bacteria | 13825 |
| 105 | Ga0182006_1057689 | 3300015261 | Bacteria | 1475 |
| 106 | Ga0163161_10173506 | 3300017792 | Bacteria | 1650 |
| 107 | Ga0213872_10002585 | 3300021361 | Bacteria | 10537 |
| 108 | Ga0213872_10005344 | 3300021361 | Bacteria | 6628 |
| 109 | Ga0209436_101442 | 3300025208 | Bacteria | 8316 |
| 110 | Ga0209436_101963 | 3300025208 | Bacteria | 6584 |
| 111 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 112 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 113 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 114 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 115 | Ga0207425_1002181 | 3300025245 | Bacteria | 7126 |
| 116 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 117 | Ga0209565_1000261 | 3300025263 | Bacteria | 55346 |
| 118 | Ga0209565_1000875 | 3300025263 | Bacteria | 16585 |
| 119 | Ga0209565_1000887 | 3300025263 | Bacteria | 16310 |
| 120 | Ga0209565_1002237 | 3300025263 | Bacteria | 7216 |
| 121 | Ga0209565_1005710 | 3300025263 | Bacteria | 3586 |
| 122 | Ga0209565_1009870 | 3300025263 | Bacteria | 2392 |
| 123 | Ga0209673_1010896 | 3300025273 | Bacteria | 3795 |
| 124 | Ga0209673_1019523 | 3300025273 | Bacteria | 2430 |
| 125 | Ga0209130_1000740 | 3300025284 | Bacteria | 28631 |
| 126 | Ga0209130_1002172 | 3300025284 | Bacteria | 10338 |
| 127 | Ga0209130_1002173 | 3300025284 | Bacteria | 10338 |
| 128 | Ga0209675_1000156 | 3300025291 | Bacteria | 88813 |
| 129 | Ga0209675_1001351 | 3300025291 | Bacteria | 14481 |
| 130 | Ga0209675_1006893 | 3300025291 | Bacteria | 4467 |
| 131 | Ga0209675_1009127 | 3300025291 | Bacteria | 3537 |
| 132 | Ga0209675_1016789 | 3300025291 | Bacteria | 2117 |
| 133 | Ga0209676_1000364 | 3300025292 | Bacteria | 85375 |
| 134 | Ga0209676_1006762 | 3300025292 | Bacteria | 5573 |
| 135 | Ga0209025_1000417 | 3300025294 | Bacteria | 85342 |
| 136 | Ga0209025_1000473 | 3300025294 | Bacteria | 78078 |
| 137 | Ga0209025_1000516 | 3300025294 | Bacteria | 73496 |
| 138 | Ga0209025_1000885 | 3300025294 | Bacteria | 46908 |
| 139 | Ga0209564_1000067 | 3300025295 | Bacteria | 311242 |
| 140 | Ga0209564_1000611 | 3300025295 | Bacteria | 55354 |
| 141 | Ga0209564_1000658 | 3300025295 | Bacteria | 51441 |
| 142 | Ga0209564_1000709 | 3300025295 | Bacteria | 48568 |
| 143 | Ga0209564_1003115 | 3300025295 | Bacteria | 11707 |
| 144 | Ga0209758_1026126 | 3300025297 | Bacteria | 2538 |
| 145 | Ga0209050_1000040 | 3300025298 | Bacteria | 408492 |
| 146 | Ga0209050_1000365 | 3300025298 | Bacteria | 86866 |
| 147 | Ga0209050_1005050 | 3300025298 | Bacteria | 8542 |
| 148 | Ga0209256_1001277 | 3300025299 | Bacteria | 27307 |
| 149 | Ga0209256_1001546 | 3300025299 | Bacteria | 22955 |
| 150 | Ga0209256_1001662 | 3300025299 | Bacteria | 21619 |
| 151 | Ga0209256_1004683 | 3300025299 | Bacteria | 8390 |
| 152 | Ga0207426_1005381 | 3300025302 | Bacteria | 5867 |
| 153 | Ga0209051_1026012 | 3300025303 | Bacteria | 2368 |
| 154 | Ga0209257_1000054 | 3300025304 | Bacteria | 416957 |
| 155 | Ga0207696_1000062 | 3300025711 | Bacteria | 239603 |
| 156 | Ga0207696_1027099 | 3300025711 | Bacteria | 1769 |
| 157 | Ga0207655_1008198 | 3300025728 | Bacteria | 6665 |
| 158 | Ga0207713_1005377 | 3300025735 | Bacteria | 8033 |
| 159 | Ga0207713_1073427 | 3300025735 | Bacteria | 1255 |
| 160 | Ga0207680_10034651 | 3300025903 | Bacteria | 2890 |
| 161 | Ga0207680_10057067 | 3300025903 | Bacteria | 2361 |
| 162 | Ga0207647_10012034 | 3300025904 | Bacteria | 6038 |
| 163 | Ga0207699_10179236 | 3300025906 | Bacteria | 1423 |
| 164 | Ga0207699_10188998 | 3300025906 | Bacteria | 1389 |
| 165 | Ga0207705_10131665 | 3300025909 | Bacteria | 1862 |
| 166 | Ga0207654_10080223 | 3300025911 | Bacteria | 1962 |
| 167 | Ga0207695_10075649 | 3300025913 | Bacteria | 3425 |
| 168 | Ga0207663_10090009 | 3300025916 | Unclassified | 2034 |
| 169 | Ga0207649_10175520 | 3300025920 | Bacteria | 1496 |
| 170 | Ga0207681_10167718 | 3300025923 | Bacteria | 1661 |
| 171 | Ga0207659_10330526 | 3300025926 | Bacteria | 1260 |
| 172 | Ga0207700_10006080 | 3300025928 | Bacteria | 7271 |
| 173 | Ga0207644_10308606 | 3300025931 | Bacteria | 1277 |
| 174 | Ga0207690_10050490 | 3300025932 | Bacteria | 2777 |
| 175 | Ga0207686_10069512 | 3300025934 | Bacteria | 2259 |
| 176 | Ga0207709_10000579 | 3300025935 | Bacteria | 30727 |
| 177 | Ga0207711_10236639 | 3300025941 | Bacteria | 1674 |
| 178 | Ga0207661_10305054 | 3300025944 | Bacteria | 1428 |
| 179 | Ga0207679_10151939 | 3300025945 | Bacteria | 1886 |
| 180 | Ga0207667_10062473 | 3300025949 | Bacteria | 3894 |
| 181 | Ga0207667_10196800 | 3300025949 | Bacteria | 2068 |
| 182 | Ga0207668_10132781 | 3300025972 | Bacteria | 1903 |
| 183 | Ga0207658_10124430 | 3300025986 | Bacteria | 2061 |
| 184 | Ga0207658_10346976 | 3300025986 | Bacteria | 1292 |
| 185 | Ga0207678_10041247 | 3300026067 | Bacteria | 4002 |
| 186 | Ga0207648_10007928 | 3300026089 | Bacteria | 10354 |
| 187 | Ga0207676_10236376 | 3300026095 | Bacteria | 1636 |
| 188 | Ga0207674_10003476 | 3300026116 | Bacteria | 19265 |
| 189 | Ga0207674_10365303 | 3300026116 | Bacteria | 1395 |
| 190 | Ga0207675_100244032 | 3300026118 | Bacteria | 1736 |
| 191 | Ga0207683_10021386 | 3300026121 | Bacteria | 5538 |
| 192 | Ga0207683_10199876 | 3300026121 | Bacteria | 1816 |
| 193 | Ga0207698_10051721 | 3300026142 | Bacteria | 3142 |
| 194 | Ga0209282_1000032 | 3300027666 | Bacteria | 149218 |
| 195 | Ga0268266_10185254 | 3300028379 | Bacteria | 1898 |
| 196 | Ga0265336_10000185 | 3300028666 | Bacteria | 43870 |
| 197 | Ga0307515_10000354 | 3300028794 | Bacteria | 112621 |
| 198 | Ga0307515_10007796 | 3300028794 | Bacteria | 21069 |
| 199 | Ga0307515_10009311 | 3300028794 | Bacteria | 19001 |
| 200 | Ga0265324_10000011 | 3300029957 | Bacteria | 218521 |
| 201 | Ga0265324_10048255 | 3300029957 | Bacteria | 1464 |
| 202 | Ga0307512_10113086 | 3300030522 | Bacteria | 1778 |
| 203 | Ga0316181_1030137 | 3300030744 | Bacteria | 3669 |
| 204 | Ga0265328_10000016 | 3300031239 | Bacteria | 132959 |
| 205 | Ga0265325_10000447 | 3300031241 | Bacteria | 29700 |
| 206 | Ga0265331_10006445 | 3300031250 | Bacteria | 6935 |
| 207 | Ga0265327_10004511 | 3300031251 | Bacteria | 12286 |
| 208 | Ga0265327_10053308 | 3300031251 | Bacteria | 2100 |
| 209 | Ga0307513_10010732 | 3300031456 | Bacteria | 11453 |
| 210 | Ga0307509_10024723 | 3300031507 | Bacteria | 6722 |
| 211 | Ga0307408_100003180 | 3300031548 | Bacteria | 11317 |
| 212 | Ga0307408_100011951 | 3300031548 | Bacteria | 5745 |
| 213 | Ga0307408_100273235 | 3300031548 | Bacteria | 1404 |
| 214 | Ga0307408_100464469 | 3300031548 | Bacteria | 1101 |
| 215 | Ga0307408_100469253 | 3300031548 | Bacteria | 1095 |
| 216 | Ga0307508_10000043 | 3300031616 | Bacteria | 143889 |
| 217 | Ga0307514_10078874 | 3300031649 | Bacteria | 2443 |
| 218 | Ga0307514_10086174 | 3300031649 | Bacteria | 2306 |
| 219 | Ga0316579_10079847 | 3300031691 | Bacteria | 1557 |
| 220 | Ga0265314_10018536 | 3300031711 | Bacteria | 5424 |
| 221 | Ga0265314_10119173 | 3300031711 | Bacteria | 1664 |
| 222 | Ga0316576_10026359 | 3300031727 | Bacteria | 4079 |
| 223 | Ga0307516_10013442 | 3300031730 | Bacteria | 8723 |
| 224 | Ga0307406_10003957 | 3300031901 | Bacteria | 8050 |
| 225 | Ga0307412_10000078 | 3300031911 | Bacteria | 94880 |
| 226 | Ga0307507_10061383 | 3300033179 | Bacteria | 3500 |
| 227 | Ga0373959_0039794 | 3300034820 | Bacteria | 982 |
| 228 | Ga0373923_0100472 | 3300035111 | Bacteria | 1275 |
| 229 | Ga0373941_0008136 | 3300035115 | Bacteria | 2596 |
| 230 | Ga0373960_0018787 | 3300035121 | Bacteria | 1808 |
| 231 | Ga0373955_0002705 | 3300035172 | Bacteria | 7765 |
| 232 | Ga0373961_0008029 | 3300035241 | Bacteria | 2563 |
| 233 | Ga0373931_0007581 | 3300035691 | Bacteria | 5113 |
| 234 | Ga0373933_0144079 | 3300035724 | Bacteria | 1506 |
| 235 | Ga0373937_0128978 | 3300036401 | Bacteria | 2361 |
| 236 | Ga0316582_0193553 | 3300036647 | Bacteria | 1386 |
| 237 | Ga0436360_0106361 | 3300039438 | Bacteria | 3201 |
| 238 | Ga0436361_0276775 | 3300039447 | Bacteria | 18967 |
| 239 | Ga0436361_0432344 | 3300039447 | Bacteria | 27994 |
| 240 | Ga0439465_0008062 | 3300041413 | Bacteria | 3332 |
| 241 | Ga0451793_0774530 | 3300041452 | Bacteria | 1639 |
| 242 | Ga0451807_1996062 | 3300041486 | Bacteria | 1133 |
| 243 | Ga0439449_0000072 | 3300042007 | Bacteria | 32024 |
| 244 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 245 | Ga0450911_009727 | 3300042115 | Bacteria | 1342 |
| 246 | Ga0451577_0098152 | 3300042876 | Bacteria | 2616 |
| 247 | Ga0451577_0417004 | 3300042876 | Bacteria | 1219 |
| 248 | Ga0466972_0008985 | 3300044658 | Bacteria | 5016 |
| 249 | Ga0466972_0056855 | 3300044658 | Bacteria | 1880 |
| 250 | Ga0453683_0163532 | 3300044673 | Bacteria | 1409 |
| 251 | Ga0466965_0002392 | 3300044683 | Bacteria | 7954 |
| 252 | Ga0466964_0036475 | 3300044706 | Bacteria | 1971 |
| 253 | Ga0453684_0001224 | 3300044712 | Bacteria | 78768 |
| 254 | Ga0453684_0005573 | 3300044712 | Bacteria | 24814 |
| 255 | Ga0466968_0004690 | 3300044735 | Bacteria | 5122 |
| 256 | Ga0451576_0000677 | 3300045051 | Bacteria | 69349 |
| 257 | Ga0451576_0009742 | 3300045051 | Bacteria | 11110 |
| 258 | Ga0451576_0038638 | 3300045051 | Bacteria | 5052 |
| 259 | Ga0451576_0272612 | 3300045051 | Bacteria | 1769 |
| 260 | Ga0451576_0351515 | 3300045051 | Bacteria | 1543 |
| 261 | Ga0495617_004710 | 3300046452 | Bacteria | 4934 |
| 262 | Ga0495590_0006781 | 3300046457 | Bacteria | 4451 |
| 263 | Ga0495590_0007599 | 3300046457 | Bacteria | 4168 |
| 264 | Ga0495590_0011466 | 3300046457 | Bacteria | 3314 |
| 265 | Ga0495591_000007 | 3300046458 | Bacteria | 366385 |
| 266 | Ga0495638_0000875 | 3300046460 | Bacteria | 31213 |
| 267 | Ga0495638_0084453 | 3300046460 | Bacteria | 1921 |
| 268 | Ga0495653_0023473 | 3300046463 | Bacteria | 4982 |
| 269 | Ga0495650_0019444 | 3300046471 | Bacteria | 3342 |
| 270 | Ga0495582_0000964 | 3300046473 | Bacteria | 16070 |
| 271 | Ga0495605_0003074 | 3300046474 | Bacteria | 10072 |
| 272 | Ga0495605_0005630 | 3300046474 | Bacteria | 7279 |
| 273 | Ga0495605_0027728 | 3300046474 | Bacteria | 2931 |
| 274 | Ga0495584_0005537 | 3300046491 | Bacteria | 6685 |
| 275 | Ga0495584_0007112 | 3300046491 | Bacteria | 5847 |
| 276 | Ga0495584_0008704 | 3300046491 | Bacteria | 5248 |
| 277 | Ga0495584_0036117 | 3300046491 | Bacteria | 2496 |
| 278 | Ga0495584_0040001 | 3300046491 | Bacteria | 2368 |
| 279 | Ga0495584_0047766 | 3300046491 | Bacteria | 2158 |
| 280 | Ga0495584_0081926 | 3300046491 | Bacteria | 1624 |
| 281 | Ga0495585_0003733 | 3300046492 | Bacteria | 10172 |
| 282 | Ga0495585_0011370 | 3300046492 | Bacteria | 5267 |
| 283 | Ga0495585_0016609 | 3300046492 | Bacteria | 4265 |
| 284 | Ga0495585_0021113 | 3300046492 | Bacteria | 3740 |
| 285 | Ga0495585_0032238 | 3300046492 | Bacteria | 2968 |
| 286 | Ga0495585_0044887 | 3300046492 | Bacteria | 2468 |
| 287 | Ga0495585_0047179 | 3300046492 | Bacteria | 2399 |
| 288 | Ga0495596_0000367 | 3300046500 | Bacteria | 29049 |
| 289 | Ga0495596_0005631 | 3300046500 | Bacteria | 5884 |
| 290 | Ga0495596_0016351 | 3300046500 | Bacteria | 3084 |
| 291 | Ga0495607_0002495 | 3300046501 | Bacteria | 14909 |
| 292 | Ga0495607_0023352 | 3300046501 | Bacteria | 3872 |
| 293 | Ga0495607_0032627 | 3300046501 | Bacteria | 3176 |
| 294 | Ga0495607_0069310 | 3300046501 | Bacteria | 1974 |
| 295 | Ga0495583_0000099 | 3300046506 | Bacteria | 148167 |
| 296 | Ga0495583_0021534 | 3300046506 | Bacteria | 3314 |
| 297 | Ga0495583_0082262 | 3300046506 | Bacteria | 1397 |
| 298 | Ga0495606_0000314 | 3300046507 | Bacteria | 83573 |
| 299 | Ga0495606_0082035 | 3300046507 | Bacteria | 2003 |
| 300 | Ga0495610_0001046 | 3300046512 | Bacteria | 25419 |
| 301 | Ga0495610_0082249 | 3300046512 | Bacteria | 1476 |
| 302 | Ga0495616_0007675 | 3300046513 | Bacteria | 6449 |
| 303 | Ga0495616_0080131 | 3300046513 | Bacteria | 1564 |
| 304 | Ga0495620_0035857 | 3300046515 | Bacteria | 2226 |
| 305 | Ga0495628_0033791 | 3300046516 | Bacteria | 4119 |
| 306 | Ga0495631_0003567 | 3300046518 | Bacteria | 8502 |
| 307 | Ga0495631_0036378 | 3300046518 | Bacteria | 2198 |
| 308 | Ga0495631_0115215 | 3300046518 | Bacteria | 1155 |
| 309 | Ga0495643_0002757 | 3300046522 | Bacteria | 13464 |
| 310 | Ga0495643_0009145 | 3300046522 | Bacteria | 6192 |
| 311 | Ga0495643_0034891 | 3300046522 | Bacteria | 2772 |
| 312 | Ga0495644_0001980 | 3300046523 | Bacteria | 8219 |
| 313 | Ga0495644_0054541 | 3300046523 | Bacteria | 1501 |
| 314 | Ga0495648_0002571 | 3300046524 | Bacteria | 16637 |
| 315 | Ga0495648_0013334 | 3300046524 | Bacteria | 6083 |
| 316 | Ga0495648_0015309 | 3300046524 | Bacteria | 5576 |
| 317 | Ga0495648_0054436 | 3300046524 | Bacteria | 2417 |
| 318 | Ga0495663_0014702 | 3300046525 | Bacteria | 2196 |
| 319 | Ga0495663_0046829 | 3300046525 | Bacteria | 1329 |
| 320 | Ga0495666_0001332 | 3300046526 | Bacteria | 11956 |
| 321 | Ga0495642_0003493 | 3300046528 | Bacteria | 6194 |
| 322 | Ga0495642_0016071 | 3300046528 | Bacteria | 2914 |
| 323 | Ga0495642_0026488 | 3300046528 | Bacteria | 2303 |
| 324 | Ga0495642_0066718 | 3300046528 | Bacteria | 1500 |
| 325 | Ga0495652_0052830 | 3300046529 | Bacteria | 3464 |
| 326 | Ga0495654_0000007 | 3300046530 | Bacteria | 403529 |
| 327 | Ga0495654_0003376 | 3300046530 | Bacteria | 9833 |
| 328 | Ga0495654_0037963 | 3300046530 | Bacteria | 2411 |
| 329 | Ga0495665_0015305 | 3300046531 | Bacteria | 4132 |
| 330 | Ga0495640_0039917 | 3300046533 | Bacteria | 3290 |
| 331 | Ga0495609_0009946 | 3300046538 | Bacteria | 4580 |
| 332 | Ga0495609_0011758 | 3300046538 | Bacteria | 4162 |
| 333 | Ga0495609_0024920 | 3300046538 | Bacteria | 2743 |
| 334 | Ga0495609_0047481 | 3300046538 | Bacteria | 1921 |
| 335 | Ga0495609_0053503 | 3300046538 | Bacteria | 1794 |
| 336 | Ga0495597_0000372 | 3300046542 | Bacteria | 39468 |
| 337 | Ga0495597_0002800 | 3300046542 | Bacteria | 10714 |
| 338 | Ga0495597_0014646 | 3300046542 | Bacteria | 3730 |
| 339 | Ga0495597_0015156 | 3300046542 | Bacteria | 3653 |
| 340 | Ga0495597_0031013 | 3300046542 | Bacteria | 2434 |
| 341 | Ga0495645_0003820 | 3300046543 | Bacteria | 10243 |
| 342 | Ga0495622_0025750 | 3300046557 | Bacteria | 2747 |
| 343 | Ga0495633_0002768 | 3300046558 | Bacteria | 12125 |
| 344 | Ga0495633_0053185 | 3300046558 | Bacteria | 1906 |
| 345 | Ga0495633_0075337 | 3300046558 | Bacteria | 1571 |
| 346 | Ga0495667_0065328 | 3300046559 | Bacteria | 2380 |
| 347 | Ga0495668_0005614 | 3300046616 | Bacteria | 8435 |
| 348 | Ga0495668_0010491 | 3300046616 | Bacteria | 5604 |
| 349 | Ga0495611_0003774 | 3300046648 | Bacteria | 6615 |
| 350 | Ga0495611_0009669 | 3300046648 | Bacteria | 4074 |
| 351 | Ga0495611_0011658 | 3300046648 | Bacteria | 3729 |
| 352 | Ga0495625_0003495 | 3300046660 | Bacteria | 15582 |
| 353 | Ga0495625_0004095 | 3300046660 | Bacteria | 13921 |
| 354 | Ga0495625_0189081 | 3300046660 | Bacteria | 1365 |
| 355 | Ga0495625_0277827 | 3300046660 | Bacteria | 1078 |
| 356 | Ga0495625_0279132 | 3300046660 | Bacteria | 1075 |
| 357 | Ga0495659_0000072 | 3300046664 | Bacteria | 42932 |
| 358 | Ga0495659_0000462 | 3300046664 | Bacteria | 15161 |
| 359 | Ga0495661_0002151 | 3300046665 | Bacteria | 15415 |
| 360 | Ga0495661_0023405 | 3300046665 | Bacteria | 4010 |
| 361 | Ga0495661_0029346 | 3300046665 | Bacteria | 3511 |
| 362 | Ga0495661_0051408 | 3300046665 | Bacteria | 2488 |
| 363 | Ga0495661_0154952 | 3300046665 | Bacteria | 1234 |
| 364 | Ga0495661_0234909 | 3300046665 | Bacteria | 943 |
| 365 | Ga0495623_0135123 | 3300046679 | Bacteria | 1472 |
| 366 | Ga0495623_0150933 | 3300046679 | Bacteria | 1373 |
| 367 | Ga0495623_0242116 | 3300046679 | Bacteria | 1018 |
| 368 | Ga0495669_0000061 | 3300046684 | Bacteria | 72014 |
| 369 | Ga0495669_0019302 | 3300046684 | Bacteria | 2941 |
| 370 | Ga0495670_0000980 | 3300046691 | Bacteria | 13848 |
| 371 | Ga0495670_0103141 | 3300046691 | Bacteria | 1470 |
| 372 | Ga0495670_0298923 | 3300046691 | Bacteria | 862 |
| 373 | Ga0495671_0000281 | 3300046692 | Bacteria | 42628 |
| 374 | Ga0495671_0002714 | 3300046692 | Bacteria | 11077 |
| 375 | Ga0495671_0109434 | 3300046692 | Bacteria | 1349 |
| 376 | Ga0495671_0198393 | 3300046692 | Bacteria | 973 |
| 377 | Ga0495649_0005692 | 3300046694 | Bacteria | 7865 |
| 378 | Ga0495649_0006153 | 3300046694 | Bacteria | 7498 |
| 379 | Ga0495649_0010368 | 3300046694 | Bacteria | 5501 |
| 380 | Ga0495589_0001288 | 3300046794 | Bacteria | 14823 |
| 381 | Ga0495589_0007740 | 3300046794 | Bacteria | 5623 |
| 382 | Ga0495589_0075772 | 3300046794 | Bacteria | 1640 |
| 383 | Ga0495660_0000355 | 3300046810 | Bacteria | 40502 |
| 384 | Ga0495660_0099940 | 3300046810 | Bacteria | 1495 |
| 385 | Ga0495581_0003008 | 3300047315 | Bacteria | 9653 |
| 386 | Ga0495636_0015212 | 3300047318 | Bacteria | 3066 |
| 387 | Ga0495636_0022380 | 3300047318 | Bacteria | 2554 |
| 388 | Ga0495636_0054269 | 3300047318 | Bacteria | 1684 |
| 389 | Ga0495636_0057185 | 3300047318 | Bacteria | 1642 |
| 390 | Ga0495672_0000026 | 3300047320 | Bacteria | 340319 |
| 391 | Ga0495672_0008932 | 3300047320 | Bacteria | 7318 |
| 392 | Ga0495672_0024235 | 3300047320 | Bacteria | 3913 |
| 393 | Ga0495672_0153549 | 3300047320 | Bacteria | 1191 |
| 394 | Ga0495676_0000025 | 3300047321 | Bacteria | 149350 |
| 395 | Ga0495680_0168764 | 3300047322 | Bacteria | 1585 |
| 396 | Ga0495683_0028552 | 3300047323 | Bacteria | 2851 |
| 397 | Ga0495687_000117 | 3300047443 | Bacteria | 122591 |
| 398 | Ga0495687_000314 | 3300047443 | Bacteria | 63156 |
| 399 | Ga0495687_000687 | 3300047443 | Bacteria | 38367 |
| 400 | Ga0495687_032347 | 3300047443 | Bacteria | 2389 |
| 401 | Ga0495675_0117936 | 3300047444 | Bacteria | 1654 |
| 402 | Ga0495677_0008307 | 3300047445 | Bacteria | 3857 |
| 403 | Ga0495677_0011569 | 3300047445 | Bacteria | 3226 |
| 404 | Ga0495677_0033900 | 3300047445 | Bacteria | 1861 |
| 405 | Ga0495685_000008 | 3300047447 | Bacteria | 95629 |
| 406 | Ga0495685_015798 | 3300047447 | Bacteria | 2578 |
| 407 | Ga0495685_053060 | 3300047447 | Bacteria | 1373 |
| 408 | Ga0495673_0068892 | 3300047469 | Bacteria | 1494 |
| 409 | Ga0495681_0002626 | 3300047470 | Bacteria | 12772 |
| 410 | Ga0495681_0006316 | 3300047470 | Bacteria | 7801 |
| 411 | Ga0495681_0035561 | 3300047470 | Bacteria | 2472 |
| 412 | Ga0495681_0068879 | 3300047470 | Unclassified | 1609 |
| 413 | Ga0495684_0064468 | 3300047471 | Bacteria | 2785 |
| 414 | Ga0495686_0015707 | 3300047472 | Bacteria | 5159 |
| 415 | Ga0495593_0021020 | 3300047673 | Bacteria | 3649 |
| 416 | Ga0495614_0006276 | 3300048089 | Bacteria | 5339 |
| 417 | Ga0496100_0263304 | 3300048903 | Bacteria | 1279 |
| 418 | Ga0496101_0000093 | 3300048904 | Bacteria | 95734 |
| 419 | Ga0496102_0000024 | 3300048905 | Bacteria | 227873 |
| 420 | Ga0496102_0006320 | 3300048905 | Bacteria | 10101 |
| 421 | Ga0496102_0095687 | 3300048905 | Bacteria | 2753 |
| 422 | Ga0496103_0208828 | 3300048906 | Bacteria | 1256 |
| 423 | Ga0496104_0000365 | 3300048907 | Bacteria | 40128 |
| 424 | Ga0496104_0174552 | 3300048907 | Bacteria | 2060 |
| 425 | Ga0496104_0382911 | 3300048907 | Bacteria | 1319 |
| 426 | Ga0496105_0000048 | 3300048908 | Bacteria | 96832 |
| 427 | Ga0496106_0028887 | 3300048909 | Bacteria | 4133 |
| 428 | Ga0496106_0118047 | 3300048909 | Bacteria | 2071 |
| 429 | Ga0496107_0047525 | 3300048910 | Bacteria | 3090 |
| 430 | Ga0496110_0001900 | 3300048913 | Bacteria | 15447 |
| 431 | Ga0496110_0326130 | 3300048913 | Bacteria | 1398 |
| 432 | Ga0496111_0063039 | 3300048914 | Bacteria | 2688 |
| 433 | Ga0496111_0105745 | 3300048914 | Bacteria | 2071 |
| 434 | Ga0496115_0033943 | 3300048918 | Bacteria | 4032 |
| 435 | Ga0496116_0000300 | 3300048919 | Bacteria | 83621 |
| 436 | Ga0496116_0001249 | 3300048919 | Bacteria | 29528 |
| 437 | Ga0496116_0003969 | 3300048919 | Bacteria | 14365 |
| 438 | Ga0496116_0008151 | 3300048919 | Bacteria | 9150 |
| 439 | Ga0496116_0010398 | 3300048919 | Bacteria | 7802 |
| 440 | Ga0496116_0088929 | 3300048919 | Bacteria | 1886 |
| 441 | Ga0496117_0000388 | 3300048920 | Bacteria | 75480 |
| 442 | Ga0496117_0158579 | 3300048920 | Bacteria | 1329 |
| 443 | Ga0496117_0176194 | 3300048920 | Bacteria | 1235 |
| 444 | Ga0496117_0193438 | 3300048920 | Bacteria | 1156 |
| 445 | Ga0496118_0007368 | 3300048921 | Bacteria | 11689 |
| 446 | Ga0496118_0013709 | 3300048921 | Bacteria | 7648 |
| 447 | Ga0496119_0017822 | 3300048922 | Bacteria | 5323 |
| 448 | Ga0496119_0046138 | 3300048922 | Bacteria | 2725 |
| 449 | Ga0496120_0001787 | 3300048923 | Bacteria | 24170 |
| 450 | Ga0496120_0013447 | 3300048923 | Bacteria | 5507 |
| 451 | Ga0496121_0000153 | 3300048924 | Bacteria | 150635 |
| 452 | Ga0496121_0008698 | 3300048924 | Bacteria | 11854 |
| 453 | Ga0496122_0000186 | 3300048925 | Bacteria | 144012 |
| 454 | Ga0496122_0003402 | 3300048925 | Bacteria | 20931 |
| 455 | Ga0496122_0006111 | 3300048925 | Bacteria | 14019 |
| 456 | Ga0496122_0112423 | 3300048925 | Bacteria | 1783 |
| 457 | Ga0496123_0000162 | 3300048926 | Bacteria | 134316 |
| 458 | Ga0496123_0000677 | 3300048926 | Bacteria | 56286 |
| 459 | Ga0496123_0004401 | 3300048926 | Bacteria | 14854 |
| 460 | Ga0496123_0031755 | 3300048926 | Bacteria | 3835 |
| 461 | Ga0496124_0029422 | 3300048927 | Bacteria | 4895 |
| 462 | Ga0496124_0052851 | 3300048927 | Bacteria | 3449 |
| 463 | Ga0496124_0089878 | 3300048927 | Bacteria | 2506 |
| 464 | Ga0496124_0165467 | 3300048927 | Bacteria | 1719 |
| 465 | Ga0496125_0000023 | 3300048928 | Bacteria | 449042 |
| 466 | Ga0496125_0031606 | 3300048928 | Bacteria | 4715 |
| 467 | Ga0496125_0209145 | 3300048928 | Bacteria | 1268 |
| 468 | Ga0496126_0114500 | 3300048929 | Bacteria | 2346 |
| 469 | Ga0496126_0364036 | 3300048929 | Bacteria | 1180 |
| 470 | Ga0495678_012076 | 3300049459 | Bacteria | 4105 |
| 471 | Ga0495682_0002892 | 3300049460 | Bacteria | 7893 |
| 472 | Ga0501032_0012041 | 3300049569 | Bacteria | 6193 |
| 473 | Ga0501032_0146683 | 3300049569 | Bacteria | 1553 |
| 474 | Ga0501033_0085641 | 3300049570 | Bacteria | 2308 |
| 475 | Ga0501034_0000134 | 3300049571 | Bacteria | 137745 |
| 476 | Ga0501034_0042742 | 3300049571 | Bacteria | 4587 |
| 477 | Ga0501034_0153173 | 3300049571 | Bacteria | 2280 |
| 478 | Ga0501034_0249535 | 3300049571 | Bacteria | 1719 |
| 479 | Ga0501036_0034453 | 3300049572 | Bacteria | 4283 |
| 480 | Ga0501037_0001580 | 3300049573 | Bacteria | 16609 |
| 481 | Ga0501038_0009408 | 3300049574 | Bacteria | 8967 |
| 482 | Ga0501038_0087957 | 3300049574 | Bacteria | 2608 |
| 483 | Ga0501039_0069109 | 3300049575 | Bacteria | 2743 |
| 484 | Ga0501040_0015365 | 3300049576 | Bacteria | 5063 |
| 485 | Ga0501043_0103702 | 3300049579 | Bacteria | 2234 |
| 486 | Ga0501047_0269947 | 3300049581 | Bacteria | 1547 |
| 487 | Ga0501047_0294985 | 3300049581 | Bacteria | 1465 |
| 488 | Ga0501048_0260861 | 3300049582 | Bacteria | 1231 |
| 489 | Ga0501067_0030877 | 3300049583 | Bacteria | 2973 |
| 490 | Ga0501068_0012186 | 3300049584 | Bacteria | 4863 |
| 491 | Ga0501070_0363172 | 3300049586 | Bacteria | 1174 |
| 492 | Ga0501071_0000860 | 3300049587 | Bacteria | 16338 |
| 493 | Ga0501072_0013858 | 3300049588 | Bacteria | 6177 |
| 494 | Ga0501075_0010964 | 3300049591 | Bacteria | 6393 |
| 495 | Ga0501080_0000881 | 3300049742 | Bacteria | 24572 |
| 496 | Ga0501080_0014560 | 3300049742 | Bacteria | 7244 |
| 497 | Ga0501081_0028006 | 3300049743 | Bacteria | 3800 |
| 498 | Ga0501081_0053143 | 3300049743 | Bacteria | 2797 |
| 499 | Ga0501083_0222588 | 3300049744 | Bacteria | 1229 |
| 500 | Ga0501280_002240 | 3300049776 | Bacteria | 3283 |
| 501 | Ga0501282_001460 | 3300049778 | Bacteria | 2624 |
| 502 | Ga0501035_0073462 | 3300049822 | Bacteria | 3026 |
| 503 | Ga0501035_0138256 | 3300049822 | Bacteria | 2119 |
| 504 | Ga0501045_0098294 | 3300049824 | Bacteria | 2166 |
| 505 | nmdc:mga00v17_225_c1 | 3300050491 | Bacteria | 33638 |
| 506 | nmdc:mga00v17_34083_c1 | 3300050491 | Bacteria | 3022 |
| 507 | nmdc:mga00v17_70192_c1 | 3300050491 | Bacteria | 2169 |
| 508 | nmdc:mga0k408_232383_c1 | 3300050493 | Bacteria | 1101 |
| 509 | nmdc:mga0k408_251353_c1 | 3300050493 | Bacteria | 1056 |
| 510 | nmdc:mga0k408_9268_c2 | 3300050493 | Bacteria | 4067 |
| 511 | nmdc:mga06z11_117453_c1 | 3300050494 | Bacteria | 1480 |
| 512 | nmdc:mga07m45_186317_c1 | 3300050496 | Bacteria | 1207 |
| 513 | nmdc:mga07m45_202878_c1 | 3300050496 | Bacteria | 1154 |
| 514 | Ga0495601_0045857 | 3300053077 | Bacteria | 2750 |
| 515 | Ga0500635_0113458 | 3300053080 | Bacteria | 1009 |
| 516 | Ga0500559_0005631 | 3300053136 | Bacteria | 5739 |
| 517 | Ga0500622_0000011 | 3300053156 | Bacteria | 386096 |
| 518 | Ga0500645_001181 | 3300053730 | Bacteria | 13913 |
| 519 | Ga0500587_004985 | 3300053739 | Bacteria | 1806 |
| 520 | Ga0501084_0162833 | 3300054114 | Bacteria | 1882 |
| 521 | Ga0530510_0396967 | 3300061734 | Bacteria | 1039 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025294 | Ga0209025_1000473 | Ga0209025_100047338 | 221 |
| 2 | 3300049571 | Ga0501034_0000134 | Ga0501034_0000134_100047_100919 | 221 |
| 3 | 3300031548 | Ga0307408_100469253 | Ga0307408_1004692531 | 224 |
| 4 | 3300031901 | Ga0307406_10003957 | Ga0307406_100039573 | 224 |
| 5 | 3300053136 | Ga0500559_0005631 | Ga0500559_0005631_4650_5495 | 225 |
| 6 | 3300047318 | Ga0495636_0015212 | Ga0495636_0015212_1048_1941 | 229 |
| 7 | 3300006948 | Ga0099826_10000024 | Ga0099826_10000024128 | 230 |
| 8 | 3300009011 | Ga0105251_10013135 | Ga0105251_100131353 | 230 |
| 9 | 3300027666 | Ga0209282_1000032 | Ga0209282_100003238 | 230 |
| 10 | 3300046474 | Ga0495605_0027728 | Ga0495605_0027728_1586_2470 | 230 |
| 11 | 3300046491 | Ga0495584_0036117 | Ga0495584_0036117_1033_1917 | 230 |
| 12 | 3300046500 | Ga0495596_0000367 | Ga0495596_0000367_2549_3433 | 230 |
| 13 | 3300046501 | Ga0495607_0023352 | Ga0495607_0023352_1540_2424 | 230 |
| 14 | 3300046512 | Ga0495610_0001046 | Ga0495610_0001046_15851_16735 | 230 |
| 15 | 3300046524 | Ga0495648_0054436 | Ga0495648_0054436_839_1723 | 230 |
| 16 | 3300046528 | Ga0495642_0066718 | Ga0495642_0066718_296_1180 | 230 |
| 17 | 3300046542 | Ga0495597_0015156 | Ga0495597_0015156_601_1485 | 230 |
| 18 | 3300046665 | Ga0495661_0051408 | Ga0495661_0051408_37_921 | 230 |
| 19 | 3300046694 | Ga0495649_0006153 | Ga0495649_0006153_1704_2588 | 230 |
| 20 | 3300046810 | Ga0495660_0099940 | Ga0495660_0099940_202_1086 | 230 |
| 21 | 3300047320 | Ga0495672_0024235 | Ga0495672_0024235_826_1710 | 230 |
| 22 | 3300047447 | Ga0495685_015798 | Ga0495685_015798_863_1747 | 230 |
| 23 | 3300048919 | Ga0496116_0010398 | Ga0496116_0010398_4494_5378 | 230 |
| 24 | 3300048924 | Ga0496121_0008698 | Ga0496121_0008698_2584_3468 | 230 |
| 25 | 3300048925 | Ga0496122_0003402 | Ga0496122_0003402_14146_15030 | 230 |
| 26 | 3300048926 | Ga0496123_0004401 | Ga0496123_0004401_5831_6715 | 230 |
| 27 | 3300048920 | Ga0496117_0176194 | Ga0496117_0176194_177_1010 | 234 |
| 28 | 3300048921 | Ga0496118_0013709 | Ga0496118_0013709_6042_6875 | 234 |
| 29 | 3300048922 | Ga0496119_0046138 | Ga0496119_0046138_162_995 | 234 |
| 30 | 3300048923 | Ga0496120_0013447 | Ga0496120_0013447_836_1669 | 234 |
| 31 | 3300048924 | Ga0496121_0000153 | Ga0496121_0000153_98842_99675 | 234 |
| 32 | 3300048925 | Ga0496122_0112423 | Ga0496122_0112423_59_892 | 234 |
| 33 | 3300048926 | Ga0496123_0031755 | Ga0496123_0031755_2764_3597 | 234 |
| 34 | 3300048928 | Ga0496125_0000023 | Ga0496125_0000023_107010_107843 | 234 |
| 35 | 3300048929 | Ga0496126_0364036 | Ga0496126_0364036_103_936 | 234 |
| 36 | 3300031911 | Ga0307412_10000078 | Ga0307412_1000007875 | 236 |
| 37 | 3300050491 | nmdc:mga00v17_70192_c1 | nmdc:mga00v17_70192_c1_1369_2124 | 238 |
| 38 | 3300005844 | Ga0068862_100174950 | Ga0068862_1001749502 | 239 |
| 39 | 3300025263 | Ga0209565_1002237 | Ga0209565_10022376 | 239 |
| 40 | 3300025291 | Ga0209675_1009127 | Ga0209675_10091275 | 239 |
| 41 | 3300025294 | Ga0209025_1000885 | Ga0209025_100088538 | 239 |
| 42 | 3300025299 | Ga0209256_1001277 | Ga0209256_100127717 | 239 |
| 43 | 3300025932 | Ga0207690_10050490 | Ga0207690_100504903 | 239 |
| 44 | 3300030744 | Ga0316181_1030137 | Ga0316181_10301372 | 239 |
| 45 | 3300034820 | Ga0373959_0039794 | Ga0373959_0039794_19_807 | 239 |
| 46 | 3300035115 | Ga0373941_0008136 | Ga0373941_0008136_1794_2582 | 239 |
| 47 | 3300035121 | Ga0373960_0018787 | Ga0373960_0018787_962_1750 | 239 |
| 48 | 3300035691 | Ga0373931_0007581 | Ga0373931_0007581_2636_3424 | 239 |
| 49 | 3300048919 | Ga0496116_0003969 | Ga0496116_0003969_12038_12895 | 239 |
| 50 | 3300003187 | JGI25151J46595_10002117 | JGI25151J46595_100021173 | 240 |
| 51 | 3300003771 | Ga0055526_1008218 | Ga0055526_10082186 | 240 |
| 52 | 3300003771 | Ga0055526_1010844 | Ga0055526_10108441 | 240 |
| 53 | 3300003781 | Ga0055536_1000930 | Ga0055536_10009306 | 240 |
| 54 | 3300003784 | Ga0055534_1001068 | Ga0055534_100106811 | 240 |
| 55 | 3300005842 | Ga0068858_100443357 | Ga0068858_1004433572 | 240 |
| 56 | 3300025291 | Ga0209675_1000156 | Ga0209675_100015634 | 240 |
| 57 | 3300025292 | Ga0209676_1000364 | Ga0209676_100036428 | 240 |
| 58 | 3300025294 | Ga0209025_1000417 | Ga0209025_100041728 | 240 |
| 59 | 3300025295 | Ga0209564_1000658 | Ga0209564_100065823 | 240 |
| 60 | 3300025295 | Ga0209564_1000709 | Ga0209564_100070927 | 240 |
| 61 | 3300025903 | Ga0207680_10057067 | Ga0207680_100570672 | 240 |
| 62 | 3300025904 | Ga0207647_10012034 | Ga0207647_100120342 | 240 |
| 63 | 3300025909 | Ga0207705_10131665 | Ga0207705_101316652 | 240 |
| 64 | 3300025911 | Ga0207654_10080223 | Ga0207654_100802232 | 240 |
| 65 | 3300025913 | Ga0207695_10075649 | Ga0207695_100756493 | 240 |
| 66 | 3300025944 | Ga0207661_10305054 | Ga0207661_103050542 | 240 |
| 67 | 3300025949 | Ga0207667_10062473 | Ga0207667_100624733 | 240 |
| 68 | 3300026116 | Ga0207674_10003476 | Ga0207674_100034765 | 240 |
| 69 | 3300031251 | Ga0265327_10053308 | Ga0265327_100533082 | 240 |
| 70 | 3300047318 | Ga0495636_0057185 | Ga0495636_0057185_795_1616 | 240 |
| 71 | 3300005344 | Ga0070661_100021266 | Ga0070661_1000212662 | 241 |
| 72 | 3300009545 | Ga0105237_10329849 | Ga0105237_103298492 | 241 |
| 73 | 3300010375 | Ga0105239_10474238 | Ga0105239_104742381 | 241 |
| 74 | 3300048905 | Ga0496102_0095687 | Ga0496102_0095687_1864_2733 | 241 |
| 75 | 3300005355 | Ga0070671_100145964 | Ga0070671_1001459642 | 242 |
| 76 | 3300009093 | Ga0105240_10193519 | Ga0105240_101935193 | 242 |
| 77 | 3300013105 | Ga0157369_10075469 | Ga0157369_100754691 | 242 |
| 78 | 3300025906 | Ga0207699_10188998 | Ga0207699_101889982 | 242 |
| 79 | 3300017792 | Ga0163161_10173506 | Ga0163161_101735062 | 243 |
| 80 | 3300042115 | Ga0450911_009727 | Ga0450911_009727_396_1253 | 243 |
| 81 | 3300025972 | Ga0207668_10132781 | Ga0207668_101327812 | 244 |
| 82 | 3300048919 | Ga0496116_0001249 | Ga0496116_0001249_28256_29113 | 244 |
| 83 | 3300013102 | Ga0157371_10013316 | Ga0157371_100133166 | 246 |
| 84 | 3300031711 | Ga0265314_10119173 | Ga0265314_101191732 | 246 |
| 85 | 3300049582 | Ga0501048_0260861 | Ga0501048_0260861_146_1036 | 246 |
| 86 | 3300053080 | Ga0500635_0113458 | Ga0500635_0113458_83_994 | 246 |
| 87 | 3300025931 | Ga0207644_10308606 | Ga0207644_103086061 | 247 |
| 88 | 3300005937 | Ga0081455_10005392 | Ga0081455_1000539210 | 248 |
| 89 | 3300006195 | Ga0075366_10094626 | Ga0075366_100946262 | 248 |
| 90 | 3300049581 | Ga0501047_0269947 | Ga0501047_0269947_274_1164 | 248 |
| 91 | 3300049581 | Ga0501047_0294985 | Ga0501047_0294985_113_1003 | 248 |
| 92 | 3300049744 | Ga0501083_0222588 | Ga0501083_0222588_36_926 | 248 |
| 93 | 3300025945 | Ga0207679_10151939 | Ga0207679_101519392 | 249 |
| 94 | 3300045051 | Ga0451576_0351515 | Ga0451576_0351515_388_1137 | 249 |
| 95 | 3300046507 | Ga0495606_0000314 | Ga0495606_0000314_31301_32152 | 249 |
| 96 | 3300046694 | Ga0495649_0005692 | Ga0495649_0005692_2912_3763 | 249 |
| 97 | 3300003751 | Ga0055538_1000085 | Ga0055538_100008518 | 250 |
| 98 | 3300003752 | Ga0055539_1000126 | Ga0055539_100012618 | 250 |
| 99 | 3300003756 | Ga0055533_1000133 | Ga0055533_100013318 | 250 |
| 100 | 3300003759 | Ga0055525_1000174 | Ga0055525_100017418 | 250 |
| 101 | 3300003841 | Ga0055541_1000085 | Ga0055541_100008559 | 250 |
| 102 | 3300005329 | Ga0070683_100432375 | Ga0070683_1004323751 | 250 |
| 103 | 3300005564 | Ga0070664_100122852 | Ga0070664_1001228522 | 250 |
| 104 | 3300009036 | Ga0105244_10050529 | Ga0105244_100505292 | 250 |
| 105 | 3300009148 | Ga0105243_10001514 | Ga0105243_1000151421 | 250 |
| 106 | 3300015261 | Ga0182006_1057689 | Ga0182006_10576891 | 250 |
| 107 | 3300021361 | Ga0213872_10005344 | Ga0213872_100053444 | 250 |
| 108 | 3300025224 | Ga0209784_100021 | Ga0209784_10002189 | 250 |
| 109 | 3300025225 | Ga0209566_100039 | Ga0209566_10003990 | 250 |
| 110 | 3300025226 | Ga0209674_100036 | Ga0209674_10003689 | 250 |
| 111 | 3300025230 | Ga0209563_100040 | Ga0209563_10004089 | 250 |
| 112 | 3300025253 | Ga0209677_100023 | Ga0209677_10002389 | 250 |
| 113 | 3300025926 | Ga0207659_10330526 | Ga0207659_103305261 | 250 |
| 114 | 3300025935 | Ga0207709_10000579 | Ga0207709_100005796 | 250 |
| 115 | 3300039447 | Ga0436361_0432344 | Ga0436361_0432344_11954_12787 | 250 |
| 116 | 3300046691 | Ga0495670_0298923 | Ga0495670_0298923_15_809 | 250 |
| 117 | 3300048928 | Ga0496125_0209145 | Ga0496125_0209145_361_1218 | 250 |
| 118 | 3300046512 | Ga0495610_0082249 | Ga0495610_0082249_184_972 | 252 |
| 119 | 3300048919 | Ga0496116_0008151 | Ga0496116_0008151_7150_7977 | 252 |
| 120 | 3300048925 | Ga0496122_0000186 | Ga0496122_0000186_43661_44488 | 252 |
| 121 | 3300048926 | Ga0496123_0000162 | Ga0496123_0000162_107855_108682 | 252 |
| 122 | 3300048928 | Ga0496125_0031606 | Ga0496125_0031606_2047_2874 | 252 |
| 123 | 3300049573 | Ga0501037_0001580 | Ga0501037_0001580_15551_16441 | 252 |
| 124 | 3300049742 | Ga0501080_0014560 | Ga0501080_0014560_2088_2978 | 252 |
| 125 | 3300025263 | Ga0209565_1009870 | Ga0209565_10098702 | 253 |
| 126 | 3300026121 | Ga0207683_10021386 | Ga0207683_100213864 | 253 |
| 127 | 3300046679 | Ga0495623_0242116 | Ga0495623_0242116_136_993 | 253 |
| 128 | 3300048907 | Ga0496104_0174552 | Ga0496104_0174552_1059_1886 | 253 |
| 129 | 3300002987 | JGI25159J45721_1007402 | JGI25159J45721_10074021 | 254 |
| 130 | 3300003374 | JGI25161J50226_1000606 | JGI25161J50226_10006064 | 254 |
| 131 | 3300003791 | Ga0055530_10008784 | Ga0055530_100087841 | 254 |
| 132 | 3300004625 | Ga0055543_1000387 | Ga0055543_100038730 | 254 |
| 133 | 3300005262 | Ga0065165_1002619 | Ga0065165_100261913 | 254 |
| 134 | 3300005367 | Ga0070667_100027200 | Ga0070667_1000272003 | 254 |
| 135 | 3300005456 | Ga0070678_100184194 | Ga0070678_1001841942 | 254 |
| 136 | 3300006051 | Ga0075364_10159068 | Ga0075364_101590682 | 254 |
| 137 | 3300009011 | Ga0105251_10130498 | Ga0105251_101304982 | 254 |
| 138 | 3300009177 | Ga0105248_10168846 | Ga0105248_101688462 | 254 |
| 139 | 3300013308 | Ga0157375_10024508 | Ga0157375_100245082 | 254 |
| 140 | 3300025208 | Ga0209436_101963 | Ga0209436_1019633 | 254 |
| 141 | 3300025263 | Ga0209565_1005710 | Ga0209565_10057103 | 254 |
| 142 | 3300025284 | Ga0209130_1000740 | Ga0209130_10007404 | 254 |
| 143 | 3300025291 | Ga0209675_1016789 | Ga0209675_10167892 | 254 |
| 144 | 3300025298 | Ga0209050_1000365 | Ga0209050_100036589 | 254 |
| 145 | 3300025903 | Ga0207680_10034651 | Ga0207680_100346513 | 254 |
| 146 | 3300025941 | Ga0207711_10236639 | Ga0207711_102366392 | 254 |
| 147 | 3300025986 | Ga0207658_10124430 | Ga0207658_101244302 | 254 |
| 148 | 3300026067 | Ga0207678_10041247 | Ga0207678_100412474 | 254 |
| 149 | 3300026121 | Ga0207683_10199876 | Ga0207683_101998763 | 254 |
| 150 | 3300028379 | Ga0268266_10185254 | Ga0268266_101852542 | 254 |
| 151 | 3300041486 | Ga0451807_1996062 | Ga0451807_1996062_168_941 | 254 |
| 152 | 3300046457 | Ga0495590_0011466 | Ga0495590_0011466_2327_3151 | 254 |
| 153 | 3300046460 | Ga0495638_0000875 | Ga0495638_0000875_8273_9109 | 254 |
| 154 | 3300046471 | Ga0495650_0019444 | Ga0495650_0019444_1129_1965 | 254 |
| 155 | 3300046474 | Ga0495605_0003074 | Ga0495605_0003074_8208_9044 | 254 |
| 156 | 3300046523 | Ga0495644_0054541 | Ga0495644_0054541_625_1461 | 254 |
| 157 | 3300046524 | Ga0495648_0015309 | Ga0495648_0015309_4679_5494 | 254 |
| 158 | 3300046528 | Ga0495642_0016071 | Ga0495642_0016071_1924_2760 | 254 |
| 159 | 3300046794 | Ga0495589_0001288 | Ga0495589_0001288_9889_10725 | 254 |
| 160 | 3300048903 | Ga0496100_0263304 | Ga0496100_0263304_299_1135 | 254 |
| 161 | 3300048909 | Ga0496106_0028887 | Ga0496106_0028887_2514_3350 | 254 |
| 162 | 3300048918 | Ga0496115_0033943 | Ga0496115_0033943_189_1025 | 254 |
| 163 | 3300050491 | nmdc:mga00v17_34083_c1 | nmdc:mga00v17_34083_c1_1839_2702 | 254 |
| 164 | 3300053730 | Ga0500645_001181 | Ga0500645_001181_11055_11939 | 254 |
| 165 | 3300002739 | JGI25158J39367_1001204 | JGI25158J39367_10012044 | 255 |
| 166 | 3300002774 | JGI25150J39212_1014055 | JGI25150J39212_10140551 | 255 |
| 167 | 3300002987 | JGI25159J45721_1003511 | JGI25159J45721_10035114 | 255 |
| 168 | 3300003354 | JGI25160J50197_1001730 | JGI25160J50197_10017303 | 255 |
| 169 | 3300003374 | JGI25161J50226_1001465 | JGI25161J50226_10014656 | 255 |
| 170 | 3300003771 | Ga0055526_1001791 | Ga0055526_100179112 | 255 |
| 171 | 3300003771 | Ga0055526_1004751 | Ga0055526_10047515 | 255 |
| 172 | 3300003773 | Ga0055537_1015044 | Ga0055537_10150441 | 255 |
| 173 | 3300003775 | Ga0055524_1012342 | Ga0055524_10123421 | 255 |
| 174 | 3300003775 | Ga0055524_1015761 | Ga0055524_10157613 | 255 |
| 175 | 3300003784 | Ga0055534_1003336 | Ga0055534_10033364 | 255 |
| 176 | 3300003790 | Ga0055528_1006649 | Ga0055528_10066492 | 255 |
| 177 | 3300003791 | Ga0055530_10024105 | Ga0055530_100241053 | 255 |
| 178 | 3300003794 | Ga0055531_10012375 | Ga0055531_100123754 | 255 |
| 179 | 3300025208 | Ga0209436_101442 | Ga0209436_1014428 | 255 |
| 180 | 3300025245 | Ga0207425_1002181 | Ga0207425_10021817 | 255 |
| 181 | 3300025263 | Ga0209565_1000875 | Ga0209565_10008757 | 255 |
| 182 | 3300025263 | Ga0209565_1000887 | Ga0209565_10008876 | 255 |
| 183 | 3300025273 | Ga0209673_1019523 | Ga0209673_10195232 | 255 |
| 184 | 3300025284 | Ga0209130_1002172 | Ga0209130_10021727 | 255 |
| 185 | 3300025284 | Ga0209130_1002173 | Ga0209130_10021737 | 255 |
| 186 | 3300025291 | Ga0209675_1001351 | Ga0209675_100135112 | 255 |
| 187 | 3300025295 | Ga0209564_1000067 | Ga0209564_100006792 | 255 |
| 188 | 3300025295 | Ga0209564_1003115 | Ga0209564_10031155 | 255 |
| 189 | 3300025298 | Ga0209050_1000040 | Ga0209050_1000040204 | 255 |
| 190 | 3300025298 | Ga0209050_1005050 | Ga0209050_10050507 | 255 |
| 191 | 3300025299 | Ga0209256_1001662 | Ga0209256_100166214 | 255 |
| 192 | 3300025299 | Ga0209256_1004683 | Ga0209256_10046834 | 255 |
| 193 | 3300025302 | Ga0207426_1005381 | Ga0207426_10053813 | 255 |
| 194 | 3300025303 | Ga0209051_1026012 | Ga0209051_10260122 | 255 |
| 195 | 3300025304 | Ga0209257_1000054 | Ga0209257_1000054195 | 255 |
| 196 | 3300025906 | Ga0207699_10179236 | Ga0207699_101792361 | 255 |
| 197 | 3300029957 | Ga0265324_10048255 | Ga0265324_100482552 | 255 |
| 198 | 3300031251 | Ga0265327_10004511 | Ga0265327_1000451110 | 255 |
| 199 | 3300031548 | Ga0307408_100003180 | Ga0307408_10000318011 | 255 |
| 200 | 3300031548 | Ga0307408_100011951 | Ga0307408_1000119518 | 255 |
| 201 | 3300046506 | Ga0495583_0082262 | Ga0495583_0082262_281_1108 | 255 |
| 202 | 3300046525 | Ga0495663_0014702 | Ga0495663_0014702_348_1169 | 255 |
| 203 | 3300046528 | Ga0495642_0026488 | Ga0495642_0026488_680_1501 | 255 |
| 204 | 3300047318 | Ga0495636_0022380 | Ga0495636_0022380_1345_2166 | 255 |
| 205 | 3300047447 | Ga0495685_053060 | Ga0495685_053060_122_943 | 255 |
| 206 | 3300048905 | Ga0496102_0000024 | Ga0496102_0000024_91703_92533 | 255 |
| 207 | 3300048906 | Ga0496103_0208828 | Ga0496103_0208828_103_930 | 255 |
| 208 | 3300048907 | Ga0496104_0382911 | Ga0496104_0382911_327_1196 | 255 |
| 209 | 3300005563 | Ga0068855_100450959 | Ga0068855_1004509592 | 256 |
| 210 | 3300013306 | Ga0163162_10025423 | Ga0163162_100254233 | 256 |
| 211 | 3300013308 | Ga0157375_10000712 | Ga0157375_1000071214 | 256 |
| 212 | 3300014969 | Ga0157376_10001938 | Ga0157376_100019384 | 256 |
| 213 | 3300025934 | Ga0207686_10069512 | Ga0207686_100695123 | 256 |
| 214 | 3300025949 | Ga0207667_10196800 | Ga0207667_101968002 | 256 |
| 215 | 3300026089 | Ga0207648_10007928 | Ga0207648_100079285 | 256 |
| 216 | 3300046458 | Ga0495591_000007 | Ga0495591_000007_355877_356710 | 256 |
| 217 | 3300046474 | Ga0495605_0005630 | Ga0495605_0005630_3668_4516 | 256 |
| 218 | 3300046491 | Ga0495584_0007112 | Ga0495584_0007112_851_1690 | 256 |
| 219 | 3300046491 | Ga0495584_0008704 | Ga0495584_0008704_1112_1960 | 256 |
| 220 | 3300046528 | Ga0495642_0003493 | Ga0495642_0003493_2035_2883 | 256 |
| 221 | 3300046530 | Ga0495654_0000007 | Ga0495654_0000007_393008_393847 | 256 |
| 222 | 3300046530 | Ga0495654_0003376 | Ga0495654_0003376_1833_2681 | 256 |
| 223 | 3300046538 | Ga0495609_0024920 | Ga0495609_0024920_1026_1868 | 256 |
| 224 | 3300046542 | Ga0495597_0002800 | Ga0495597_0002800_4238_5086 | 256 |
| 225 | 3300046616 | Ga0495668_0005614 | Ga0495668_0005614_436_1284 | 256 |
| 226 | 3300046794 | Ga0495589_0075772 | Ga0495589_0075772_447_1295 | 256 |
| 227 | 3300046810 | Ga0495660_0000355 | Ga0495660_0000355_38626_39468 | 256 |
| 228 | 3300047320 | Ga0495672_0008932 | Ga0495672_0008932_6007_6855 | 256 |
| 229 | 3300047472 | Ga0495686_0015707 | Ga0495686_0015707_1151_1993 | 256 |
| 230 | 3300048907 | Ga0496104_0000365 | Ga0496104_0000365_35483_36346 | 256 |
| 231 | 3300048908 | Ga0496105_0000048 | Ga0496105_0000048_35483_36346 | 256 |
| 232 | 3300048913 | Ga0496110_0001900 | Ga0496110_0001900_5132_5959 | 256 |
| 233 | 3300048914 | Ga0496111_0105745 | Ga0496111_0105745_761_1588 | 256 |
| 234 | 3300005330 | Ga0070690_100255160 | Ga0070690_1002551602 | 257 |
| 235 | 3300005466 | Ga0070685_10244327 | Ga0070685_102443272 | 257 |
| 236 | 3300009011 | Ga0105251_10118358 | Ga0105251_101183582 | 257 |
| 237 | 3300009176 | Ga0105242_10040170 | Ga0105242_100401704 | 257 |
| 238 | 3300013105 | Ga0157369_10041346 | Ga0157369_100413462 | 257 |
| 239 | 3300013296 | Ga0157374_10087383 | Ga0157374_100873833 | 257 |
| 240 | 3300013307 | Ga0157372_10158180 | Ga0157372_101581803 | 257 |
| 241 | 3300025735 | Ga0207713_1073427 | Ga0207713_10734272 | 257 |
| 242 | 3300026095 | Ga0207676_10236376 | Ga0207676_102363762 | 257 |
| 243 | 3300031548 | Ga0307408_100464469 | Ga0307408_1004644692 | 257 |
| 244 | 3300046538 | Ga0495609_0011758 | Ga0495609_0011758_969_1796 | 257 |
| 245 | 3300046542 | Ga0495597_0000372 | Ga0495597_0000372_1401_2228 | 257 |
| 246 | 3300049569 | Ga0501032_0012041 | Ga0501032_0012041_2958_3749 | 257 |
| 247 | 3300049571 | Ga0501034_0042742 | Ga0501034_0042742_1294_2085 | 257 |
| 248 | 3300049574 | Ga0501038_0009408 | Ga0501038_0009408_5891_6682 | 257 |
| 249 | 3300003322 | rootL2_10092461 | rootL2_100924611 | 258 |
| 250 | 3300053156 | Ga0500622_0000011 | Ga0500622_0000011_25259_26119 | 258 |
| 251 | 3300005549 | Ga0070704_100201971 | Ga0070704_1002019712 | 259 |
| 252 | 3300005615 | Ga0070702_100267263 | Ga0070702_1002672632 | 259 |
| 253 | 3300009036 | Ga0105244_10030322 | Ga0105244_100303222 | 259 |
| 254 | 3300031239 | Ga0265328_10000016 | Ga0265328_1000001693 | 259 |
| 255 | 3300035241 | Ga0373961_0008029 | Ga0373961_0008029_1384_2172 | 259 |
| 256 | 3300046522 | Ga0495643_0002757 | Ga0495643_0002757_5673_6524 | 259 |
| 257 | 3300046522 | Ga0495643_0009145 | Ga0495643_0009145_2702_3553 | 259 |
| 258 | 3300046660 | Ga0495625_0189081 | Ga0495625_0189081_439_1290 | 259 |
| 259 | 3300046692 | Ga0495671_0002714 | Ga0495671_0002714_9508_10359 | 259 |
| 260 | 3300046694 | Ga0495649_0010368 | Ga0495649_0010368_3305_4156 | 259 |
| 261 | 3300047470 | Ga0495681_0035561 | Ga0495681_0035561_1377_2228 | 259 |
| 262 | 3300049584 | Ga0501068_0012186 | Ga0501068_0012186_1636_2430 | 259 |
| 263 | 3300049587 | Ga0501071_0000860 | Ga0501071_0000860_6346_7140 | 259 |
| 264 | 3300049588 | Ga0501072_0013858 | Ga0501072_0013858_3744_4538 | 259 |
| 265 | 3300049591 | Ga0501075_0010964 | Ga0501075_0010964_466_1260 | 259 |
| 266 | 3300049742 | Ga0501080_0000881 | Ga0501080_0000881_9629_10423 | 259 |
| 267 | 3300049743 | Ga0501081_0028006 | Ga0501081_0028006_1502_2296 | 259 |
| 268 | 3300049824 | Ga0501045_0098294 | Ga0501045_0098294_220_1014 | 259 |
| 269 | 3300054114 | Ga0501084_0162833 | Ga0501084_0162833_797_1591 | 259 |
| 270 | 3300061734 | Ga0530510_0396967 | Ga0530510_0396967_120_914 | 259 |
| 271 | 3300025292 | Ga0209676_1006762 | Ga0209676_10067622 | 260 |
| 272 | 3300031548 | Ga0307408_100273235 | Ga0307408_1002732352 | 260 |
| 273 | 3300046501 | Ga0495607_0002495 | Ga0495607_0002495_13662_14492 | 260 |
| 274 | 3300046665 | Ga0495661_0234909 | Ga0495661_0234909_11_799 | 260 |
| 275 | 3300048929 | Ga0496126_0114500 | Ga0496126_0114500_106_945 | 260 |
| 276 | 3300049586 | Ga0501070_0363172 | Ga0501070_0363172_252_1106 | 260 |
| 277 | iso_pu_bacteria | 2585428062 | 2587754080 | 260 |
| 278 | iso_pu_bacteria | 2919704043 | 2919707137 | 260 |
| 279 | 3300003187 | JGI25151J46595_10004389 | JGI25151J46595_100043891 | 261 |
| 280 | 3300003771 | Ga0055526_1006655 | Ga0055526_10066556 | 261 |
| 281 | 3300003773 | Ga0055537_1004773 | Ga0055537_10047733 | 261 |
| 282 | 3300003775 | Ga0055524_1002928 | Ga0055524_10029286 | 261 |
| 283 | 3300003784 | Ga0055534_1001951 | Ga0055534_10019517 | 261 |
| 284 | 3300005439 | Ga0070711_100071818 | Ga0070711_1000718182 | 261 |
| 285 | 3300009011 | Ga0105251_10029983 | Ga0105251_100299832 | 261 |
| 286 | 3300009036 | Ga0105244_10050822 | Ga0105244_100508222 | 261 |
| 287 | 3300009176 | Ga0105242_10156295 | Ga0105242_101562952 | 261 |
| 288 | 3300009177 | Ga0105248_10402940 | Ga0105248_104029402 | 261 |
| 289 | 3300025263 | Ga0209565_1000261 | Ga0209565_10002613 | 261 |
| 290 | 3300025273 | Ga0209673_1010896 | Ga0209673_10108963 | 261 |
| 291 | 3300025291 | Ga0209675_1006893 | Ga0209675_10068934 | 261 |
| 292 | 3300025294 | Ga0209025_1000516 | Ga0209025_100051618 | 261 |
| 293 | 3300025295 | Ga0209564_1000611 | Ga0209564_10006113 | 261 |
| 294 | 3300025297 | Ga0209758_1026126 | Ga0209758_10261263 | 261 |
| 295 | 3300025299 | Ga0209256_1001546 | Ga0209256_10015464 | 261 |
| 296 | 3300025916 | Ga0207663_10090009 | Ga0207663_100900092 | 261 |
| 297 | 3300048905 | Ga0496102_0006320 | Ga0496102_0006320_7087_7902 | 261 |
| 298 | 3300048920 | Ga0496117_0193438 | Ga0496117_0193438_69_914 | 261 |
| 299 | iso_pu_bacteria | 2738543013 | 2739248279 | 261 |
| 300 | 3300003322 | rootL2_10237592 | rootL2_102375921 | 262 |
| 301 | 3300005330 | Ga0070690_100356754 | Ga0070690_1003567542 | 262 |
| 302 | 3300005434 | Ga0070709_10363736 | Ga0070709_103637362 | 262 |
| 303 | 3300005459 | Ga0068867_100150992 | Ga0068867_1001509922 | 262 |
| 304 | 3300006195 | Ga0075366_10012944 | Ga0075366_100129443 | 262 |
| 305 | 3300006195 | Ga0075366_10092392 | Ga0075366_100923922 | 262 |
| 306 | 3300006353 | Ga0075370_10223415 | Ga0075370_102234152 | 262 |
| 307 | 3300006353 | Ga0075370_10273172 | Ga0075370_102731721 | 262 |
| 308 | 3300009092 | Ga0105250_10025778 | Ga0105250_100257782 | 262 |
| 309 | 3300025711 | Ga0207696_1027099 | Ga0207696_10270993 | 262 |
| 310 | 3300025920 | Ga0207649_10175520 | Ga0207649_101755201 | 262 |
| 311 | 3300025923 | Ga0207681_10167718 | Ga0207681_101677182 | 262 |
| 312 | 3300028794 | Ga0307515_10000354 | Ga0307515_1000035452 | 262 |
| 313 | 3300028794 | Ga0307515_10007796 | Ga0307515_100077964 | 262 |
| 314 | 3300028794 | Ga0307515_10009311 | Ga0307515_100093116 | 262 |
| 315 | 3300030522 | Ga0307512_10113086 | Ga0307512_101130862 | 262 |
| 316 | 3300031456 | Ga0307513_10010732 | Ga0307513_100107328 | 262 |
| 317 | 3300031507 | Ga0307509_10024723 | Ga0307509_100247233 | 262 |
| 318 | 3300031616 | Ga0307508_10000043 | Ga0307508_1000004381 | 262 |
| 319 | 3300031649 | Ga0307514_10078874 | Ga0307514_100788743 | 262 |
| 320 | 3300031649 | Ga0307514_10086174 | Ga0307514_100861742 | 262 |
| 321 | 3300031730 | Ga0307516_10013442 | Ga0307516_100134428 | 262 |
| 322 | 3300033179 | Ga0307507_10061383 | Ga0307507_100613832 | 262 |
| 323 | 3300035111 | Ga0373923_0100472 | Ga0373923_0100472_11_832 | 262 |
| 324 | 3300035172 | Ga0373955_0002705 | Ga0373955_0002705_25_846 | 262 |
| 325 | 3300036401 | Ga0373937_0128978 | Ga0373937_0128978_1293_2114 | 262 |
| 326 | 3300041452 | Ga0451793_0774530 | Ga0451793_0774530_498_1316 | 262 |
| 327 | 3300042876 | Ga0451577_0098152 | Ga0451577_0098152_734_1594 | 262 |
| 328 | 3300044658 | Ga0466972_0008985 | Ga0466972_0008985_1634_2464 | 262 |
| 329 | 3300044673 | Ga0453683_0163532 | Ga0453683_0163532_176_1045 | 262 |
| 330 | 3300044712 | Ga0453684_0005573 | Ga0453684_0005573_15653_16513 | 262 |
| 331 | 3300045051 | Ga0451576_0009742 | Ga0451576_0009742_5231_6100 | 262 |
| 332 | 3300045051 | Ga0451576_0272612 | Ga0451576_0272612_316_1137 | 262 |
| 333 | 3300046463 | Ga0495653_0023473 | Ga0495653_0023473_3154_3975 | 262 |
| 334 | 3300046515 | Ga0495620_0035857 | Ga0495620_0035857_628_1446 | 262 |
| 335 | 3300046516 | Ga0495628_0033791 | Ga0495628_0033791_683_1504 | 262 |
| 336 | 3300046522 | Ga0495643_0034891 | Ga0495643_0034891_1873_2691 | 262 |
| 337 | 3300046525 | Ga0495663_0046829 | Ga0495663_0046829_368_1225 | 262 |
| 338 | 3300046529 | Ga0495652_0052830 | Ga0495652_0052830_397_1218 | 262 |
| 339 | 3300046543 | Ga0495645_0003820 | Ga0495645_0003820_1670_2491 | 262 |
| 340 | 3300046559 | Ga0495667_0065328 | Ga0495667_0065328_1112_1933 | 262 |
| 341 | 3300046660 | Ga0495625_0003495 | Ga0495625_0003495_12340_13158 | 262 |
| 342 | 3300046679 | Ga0495623_0135123 | Ga0495623_0135123_97_918 | 262 |
| 343 | 3300047322 | Ga0495680_0168764 | Ga0495680_0168764_134_955 | 262 |
| 344 | 3300047471 | Ga0495684_0064468 | Ga0495684_0064468_1458_2279 | 262 |
| 345 | 3300048927 | Ga0496124_0165467 | Ga0496124_0165467_255_1118 | 262 |
| 346 | 3300049571 | Ga0501034_0249535 | Ga0501034_0249535_26_847 | 262 |
| 347 | 3300050493 | nmdc:mga0k408_232383_c1 | nmdc:mga0k408_232383_c1_113_931 | 262 |
| 348 | 3300050493 | nmdc:mga0k408_251353_c1 | nmdc:mga0k408_251353_c1_106_924 | 262 |
| 349 | 3300050493 | nmdc:mga0k408_9268_c2 | nmdc:mga0k408_9268_c2_1057_1884 | 262 |
| 350 | 3300050494 | nmdc:mga06z11_117453_c1 | nmdc:mga06z11_117453_c1_497_1315 | 262 |
| 351 | 3300050496 | nmdc:mga07m45_186317_c1 | nmdc:mga07m45_186317_c1_152_970 | 262 |
| 352 | 3300050496 | nmdc:mga07m45_202878_c1 | nmdc:mga07m45_202878_c1_106_924 | 262 |
| 353 | 3300053077 | Ga0495601_0045857 | Ga0495601_0045857_129_950 | 262 |
| 354 | 3300053739 | Ga0500587_004985 | Ga0500587_004985_116_934 | 262 |
| 355 | iso_pu_bacteria | 2842747753 | 2842748869 | 262 |
| 356 | iso_pu_bacteria | 2945972063 | 2945975658 | 262 |
| 357 | 3300005436 | Ga0070713_100003725 | Ga0070713_1000037258 | 263 |
| 358 | 3300005577 | Ga0068857_100362807 | Ga0068857_1003628072 | 263 |
| 359 | 3300009098 | Ga0105245_10334489 | Ga0105245_103344892 | 263 |
| 360 | 3300025928 | Ga0207700_10006080 | Ga0207700_100060805 | 263 |
| 361 | 3300025986 | Ga0207658_10346976 | Ga0207658_103469761 | 263 |
| 362 | 3300026116 | Ga0207674_10365303 | Ga0207674_103653032 | 263 |
| 363 | 3300035724 | Ga0373933_0144079 | Ga0373933_0144079_275_1162 | 263 |
| 364 | 3300047470 | Ga0495681_0068879 | Ga0495681_0068879_98_916 | 263 |
| 365 | 3300049569 | Ga0501032_0146683 | Ga0501032_0146683_328_1218 | 263 |
| 366 | iso_pu_bacteria | 2904479285 | 2904481652 | 263 |
| 367 | 3300005459 | Ga0068867_100459301 | Ga0068867_1004593012 | 264 |
| 368 | 3300036647 | Ga0316582_0193553 | Ga0316582_0193553_18_872 | 264 |
| 369 | 3300046557 | Ga0495622_0025750 | Ga0495622_0025750_218_1045 | 264 |
| 370 | 3300047321 | Ga0495676_0000025 | Ga0495676_0000025_103024_103851 | 264 |
| 371 | 3300048927 | Ga0496124_0052851 | Ga0496124_0052851_1017_1850 | 264 |
| 372 | 3300046452 | Ga0495617_004710 | Ga0495617_004710_115_933 | 265 |
| 373 | 3300046457 | Ga0495590_0006781 | Ga0495590_0006781_1448_2266 | 265 |
| 374 | 3300046460 | Ga0495638_0084453 | Ga0495638_0084453_592_1410 | 265 |
| 375 | 3300046491 | Ga0495584_0005537 | Ga0495584_0005537_159_977 | 265 |
| 376 | 3300046491 | Ga0495584_0081926 | Ga0495584_0081926_115_933 | 265 |
| 377 | 3300046492 | Ga0495585_0021113 | Ga0495585_0021113_646_1464 | 265 |
| 378 | 3300046492 | Ga0495585_0032238 | Ga0495585_0032238_338_1156 | 265 |
| 379 | 3300046492 | Ga0495585_0044887 | Ga0495585_0044887_1430_2248 | 265 |
| 380 | 3300046501 | Ga0495607_0032627 | Ga0495607_0032627_2256_3074 | 265 |
| 381 | 3300046506 | Ga0495583_0000099 | Ga0495583_0000099_34504_35322 | 265 |
| 382 | 3300046513 | Ga0495616_0007675 | Ga0495616_0007675_674_1492 | 265 |
| 383 | 3300046523 | Ga0495644_0001980 | Ga0495644_0001980_5097_5915 | 265 |
| 384 | 3300046524 | Ga0495648_0002571 | Ga0495648_0002571_164_982 | 265 |
| 385 | 3300046538 | Ga0495609_0009946 | Ga0495609_0009946_1461_2279 | 265 |
| 386 | 3300046538 | Ga0495609_0053503 | Ga0495609_0053503_457_1275 | 265 |
| 387 | 3300046558 | Ga0495633_0002768 | Ga0495633_0002768_5620_6438 | 265 |
| 388 | 3300046558 | Ga0495633_0075337 | Ga0495633_0075337_592_1410 | 265 |
| 389 | 3300046648 | Ga0495611_0003774 | Ga0495611_0003774_182_1000 | 265 |
| 390 | 3300046648 | Ga0495611_0009669 | Ga0495611_0009669_1019_1837 | 265 |
| 391 | 3300046660 | Ga0495625_0277827 | Ga0495625_0277827_99_917 | 265 |
| 392 | 3300046660 | Ga0495625_0279132 | Ga0495625_0279132_162_980 | 265 |
| 393 | 3300046664 | Ga0495659_0000462 | Ga0495659_0000462_12738_13556 | 265 |
| 394 | 3300046665 | Ga0495661_0154952 | Ga0495661_0154952_260_1078 | 265 |
| 395 | 3300046691 | Ga0495670_0103141 | Ga0495670_0103141_104_922 | 265 |
| 396 | 3300046692 | Ga0495671_0109434 | Ga0495671_0109434_209_1027 | 265 |
| 397 | 3300046692 | Ga0495671_0198393 | Ga0495671_0198393_58_876 | 265 |
| 398 | 3300047320 | Ga0495672_0153549 | Ga0495672_0153549_99_917 | 265 |
| 399 | 3300047323 | Ga0495683_0028552 | Ga0495683_0028552_99_917 | 265 |
| 400 | 3300047443 | Ga0495687_000687 | Ga0495687_000687_6062_6880 | 265 |
| 401 | 3300047445 | Ga0495677_0033900 | Ga0495677_0033900_221_1039 | 265 |
| 402 | 3300047447 | Ga0495685_000008 | Ga0495685_000008_61637_62455 | 265 |
| 403 | 3300047469 | Ga0495673_0068892 | Ga0495673_0068892_147_965 | 265 |
| 404 | 3300049459 | Ga0495678_012076 | Ga0495678_012076_360_1178 | 265 |
| 405 | 3300049460 | Ga0495682_0002892 | Ga0495682_0002892_544_1362 | 265 |
| 406 | 3300049570 | Ga0501033_0085641 | Ga0501033_0085641_811_1701 | 265 |
| 407 | 3300049571 | Ga0501034_0153173 | Ga0501034_0153173_787_1677 | 265 |
| 408 | 3300049572 | Ga0501036_0034453 | Ga0501036_0034453_328_1218 | 265 |
| 409 | 3300049574 | Ga0501038_0087957 | Ga0501038_0087957_602_1492 | 265 |
| 410 | 3300049575 | Ga0501039_0069109 | Ga0501039_0069109_486_1376 | 265 |
| 411 | 3300049579 | Ga0501043_0103702 | Ga0501043_0103702_1102_1992 | 265 |
| 412 | 3300049583 | Ga0501067_0030877 | Ga0501067_0030877_926_1816 | 265 |
| 413 | 3300049778 | Ga0501282_001460 | Ga0501282_001460_836_1648 | 265 |
| 414 | 3300049822 | Ga0501035_0138256 | Ga0501035_0138256_113_1003 | 265 |
| 415 | iso_pu_bacteria | 2885080285 | 2885080390 | 265 |
| 416 | iso_pu_bacteria | 2941479691 | 2941484849 | 265 |
| 417 | 3300005616 | Ga0068852_100012173 | Ga0068852_1000121735 | 266 |
| 418 | 3300006058 | Ga0075432_10048059 | Ga0075432_100480592 | 266 |
| 419 | 3300009036 | Ga0105244_10052701 | Ga0105244_100527012 | 266 |
| 420 | 3300009545 | Ga0105237_10389689 | Ga0105237_103896892 | 266 |
| 421 | 3300013100 | Ga0157373_10001293 | Ga0157373_100012932 | 266 |
| 422 | 3300013102 | Ga0157371_10000646 | Ga0157371_1000064636 | 266 |
| 423 | 3300021361 | Ga0213872_10002585 | Ga0213872_1000258510 | 266 |
| 424 | 3300025711 | Ga0207696_1000062 | Ga0207696_1000062117 | 266 |
| 425 | 3300026142 | Ga0207698_10051721 | Ga0207698_100517212 | 266 |
| 426 | 3300039447 | Ga0436361_0276775 | Ga0436361_0276775_16525_17412 | 266 |
| 427 | 3300044658 | Ga0466972_0056855 | Ga0466972_0056855_419_1270 | 266 |
| 428 | 3300044683 | Ga0466965_0002392 | Ga0466965_0002392_6331_7182 | 266 |
| 429 | 3300044706 | Ga0466964_0036475 | Ga0466964_0036475_317_1168 | 266 |
| 430 | 3300044735 | Ga0466968_0004690 | Ga0466968_0004690_3784_4635 | 266 |
| 431 | 3300046457 | Ga0495590_0007599 | Ga0495590_0007599_2792_3619 | 266 |
| 432 | 3300046473 | Ga0495582_0000964 | Ga0495582_0000964_6036_6875 | 266 |
| 433 | 3300046491 | Ga0495584_0040001 | Ga0495584_0040001_635_1474 | 266 |
| 434 | 3300046491 | Ga0495584_0047766 | Ga0495584_0047766_992_1831 | 266 |
| 435 | 3300046492 | Ga0495585_0003733 | Ga0495585_0003733_4521_5348 | 266 |
| 436 | 3300046492 | Ga0495585_0011370 | Ga0495585_0011370_2602_3438 | 266 |
| 437 | 3300046492 | Ga0495585_0016609 | Ga0495585_0016609_3125_3964 | 266 |
| 438 | 3300046492 | Ga0495585_0047179 | Ga0495585_0047179_698_1537 | 266 |
| 439 | 3300046500 | Ga0495596_0005631 | Ga0495596_0005631_2956_3795 | 266 |
| 440 | 3300046500 | Ga0495596_0016351 | Ga0495596_0016351_1413_2240 | 266 |
| 441 | 3300046501 | Ga0495607_0069310 | Ga0495607_0069310_310_1149 | 266 |
| 442 | 3300046506 | Ga0495583_0021534 | Ga0495583_0021534_202_1038 | 266 |
| 443 | 3300046507 | Ga0495606_0082035 | Ga0495606_0082035_66_893 | 266 |
| 444 | 3300046513 | Ga0495616_0080131 | Ga0495616_0080131_589_1428 | 266 |
| 445 | 3300046518 | Ga0495631_0003567 | Ga0495631_0003567_162_1001 | 266 |
| 446 | 3300046518 | Ga0495631_0036378 | Ga0495631_0036378_551_1378 | 266 |
| 447 | 3300046518 | Ga0495631_0115215 | Ga0495631_0115215_143_982 | 266 |
| 448 | 3300046524 | Ga0495648_0013334 | Ga0495648_0013334_501_1337 | 266 |
| 449 | 3300046526 | Ga0495666_0001332 | Ga0495666_0001332_5092_5928 | 266 |
| 450 | 3300046530 | Ga0495654_0037963 | Ga0495654_0037963_75_905 | 266 |
| 451 | 3300046531 | Ga0495665_0015305 | Ga0495665_0015305_786_1622 | 266 |
| 452 | 3300046533 | Ga0495640_0039917 | Ga0495640_0039917_2077_2904 | 266 |
| 453 | 3300046538 | Ga0495609_0047481 | Ga0495609_0047481_462_1301 | 266 |
| 454 | 3300046542 | Ga0495597_0014646 | Ga0495597_0014646_465_1292 | 266 |
| 455 | 3300046542 | Ga0495597_0031013 | Ga0495597_0031013_309_1139 | 266 |
| 456 | 3300046558 | Ga0495633_0053185 | Ga0495633_0053185_161_1000 | 266 |
| 457 | 3300046616 | Ga0495668_0010491 | Ga0495668_0010491_2009_2848 | 266 |
| 458 | 3300046648 | Ga0495611_0011658 | Ga0495611_0011658_568_1407 | 266 |
| 459 | 3300046660 | Ga0495625_0004095 | Ga0495625_0004095_6561_7391 | 266 |
| 460 | 3300046664 | Ga0495659_0000072 | Ga0495659_0000072_22100_22930 | 266 |
| 461 | 3300046665 | Ga0495661_0002151 | Ga0495661_0002151_9316_10155 | 266 |
| 462 | 3300046665 | Ga0495661_0023405 | Ga0495661_0023405_2760_3596 | 266 |
| 463 | 3300046665 | Ga0495661_0029346 | Ga0495661_0029346_2414_3241 | 266 |
| 464 | 3300046679 | Ga0495623_0150933 | Ga0495623_0150933_66_902 | 266 |
| 465 | 3300046684 | Ga0495669_0000061 | Ga0495669_0000061_37083_37922 | 266 |
| 466 | 3300046684 | Ga0495669_0019302 | Ga0495669_0019302_886_1713 | 266 |
| 467 | 3300046691 | Ga0495670_0000980 | Ga0495670_0000980_7503_8342 | 266 |
| 468 | 3300046692 | Ga0495671_0000281 | Ga0495671_0000281_19881_20711 | 266 |
| 469 | 3300046794 | Ga0495589_0007740 | Ga0495589_0007740_2475_3302 | 266 |
| 470 | 3300047315 | Ga0495581_0003008 | Ga0495581_0003008_6016_6855 | 266 |
| 471 | 3300047318 | Ga0495636_0054269 | Ga0495636_0054269_56_895 | 266 |
| 472 | 3300047320 | Ga0495672_0000026 | Ga0495672_0000026_326013_326843 | 266 |
| 473 | 3300047443 | Ga0495687_000117 | Ga0495687_000117_19608_20444 | 266 |
| 474 | 3300047443 | Ga0495687_000314 | Ga0495687_000314_45208_46035 | 266 |
| 475 | 3300047443 | Ga0495687_032347 | Ga0495687_032347_808_1635 | 266 |
| 476 | 3300047444 | Ga0495675_0117936 | Ga0495675_0117936_414_1250 | 266 |
| 477 | 3300047445 | Ga0495677_0008307 | Ga0495677_0008307_297_1136 | 266 |
| 478 | 3300047445 | Ga0495677_0011569 | Ga0495677_0011569_1419_2258 | 266 |
| 479 | 3300047470 | Ga0495681_0002626 | Ga0495681_0002626_634_1458 | 266 |
| 480 | 3300047470 | Ga0495681_0006316 | Ga0495681_0006316_746_1585 | 266 |
| 481 | 3300047673 | Ga0495593_0021020 | Ga0495593_0021020_638_1477 | 266 |
| 482 | 3300048089 | Ga0495614_0006276 | Ga0495614_0006276_697_1536 | 266 |
| 483 | 3300048904 | Ga0496101_0000093 | Ga0496101_0000093_7762_8601 | 266 |
| 484 | 3300048909 | Ga0496106_0118047 | Ga0496106_0118047_915_1742 | 266 |
| 485 | 3300048910 | Ga0496107_0047525 | Ga0496107_0047525_2056_2883 | 266 |
| 486 | 3300048913 | Ga0496110_0326130 | Ga0496110_0326130_138_965 | 266 |
| 487 | 3300048914 | Ga0496111_0063039 | Ga0496111_0063039_591_1418 | 266 |
| 488 | 3300048920 | Ga0496117_0158579 | Ga0496117_0158579_265_1104 | 266 |
| 489 | 3300048922 | Ga0496119_0017822 | Ga0496119_0017822_454_1293 | 266 |
| 490 | 3300048923 | Ga0496120_0001787 | Ga0496120_0001787_8651_9490 | 266 |
| 491 | 3300048925 | Ga0496122_0006111 | Ga0496122_0006111_7584_8423 | 266 |
| 492 | 3300048926 | Ga0496123_0000677 | Ga0496123_0000677_41208_42047 | 266 |
| 493 | 3300048927 | Ga0496124_0029422 | Ga0496124_0029422_3742_4581 | 266 |
| 494 | iso_pu_bacteria | 2643221645 | 2644255055 | 266 |
| 495 | iso_pu_bacteria | 2643221664 | 2644359156 | 266 |
| 496 | iso_pu_bacteria | 2738541280 | 2738738426 | 266 |
| 497 | iso_pu_bacteria | 2738541300 | 2738842775 | 266 |
| 498 | iso_pu_bacteria | 2738543018 | 2739273522 | 266 |
| 499 | iso_pu_bacteria | 2738543030 | 2739342566 | 266 |
| 500 | iso_pu_bacteria | 2919046199 | 2919048906 | 266 |
| 501 | 3300009011 | Ga0105251_10006802 | Ga0105251_100068022 | 267 |
| 502 | 3300048919 | Ga0496116_0088929 | Ga0496116_0088929_758_1597 | 267 |
| 503 | iso_pu_bacteria | 2895511927 | 2895514896 | 267 |
| 504 | iso_pu_bacteria | 8054357960 | 8054359780 | 267 |
| 505 | 3300013306 | Ga0163162_10000877 | Ga0163162_100008776 | 268 |
| 506 | 3300041413 | Ga0439465_0008062 | Ga0439465_0008062_188_1039 | 268 |
| 507 | 3300042007 | Ga0439449_0000072 | Ga0439449_0000072_30180_31031 | 268 |
| 508 | 3300042876 | Ga0451577_0417004 | Ga0451577_0417004_213_1037 | 268 |
| 509 | 3300049776 | Ga0501280_002240 | Ga0501280_002240_2052_2873 | 268 |
| 510 | iso_pu_bacteria | 2808606418 | 2809146169 | 268 |
| 511 | 3300045051 | Ga0451576_0038638 | Ga0451576_0038638_652_1497 | 269 |
| 512 | iso_pu_bacteria | 2510065053 | 2510284579 | 270 |
| 513 | iso_pu_bacteria | 2510065055 | 2510295707 | 270 |
| 514 | iso_pu_bacteria | 2510065058 | 2510311957 | 270 |
| 515 | iso_pu_bacteria | 2728369097 | 2729147188 | 270 |
| 516 | iso_pu_bacteria | 2773857672 | 2774130740 | 270 |
| 517 | iso_pu_bacteria | 2887630918 | 2887631094 | 270 |
| 518 | iso_pu_bacteria | 2917832318 | 2917834445 | 270 |
| 519 | iso_pu_bacteria | 2919125081 | 2919128001 | 270 |
| 520 | iso_pu_bacteria | 2919501602 | 2919501717 | 270 |
| 521 | iso_pu_bacteria | 2926063275 | 2926063390 | 270 |
| 522 | iso_pu_bacteria | 2974298342 | 2974298406 | 270 |
| 523 | iso_pu_bacteria | 2984499530 | 2984504215 | 270 |
| 524 | iso_pu_bacteria | 2984504281 | 2984505911 | 270 |
| 525 | iso_pu_bacteria | 2990196909 | 2990200736 | 270 |
| 526 | iso_pu_bacteria | 3007252601 | 3007255925 | 270 |
| 527 | iso_pu_bacteria | 640427133 | 640489123 | 270 |
| 528 | iso_pu_bacteria | 651053060 | 651177218 | 270 |
| 529 | iso_pu_bacteria | 8016728285 | 8016732129 | 270 |
| 530 | iso_pu_bacteria | 8057160832 | 8057162085 | 270 |
| 531 | 3300028666 | Ga0265336_10000185 | Ga0265336_1000018535 | 271 |
| 532 | 3300029957 | Ga0265324_10000011 | Ga0265324_10000011132 | 271 |
| 533 | 3300031241 | Ga0265325_10000447 | Ga0265325_100004478 | 271 |
| 534 | 3300031711 | Ga0265314_10018536 | Ga0265314_100185365 | 271 |
| 535 | iso_pu_bacteria | 2899803654 | 2899808232 | 271 |
| 536 | 3300009553 | Ga0105249_10029317 | Ga0105249_100293174 | 272 |
| 537 | 3300026118 | Ga0207675_100244032 | Ga0207675_1002440323 | 272 |
| 538 | 3300045051 | Ga0451576_0000677 | Ga0451576_0000677_16791_17651 | 272 |
| 539 | iso_pu_bacteria | 2524614729 | 2525556202 | 272 |
| 540 | iso_pu_bacteria | 2627854209 | 2630649432 | 272 |
| 541 | iso_pu_bacteria | 2643221551 | 2643776797 | 272 |
| 542 | iso_pu_bacteria | 2643221555 | 2643795245 | 272 |
| 543 | iso_pu_bacteria | 2671180115 | 2671584787 | 272 |
| 544 | iso_pu_bacteria | 2854601825 | 2854602505 | 272 |
| 545 | iso_pu_bacteria | 2923525760 | 2923527589 | 272 |
| 546 | iso_pu_bacteria | 2939602548 | 2939605671 | 272 |
| 547 | iso_pu_bacteria | 8002745576 | 8002746506 | 272 |
| 548 | iso_pu_bacteria | 8003400568 | 8003403991 | 272 |
| 549 | iso_pu_bacteria | 8054844752 | 8054845538 | 272 |
| 550 | 3300009011 | Ga0105251_10001860 | Ga0105251_100018606 | 273 |
| 551 | 3300025735 | Ga0207713_1005377 | Ga0207713_10053773 | 273 |
| 552 | 3300039438 | Ga0436360_0106361 | Ga0436360_0106361_1899_2771 | 273 |
| 553 | 3300049576 | Ga0501040_0015365 | Ga0501040_0015365_2163_3044 | 273 |
| 554 | 3300049743 | Ga0501081_0053143 | Ga0501081_0053143_1397_2278 | 273 |
| 555 | 3300049822 | Ga0501035_0073462 | Ga0501035_0073462_1366_2220 | 273 |
| 556 | iso_pu_bacteria | 2513237150 | 2513956605 | 273 |
| 557 | iso_pu_bacteria | 2513237165 | 2514044077 | 273 |
| 558 | iso_pu_bacteria | 2558860983 | 2561466922 | 273 |
| 559 | iso_pu_bacteria | 2738543020 | 2739289253 | 273 |
| 560 | iso_pu_bacteria | 2738543021 | 2739294565 | 273 |
| 561 | iso_pu_bacteria | 2834641062 | 2834642502 | 273 |
| 562 | iso_pu_bacteria | 644736347 | 644749115 | 273 |
| 563 | iso_pu_bacteria | 8055431914 | 8055435766 | 273 |
| 564 | 3300006051 | Ga0075364_10001253 | Ga0075364_100012534 | 274 |
| 565 | 3300044712 | Ga0453684_0001224 | Ga0453684_0001224_2661_3521 | 274 |
| 566 | 3300050491 | nmdc:mga00v17_225_c1 | nmdc:mga00v17_225_c1_21784_22680 | 274 |
| 567 | iso_pu_bacteria | 2706794495 | 2707099181 | 274 |
| 568 | iso_pu_bacteria | 8055693939 | 8055695822 | 274 |
| 569 | 3300031727 | Ga0316576_10026359 | Ga0316576_100263592 | 275 |
| 570 | iso_pu_bacteria | 2511231025 | 2511381304 | 275 |
| 571 | iso_pu_bacteria | 2511231035 | 2511437239 | 275 |
| 572 | iso_pu_bacteria | 2547132181 | 2547695761 | 275 |
| 573 | iso_pu_bacteria | 2791355010 | 2792310772 | 275 |
| 574 | iso_pu_bacteria | 2874220319 | 2874220324 | 275 |
| 575 | iso_pu_bacteria | 2876601092 | 2876603834 | 275 |
| 576 | iso_pu_bacteria | 2900051742 | 2900051845 | 275 |
| 577 | iso_pu_bacteria | 2961047084 | 2961047089 | 275 |
| 578 | iso_pu_bacteria | 8016733728 | 8016735528 | 275 |
| 579 | iso_pu_bacteria | 8019499862 | 8019501084 | 275 |
| 580 | 3300031691 | Ga0316579_10079847 | Ga0316579_100798472 | 276 |
| 581 | iso_pu_bacteria | 2537561728 | 2538424723 | 276 |
| 582 | iso_pu_bacteria | 2599185299 | 2599925388 | 276 |
| 583 | iso_pu_bacteria | 2648501693 | 2650898723 | 276 |
| 584 | iso_pu_bacteria | 2684622997 | 2686353107 | 276 |
| 585 | iso_pu_bacteria | 2808606414 | 2809123840 | 276 |
| 586 | iso_pu_bacteria | 2847797336 | 2847800113 | 276 |
| 587 | iso_pu_bacteria | 2855195626 | 2855197215 | 276 |
| 588 | iso_pu_bacteria | 2858466076 | 2858468627 | 276 |
| 589 | iso_pu_bacteria | 2871272651 | 2871272946 | 276 |
| 590 | iso_pu_bacteria | 2871282230 | 2871283791 | 276 |
| 591 | iso_pu_bacteria | 2984494565 | 2984496393 | 276 |
| 592 | iso_pu_bacteria | 2990261002 | 2990261814 | 276 |
| 593 | iso_pu_bacteria | 8054849141 | 8054852948 | 276 |
| 594 | 3300031250 | Ga0265331_10006445 | Ga0265331_100064455 | 277 |
| 595 | iso_pu_bacteria | 2648501241 | 2649122528 | 277 |
| 596 | iso_pu_bacteria | 2651869818 | 2652976087 | 277 |
| 597 | iso_pu_bacteria | 2969079654 | 2969081668 | 277 |
| 598 | 3300001989 | JGI24739J22299_10001449 | JGI24739J22299_100014497 | 280 |
| 599 | 3300009036 | Ga0105244_10002459 | Ga0105244_100024597 | 280 |
| 600 | 3300013104 | Ga0157370_10003676 | Ga0157370_1000367610 | 280 |
| 601 | 3300025728 | Ga0207655_1008198 | Ga0207655_10081987 | 280 |
| 602 | 3300042010 | Ga0439452_000001 | Ga0439452_000001_571101_571943 | 280 |
| 603 | 3300048919 | Ga0496116_0000300 | Ga0496116_0000300_81713_82555 | 280 |
| 604 | 3300048920 | Ga0496117_0000388 | Ga0496117_0000388_22452_23294 | 280 |
| 605 | 3300048921 | Ga0496118_0007368 | Ga0496118_0007368_7786_8628 | 280 |
| 606 | 3300048927 | Ga0496124_0089878 | Ga0496124_0089878_1626_2468 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t43-assembly1.cif.gz_A | crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) | 0.969 | 2 | 273 |
| 1t43-assembly1.cif.gz_A | crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) | 0.9587 | 2 | 273 |
| 1vq1-assembly2.cif.gz_B | crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution | 0.9114 | 1 | 272 |
| 1nv8-assembly2.cif.gz_B | n5-glutamine methyltransferase, hemk | 0.91 | 3 | 272 |
| 1vq1-assembly1.cif.gz_A | crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution | 0.9027 | 1 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ACC1_1_83_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 1.001 | 1 | 82 | 1.10.8.10 |
| 2b3tA01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.9846 | 1 | 84 | 1.10.8.10 |
| af_P0ACC1_1_83_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.9771 | 1 | 82 | 1.10.8.10 |
| 2b3tA01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.9732 | 1 | 84 | 1.10.8.10 |
| 1t43A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9705 | 85 | 273 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K8CDC3-F1-model_v4 | deleted | 0.9954 | 106 | 276 |
|
| AF-Q5E6T2-F1-model_v4 | Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) | 0.9919 | 1 | 276 |
GO:0003676
GO:0032259 GO:0036009 GO:0102559 |
| AF-A0A3B9A882-F1-model_v4 | Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) | 0.991 | 63 | 276 |
GO:0003676
GO:0032259 GO:0036009 GO:0102559 |
| AF-A0A3M2ZX95-F1-model_v4 | peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) | 0.9895 | 69 | 276 |
GO:0003676
GO:0032259 GO:0036009 GO:0102559 |
| AF-A0A800EG60-F1-model_v4 | deleted | 0.9855 | 1 | 177 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar