F468563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 606 | 280 | 1212 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100135066|Ga0070698_1001350663 |
| Length | 191 |
| Sequence | MGHAKESVSFPGEASEAKGDLDLVERQLGRRPRAFRRVVVRCPFGAPAVTEQAAYDASGDPFPTTYYVTCPQLVAAVSRLEAAGGVERWSEAAQREPALAESLARATAEQRRVRAELAAGELGPDAGASLDLGIGGSRNPEQLKCLHAHVAFALARPGYELGERIVAEIDPLWPRTCCMNSRGVAVSSNAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 108 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 110 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 111 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 117 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 118 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 123 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 125 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 134 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 136 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 137 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 138 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 139 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 140 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 141 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 142 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 145 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 146 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 147 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 148 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 149 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 150 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 151 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 260 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 261 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 262 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 278 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 280 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.32 |
| Nodule | 0 |
| Rhizoplane | 8.58 |
| Rhizosphere | 89.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070698_100135066 | 3300005471 | Bacteria | 2421 |
| 2 | JGI25407J50210_10002089 | 3300003373 | Bacteria | 4664 |
| 3 | JGI25407J50210_10003349 | 3300003373 | Bacteria | 3822 |
| 4 | Ga0070658_10089856 | 3300005327 | Bacteria | 2529 |
| 5 | Ga0070683_100007995 | 3300005329 | Bacteria | 8973 |
| 6 | Ga0070683_100012452 | 3300005329 | Bacteria | 7394 |
| 7 | Ga0070683_100039148 | 3300005329 | Bacteria | 4351 |
| 8 | Ga0070680_100021220 | 3300005336 | Bacteria | 5160 |
| 9 | Ga0070680_100303269 | 3300005336 | Unclassified | 1355 |
| 10 | Ga0070660_100127947 | 3300005339 | Bacteria | 2030 |
| 11 | Ga0070660_100160605 | 3300005339 | Bacteria | 1811 |
| 12 | Ga0070661_100069862 | 3300005344 | Bacteria | 2582 |
| 13 | Ga0070661_100225961 | 3300005344 | Bacteria | 1437 |
| 14 | Ga0070692_10184535 | 3300005345 | Unclassified | 1211 |
| 15 | Ga0070668_100207993 | 3300005347 | Bacteria | 1608 |
| 16 | Ga0070675_100467441 | 3300005354 | Bacteria | 1133 |
| 17 | Ga0070674_100065009 | 3300005356 | Bacteria | 2559 |
| 18 | Ga0070659_100200646 | 3300005366 | Bacteria | 1642 |
| 19 | Ga0070709_10147255 | 3300005434 | Unclassified | 1624 |
| 20 | Ga0070709_11255209 | 3300005434 | Unclassified | 597 |
| 21 | Ga0070714_100017768 | 3300005435 | Bacteria | 5766 |
| 22 | Ga0070714_100070727 | 3300005435 | Bacteria | 3016 |
| 23 | Ga0070714_100136588 | 3300005435 | Bacteria | 2197 |
| 24 | Ga0070714_100419575 | 3300005435 | Unclassified | 1267 |
| 25 | Ga0070714_101038676 | 3300005435 | Bacteria | 798 |
| 26 | Ga0070713_100418647 | 3300005436 | Bacteria | 1254 |
| 27 | Ga0070710_10425118 | 3300005437 | Bacteria | 895 |
| 28 | Ga0070711_100166213 | 3300005439 | Bacteria | 1677 |
| 29 | Ga0070711_100455108 | 3300005439 | Bacteria | 1048 |
| 30 | Ga0070711_100683625 | 3300005439 | Bacteria | 863 |
| 31 | Ga0070705_100146727 | 3300005440 | Unclassified | 1560 |
| 32 | Ga0070708_100544841 | 3300005445 | Bacteria | 1094 |
| 33 | Ga0070662_100372689 | 3300005457 | Bacteria | 1173 |
| 34 | Ga0070662_100384829 | 3300005457 | Bacteria | 1155 |
| 35 | Ga0070681_10002582 | 3300005458 | Bacteria | 16612 |
| 36 | Ga0070681_10015596 | 3300005458 | Bacteria | 7567 |
| 37 | Ga0068867_100867960 | 3300005459 | Bacteria | 810 |
| 38 | Ga0068867_101551421 | 3300005459 | Bacteria | 618 |
| 39 | Ga0070685_10138535 | 3300005466 | Unclassified | 1529 |
| 40 | Ga0070685_10429360 | 3300005466 | Bacteria | 921 |
| 41 | Ga0070706_100457816 | 3300005467 | Unclassified | 1187 |
| 42 | Ga0070707_100041396 | 3300005468 | Bacteria | 4409 |
| 43 | Ga0070707_101246799 | 3300005468 | Bacteria | 710 |
| 44 | Ga0070699_100021443 | 3300005518 | Bacteria | 5572 |
| 45 | Ga0070679_100003582 | 3300005530 | Bacteria | 14210 |
| 46 | Ga0070679_100028851 | 3300005530 | Bacteria | 5473 |
| 47 | Ga0070679_101347425 | 3300005530 | Bacteria | 659 |
| 48 | Ga0070684_100002126 | 3300005535 | Bacteria | 14619 |
| 49 | Ga0070684_100006736 | 3300005535 | Bacteria | 8912 |
| 50 | Ga0070684_100007785 | 3300005535 | Bacteria | 8356 |
| 51 | Ga0070684_100042730 | 3300005535 | Bacteria | 3914 |
| 52 | Ga0070684_100082044 | 3300005535 | Bacteria | 2854 |
| 53 | Ga0070684_100293151 | 3300005535 | Bacteria | 1492 |
| 54 | Ga0068853_100500911 | 3300005539 | Unclassified | 1146 |
| 55 | Ga0070704_100406875 | 3300005549 | Bacteria | 1162 |
| 56 | Ga0068855_100530153 | 3300005563 | Unclassified | 1277 |
| 57 | Ga0070664_100086916 | 3300005564 | Bacteria | 2702 |
| 58 | Ga0070664_100474255 | 3300005564 | Bacteria | 1151 |
| 59 | Ga0070664_100667108 | 3300005564 | Bacteria | 967 |
| 60 | Ga0068857_100027674 | 3300005577 | Bacteria | 5001 |
| 61 | Ga0068857_100053842 | 3300005577 | Bacteria | 3570 |
| 62 | Ga0068857_100086946 | 3300005577 | Bacteria | 2796 |
| 63 | Ga0068856_100263442 | 3300005614 | Bacteria | 1739 |
| 64 | Ga0070702_100182867 | 3300005615 | Bacteria | 1373 |
| 65 | Ga0068870_10002935 | 3300005840 | Bacteria | 7182 |
| 66 | Ga0068870_10379482 | 3300005840 | Bacteria | 915 |
| 67 | Ga0081455_10010510 | 3300005937 | Bacteria | 9380 |
| 68 | Ga0081455_10024006 | 3300005937 | Bacteria | 5658 |
| 69 | Ga0081538_10000764 | 3300005981 | Bacteria | 35156 |
| 70 | Ga0081538_10003134 | 3300005981 | Bacteria | 15720 |
| 71 | Ga0081538_10069515 | 3300005981 | Bacteria | 1950 |
| 72 | Ga0081540_1004199 | 3300005983 | Bacteria | 11072 |
| 73 | Ga0070717_10009460 | 3300006028 | Bacteria | 7326 |
| 74 | Ga0070717_10024240 | 3300006028 | Bacteria | 4816 |
| 75 | Ga0075365_10010270 | 3300006038 | Bacteria | 5441 |
| 76 | Ga0075364_10044927 | 3300006051 | Bacteria | 2874 |
| 77 | Ga0075432_10344483 | 3300006058 | Unclassified | 630 |
| 78 | Ga0070715_10136242 | 3300006163 | Unclassified | 1187 |
| 79 | Ga0070716_100151157 | 3300006173 | Bacteria | 1493 |
| 80 | Ga0075362_10007581 | 3300006177 | Bacteria | 4119 |
| 81 | Ga0075428_100002031 | 3300006844 | Bacteria | 21804 |
| 82 | Ga0075428_100163168 | 3300006844 | Bacteria | 2418 |
| 83 | Ga0075430_100004550 | 3300006846 | Bacteria | 11676 |
| 84 | Ga0075431_100008749 | 3300006847 | Bacteria | 10142 |
| 85 | Ga0075431_100322692 | 3300006847 | Bacteria | 1557 |
| 86 | Ga0075433_10081721 | 3300006852 | Bacteria | 2849 |
| 87 | Ga0075433_10151630 | 3300006852 | Bacteria | 2062 |
| 88 | Ga0075433_10225593 | 3300006852 | Bacteria | 1664 |
| 89 | Ga0075434_100076309 | 3300006871 | Bacteria | 3346 |
| 90 | Ga0075434_100116156 | 3300006871 | Bacteria | 2689 |
| 91 | Ga0075434_101208651 | 3300006871 | Bacteria | 768 |
| 92 | Ga0075429_100053827 | 3300006880 | Bacteria | 3501 |
| 93 | Ga0075429_100179406 | 3300006880 | Bacteria | 1856 |
| 94 | Ga0075435_100002208 | 3300007076 | Bacteria | 12844 |
| 95 | Ga0075435_100070872 | 3300007076 | Bacteria | 2846 |
| 96 | Ga0075435_100212019 | 3300007076 | Bacteria | 1643 |
| 97 | Ga0075435_100719065 | 3300007076 | Bacteria | 868 |
| 98 | Ga0105240_11281314 | 3300009093 | Bacteria | 774 |
| 99 | Ga0111539_10165451 | 3300009094 | Bacteria | 2586 |
| 100 | Ga0111539_10264614 | 3300009094 | Unclassified | 2002 |
| 101 | Ga0111539_10394271 | 3300009094 | Bacteria | 1612 |
| 102 | Ga0111539_10706518 | 3300009094 | Bacteria | 1173 |
| 103 | Ga0105245_10148930 | 3300009098 | Bacteria | 2211 |
| 104 | Ga0105245_10437535 | 3300009098 | Bacteria | 1314 |
| 105 | Ga0105247_10120626 | 3300009101 | Bacteria | 1698 |
| 106 | Ga0114129_10000663 | 3300009147 | Bacteria | 43174 |
| 107 | Ga0114129_10218069 | 3300009147 | Bacteria | 2576 |
| 108 | Ga0114129_10332478 | 3300009147 | Bacteria | 2017 |
| 109 | Ga0114129_10389606 | 3300009147 | Unclassified | 1838 |
| 110 | Ga0114129_10491900 | 3300009147 | Bacteria | 1603 |
| 111 | Ga0114129_10531841 | 3300009147 | Bacteria | 1531 |
| 112 | Ga0114129_12064382 | 3300009147 | Bacteria | 688 |
| 113 | Ga0105243_10141954 | 3300009148 | Bacteria | 2050 |
| 114 | Ga0105243_10941211 | 3300009148 | Bacteria | 862 |
| 115 | Ga0105237_11208119 | 3300009545 | Bacteria | 763 |
| 116 | Ga0105238_10040039 | 3300009551 | Bacteria | 4750 |
| 117 | Ga0099796_10022206 | 3300010159 | Bacteria | 1966 |
| 118 | Ga0105239_10148822 | 3300010375 | Bacteria | 2613 |
| 119 | Ga0157369_10422903 | 3300013105 | Bacteria | 1381 |
| 120 | Ga0157374_10060432 | 3300013296 | Bacteria | 3546 |
| 121 | Ga0157378_10657147 | 3300013297 | Bacteria | 1064 |
| 122 | Ga0163162_10064750 | 3300013306 | Bacteria | 3701 |
| 123 | Ga0163162_11133522 | 3300013306 | Unclassified | 887 |
| 124 | Ga0157375_10268818 | 3300013308 | Unclassified | 1867 |
| 125 | Ga0157375_10764025 | 3300013308 | Bacteria | 1117 |
| 126 | Ga0163163_10422600 | 3300014325 | Unclassified | 1392 |
| 127 | Ga0163163_10674762 | 3300014325 | Bacteria | 1097 |
| 128 | Ga0157380_11067768 | 3300014326 | Bacteria | 845 |
| 129 | Ga0157376_10043809 | 3300014969 | Bacteria | 3674 |
| 130 | Ga0182007_10046002 | 3300015262 | Unclassified | 1445 |
| 131 | Ga0207692_10079976 | 3300025898 | Bacteria | 1745 |
| 132 | Ga0207699_10111583 | 3300025906 | Bacteria | 1753 |
| 133 | Ga0207643_10003192 | 3300025908 | Bacteria | 8831 |
| 134 | Ga0207705_10044389 | 3300025909 | Bacteria | 3194 |
| 135 | Ga0207684_10562928 | 3300025910 | Bacteria | 975 |
| 136 | Ga0207707_10017662 | 3300025912 | Bacteria | 6221 |
| 137 | Ga0207707_10107393 | 3300025912 | Bacteria | 2440 |
| 138 | Ga0207693_10001487 | 3300025915 | Bacteria | 20704 |
| 139 | Ga0207693_10007145 | 3300025915 | Bacteria | 9210 |
| 140 | Ga0207663_10167057 | 3300025916 | Unclassified | 1559 |
| 141 | Ga0207660_10014983 | 3300025917 | Bacteria | 5109 |
| 142 | Ga0207660_10188440 | 3300025917 | Unclassified | 1605 |
| 143 | Ga0207657_10035698 | 3300025919 | Bacteria | 4456 |
| 144 | Ga0207657_10094043 | 3300025919 | Bacteria | 2496 |
| 145 | Ga0207657_10116681 | 3300025919 | Bacteria | 2199 |
| 146 | Ga0207649_10046066 | 3300025920 | Bacteria | 2677 |
| 147 | Ga0207649_10175620 | 3300025920 | Bacteria | 1496 |
| 148 | Ga0207652_10117748 | 3300025921 | Bacteria | 2360 |
| 149 | Ga0207652_10342431 | 3300025921 | Bacteria | 1350 |
| 150 | Ga0207646_10046517 | 3300025922 | Bacteria | 3893 |
| 151 | Ga0207650_10002691 | 3300025925 | Bacteria | 12273 |
| 152 | Ga0207687_10036227 | 3300025927 | Bacteria | 3360 |
| 153 | Ga0207687_10064716 | 3300025927 | Bacteria | 2594 |
| 154 | Ga0207700_10043659 | 3300025928 | Bacteria | 3294 |
| 155 | Ga0207700_10109038 | 3300025928 | Bacteria | 2224 |
| 156 | Ga0207664_10008451 | 3300025929 | Bacteria | 7182 |
| 157 | Ga0207664_10032880 | 3300025929 | Bacteria | 3979 |
| 158 | Ga0207664_10233888 | 3300025929 | Bacteria | 1598 |
| 159 | Ga0207664_10326299 | 3300025929 | Unclassified | 1355 |
| 160 | Ga0207664_10414375 | 3300025929 | Unclassified | 1199 |
| 161 | Ga0207664_11026461 | 3300025929 | Bacteria | 739 |
| 162 | Ga0207690_10443855 | 3300025932 | Unclassified | 1042 |
| 163 | Ga0207690_10752446 | 3300025932 | Unclassified | 803 |
| 164 | Ga0207706_10471618 | 3300025933 | Bacteria | 1085 |
| 165 | Ga0207706_10710412 | 3300025933 | Bacteria | 858 |
| 166 | Ga0207709_10400535 | 3300025935 | Bacteria | 1049 |
| 167 | Ga0207669_11213705 | 3300025937 | Unclassified | 639 |
| 168 | Ga0207704_10846662 | 3300025938 | Bacteria | 766 |
| 169 | Ga0207665_10000298 | 3300025939 | Bacteria | 34286 |
| 170 | Ga0207665_10091992 | 3300025939 | Bacteria | 2103 |
| 171 | Ga0207661_10021449 | 3300025944 | Bacteria | 4839 |
| 172 | Ga0207661_10067217 | 3300025944 | Bacteria | 2914 |
| 173 | Ga0207661_10290539 | 3300025944 | Unclassified | 1463 |
| 174 | Ga0207661_10646117 | 3300025944 | Bacteria | 972 |
| 175 | Ga0207661_11292338 | 3300025944 | Bacteria | 670 |
| 176 | Ga0207679_10069709 | 3300025945 | Bacteria | 2647 |
| 177 | Ga0207651_10548655 | 3300025960 | Bacteria | 1005 |
| 178 | Ga0207677_10173264 | 3300026023 | Unclassified | 1690 |
| 179 | Ga0207677_10815614 | 3300026023 | Bacteria | 836 |
| 180 | Ga0207639_11171689 | 3300026041 | Bacteria | 721 |
| 181 | Ga0207708_10620904 | 3300026075 | Bacteria | 917 |
| 182 | Ga0207708_10667107 | 3300026075 | Unclassified | 886 |
| 183 | Ga0207708_11485189 | 3300026075 | Unclassified | 595 |
| 184 | Ga0207648_10066369 | 3300026089 | Bacteria | 3147 |
| 185 | Ga0207648_10578084 | 3300026089 | Bacteria | 1034 |
| 186 | Ga0207674_10001702 | 3300026116 | Bacteria | 28143 |
| 187 | Ga0207674_10024757 | 3300026116 | Bacteria | 6407 |
| 188 | Ga0207674_10066083 | 3300026116 | Bacteria | 3644 |
| 189 | Ga0207674_10141014 | 3300026116 | Bacteria | 2369 |
| 190 | Ga0207683_10118683 | 3300026121 | Bacteria | 2373 |
| 191 | Ga0207428_10004697 | 3300027907 | Bacteria | 12932 |
| 192 | Ga0207428_10016837 | 3300027907 | Bacteria | 6282 |
| 193 | Ga0207428_10111453 | 3300027907 | Bacteria | 2105 |
| 194 | Ga0265318_10092624 | 3300028577 | Bacteria | 1113 |
| 195 | Ga0307408_100175947 | 3300031548 | Bacteria | 1712 |
| 196 | Ga0307405_10368929 | 3300031731 | Bacteria | 1113 |
| 197 | Ga0307405_10799605 | 3300031731 | Bacteria | 790 |
| 198 | Ga0307413_10050193 | 3300031824 | Bacteria | 2505 |
| 199 | Ga0307410_10033585 | 3300031852 | Bacteria | 3313 |
| 200 | Ga0307406_10032384 | 3300031901 | Bacteria | 3191 |
| 201 | Ga0307412_10060967 | 3300031911 | Bacteria | 2534 |
| 202 | Ga0307409_100067053 | 3300031995 | Bacteria | 2832 |
| 203 | Ga0307409_100523577 | 3300031995 | Bacteria | 1159 |
| 204 | Ga0307416_100021260 | 3300032002 | Bacteria | 4654 |
| 205 | Ga0307416_100097466 | 3300032002 | Bacteria | 2546 |
| 206 | Ga0307414_10297670 | 3300032004 | Bacteria | 1363 |
| 207 | Ga0307411_10040458 | 3300032005 | Bacteria | 2957 |
| 208 | Ga0307415_100099430 | 3300032126 | Bacteria | 2129 |
| 209 | Ga0373944_0013885 | 3300035089 | Bacteria | 2241 |
| 210 | Ga0373923_0122444 | 3300035111 | Bacteria | 1163 |
| 211 | Ga0373936_0158085 | 3300035113 | Bacteria | 986 |
| 212 | Ga0373945_0037241 | 3300035116 | Bacteria | 1745 |
| 213 | Ga0373943_0054145 | 3300035170 | Bacteria | 1983 |
| 214 | Ga0373943_0096576 | 3300035170 | Bacteria | 1539 |
| 215 | Ga0373943_0248244 | 3300035170 | Bacteria | 999 |
| 216 | Ga0373931_0008105 | 3300035691 | Bacteria | 4975 |
| 217 | Ga0373927_0013559 | 3300035695 | Bacteria | 5413 |
| 218 | Ga0373947_0006331 | 3300035725 | Bacteria | 6877 |
| 219 | Ga0373937_0000447 | 3300036401 | Bacteria | 38075 |
| 220 | Ga0373925_0002886 | 3300037068 | Bacteria | 13581 |
| 221 | Ga0395899_0003964 | 3300037312 | Bacteria | 11663 |
| 222 | Ga0395899_0044717 | 3300037312 | Bacteria | 3299 |
| 223 | Ga0395899_0058333 | 3300037312 | Bacteria | 2847 |
| 224 | Ga0395899_0126712 | 3300037312 | Bacteria | 1826 |
| 225 | Ga0395899_0133836 | 3300037312 | Bacteria | 1768 |
| 226 | Ga0395899_0153452 | 3300037312 | Bacteria | 1631 |
| 227 | Ga0395900_0007259 | 3300037418 | Bacteria | 11475 |
| 228 | Ga0395900_0024221 | 3300037418 | Bacteria | 6214 |
| 229 | Ga0395900_0047541 | 3300037418 | Bacteria | 4418 |
| 230 | Ga0395900_0049289 | 3300037418 | Bacteria | 4339 |
| 231 | Ga0395900_0055262 | 3300037418 | Bacteria | 4088 |
| 232 | Ga0395900_0068018 | 3300037418 | Bacteria | 3660 |
| 233 | Ga0395900_0097950 | 3300037418 | Bacteria | 3013 |
| 234 | Ga0395900_0141217 | 3300037418 | Bacteria | 2466 |
| 235 | Ga0395900_0164386 | 3300037418 | Bacteria | 2262 |
| 236 | Ga0395900_0630270 | 3300037418 | Bacteria | 1010 |
| 237 | Ga0395900_1029836 | 3300037418 | Viruses | 742 |
| 238 | Ga0395898_0003845 | 3300037466 | Bacteria | 16633 |
| 239 | Ga0395898_0008130 | 3300037466 | Bacteria | 11106 |
| 240 | Ga0395898_0009330 | 3300037466 | Bacteria | 10310 |
| 241 | Ga0395898_0043296 | 3300037466 | Bacteria | 4436 |
| 242 | Ga0395898_0053387 | 3300037466 | Bacteria | 3947 |
| 243 | Ga0395898_0095125 | 3300037466 | Bacteria | 2862 |
| 244 | Ga0395898_0140645 | 3300037466 | Bacteria | 2311 |
| 245 | Ga0395898_0383679 | 3300037466 | Bacteria | 1340 |
| 246 | Ga0395898_0681458 | 3300037466 | Viruses | 970 |
| 247 | Ga0395898_0943320 | 3300037466 | Unclassified | 800 |
| 248 | Ga0395898_1530568 | 3300037466 | Unclassified | 592 |
| 249 | Ga0395905_0013924 | 3300037471 | Bacteria | 7693 |
| 250 | Ga0395905_0016829 | 3300037471 | Bacteria | 6947 |
| 251 | Ga0395905_0057024 | 3300037471 | Bacteria | 3653 |
| 252 | Ga0395905_0132978 | 3300037471 | Unclassified | 2340 |
| 253 | Ga0395905_0287737 | 3300037471 | Bacteria | 1530 |
| 254 | Ga0395905_0377517 | 3300037471 | Bacteria | 1311 |
| 255 | Ga0395905_0497040 | 3300037471 | Bacteria | 1120 |
| 256 | Ga0395901_0003520 | 3300038443 | Bacteria | 15772 |
| 257 | Ga0395901_0008514 | 3300038443 | Bacteria | 10364 |
| 258 | Ga0395901_0009985 | 3300038443 | Bacteria | 9620 |
| 259 | Ga0395901_0023584 | 3300038443 | Bacteria | 6308 |
| 260 | Ga0395901_0033709 | 3300038443 | Bacteria | 5287 |
| 261 | Ga0395901_0035987 | 3300038443 | Bacteria | 5115 |
| 262 | Ga0395901_0055138 | 3300038443 | Bacteria | 4132 |
| 263 | Ga0395901_0070177 | 3300038443 | Unclassified | 3650 |
| 264 | Ga0395901_0088972 | 3300038443 | Bacteria | 3230 |
| 265 | Ga0395901_0089864 | 3300038443 | Bacteria | 3214 |
| 266 | Ga0395901_0223165 | 3300038443 | Unclassified | 1969 |
| 267 | Ga0395901_0436502 | 3300038443 | Bacteria | 1341 |
| 268 | Ga0395901_0534366 | 3300038443 | Unclassified | 1190 |
| 269 | Ga0395901_0558076 | 3300038443 | Bacteria | 1160 |
| 270 | Ga0395901_1249405 | 3300038443 | Bacteria | 706 |
| 271 | Ga0439438_068946 | 3300041405 | Bacteria | 877 |
| 272 | Ga0451789_0558252 | 3300041443 | Bacteria | 744 |
| 273 | Ga0451841_0020301 | 3300041498 | Bacteria | 624 |
| 274 | Ga0451849_1569805 | 3300041505 | Bacteria | 839 |
| 275 | Ga0451853_0186481 | 3300041512 | Bacteria | 1965 |
| 276 | Ga0439448_0141143 | 3300042005 | Bacteria | 834 |
| 277 | Ga0439458_0011985 | 3300042157 | Bacteria | 1942 |
| 278 | Ga0439434_0003874 | 3300042435 | Bacteria | 4372 |
| 279 | Ga0439440_0139918 | 3300042993 | Bacteria | 687 |
| 280 | Ga0466969_0017127 | 3300044656 | Bacteria | 3787 |
| 281 | Ga0466961_0030210 | 3300044693 | Bacteria | 3482 |
| 282 | Ga0466961_0126155 | 3300044693 | Unclassified | 1606 |
| 283 | Ga0466963_0000755 | 3300044694 | Bacteria | 15979 |
| 284 | Ga0466963_0149249 | 3300044694 | Bacteria | 1623 |
| 285 | Ga0466963_0178533 | 3300044694 | Unclassified | 1482 |
| 286 | Ga0466964_0004027 | 3300044706 | Bacteria | 5400 |
| 287 | Ga0466964_0010699 | 3300044706 | Bacteria | 3463 |
| 288 | Ga0466964_0164333 | 3300044706 | Bacteria | 1040 |
| 289 | Ga0466971_0006458 | 3300044719 | Bacteria | 5093 |
| 290 | Ga0466971_0010227 | 3300044719 | Bacteria | 4098 |
| 291 | Ga0466968_0046556 | 3300044735 | Bacteria | 1843 |
| 292 | Ga0466957_0053078 | 3300044842 | Bacteria | 2470 |
| 293 | Ga0466957_0525521 | 3300044842 | Bacteria | 822 |
| 294 | Ga0466960_0434493 | 3300044901 | Bacteria | 761 |
| 295 | Ga0466960_0631095 | 3300044901 | Bacteria | 638 |
| 296 | Ga0451576_1848763 | 3300045051 | Bacteria | 624 |
| 297 | Ga0466958_0016030 | 3300045836 | Bacteria | 4308 |
| 298 | Ga0466958_0076955 | 3300045836 | Unclassified | 2048 |
| 299 | Ga0466967_0019309 | 3300045976 | Bacteria | 5476 |
| 300 | Ga0466967_0028096 | 3300045976 | Bacteria | 4691 |
| 301 | Ga0466967_0033888 | 3300045976 | Bacteria | 4328 |
| 302 | Ga0466967_0136873 | 3300045976 | Bacteria | 2278 |
| 303 | Ga0466967_0321616 | 3300045976 | Unclassified | 1492 |
| 304 | Ga0466967_0731932 | 3300045976 | Bacteria | 980 |
| 305 | Ga0495592_0000124 | 3300046454 | Bacteria | 68396 |
| 306 | Ga0495592_0149124 | 3300046454 | Unclassified | 1619 |
| 307 | Ga0495592_0184618 | 3300046454 | Bacteria | 1418 |
| 308 | Ga0495603_0021025 | 3300046455 | Bacteria | 3951 |
| 309 | Ga0495603_0617789 | 3300046455 | Bacteria | 620 |
| 310 | Ga0495629_0032201 | 3300046459 | Bacteria | 3712 |
| 311 | Ga0495629_0120821 | 3300046459 | Bacteria | 1825 |
| 312 | Ga0495641_0004998 | 3300046461 | Bacteria | 9150 |
| 313 | Ga0495641_0008215 | 3300046461 | Bacteria | 6398 |
| 314 | Ga0495641_0012855 | 3300046461 | Bacteria | 4645 |
| 315 | Ga0495641_0205239 | 3300046461 | Bacteria | 883 |
| 316 | Ga0495651_0000310 | 3300046462 | Bacteria | 37941 |
| 317 | Ga0495651_0018723 | 3300046462 | Bacteria | 5364 |
| 318 | Ga0495651_0251099 | 3300046462 | Bacteria | 1208 |
| 319 | Ga0495653_0006649 | 3300046463 | Bacteria | 9488 |
| 320 | Ga0495653_0016517 | 3300046463 | Bacteria | 6006 |
| 321 | Ga0495653_0249882 | 3300046463 | Bacteria | 1177 |
| 322 | Ga0495580_0016366 | 3300046472 | Bacteria | 5567 |
| 323 | Ga0495582_0039549 | 3300046473 | Bacteria | 2596 |
| 324 | Ga0495582_0085920 | 3300046473 | Bacteria | 1750 |
| 325 | Ga0495639_0000291 | 3300046475 | Bacteria | 24492 |
| 326 | Ga0495662_0001883 | 3300046476 | Bacteria | 10515 |
| 327 | Ga0495664_0010087 | 3300046477 | Bacteria | 5298 |
| 328 | Ga0495584_0121846 | 3300046491 | Bacteria | 1321 |
| 329 | Ga0495585_0417894 | 3300046492 | Unclassified | 644 |
| 330 | Ga0495596_0303544 | 3300046500 | Bacteria | 621 |
| 331 | Ga0495608_0001926 | 3300046511 | Bacteria | 14894 |
| 332 | Ga0495608_0019616 | 3300046511 | Bacteria | 4652 |
| 333 | Ga0495618_0013301 | 3300046514 | Bacteria | 5008 |
| 334 | Ga0495618_0031973 | 3300046514 | Bacteria | 3295 |
| 335 | Ga0495618_0137479 | 3300046514 | Bacteria | 1563 |
| 336 | Ga0495618_0282674 | 3300046514 | Bacteria | 1034 |
| 337 | Ga0495628_0000436 | 3300046516 | Bacteria | 37941 |
| 338 | Ga0495628_0735128 | 3300046516 | Bacteria | 694 |
| 339 | Ga0495630_0000631 | 3300046517 | Bacteria | 25489 |
| 340 | Ga0495630_0019931 | 3300046517 | Bacteria | 4937 |
| 341 | Ga0495631_0168083 | 3300046518 | Bacteria | 941 |
| 342 | Ga0495637_0118127 | 3300046520 | Bacteria | 1023 |
| 343 | Ga0495644_0044089 | 3300046523 | Bacteria | 1678 |
| 344 | Ga0495644_0187355 | 3300046523 | Bacteria | 796 |
| 345 | Ga0495666_0000270 | 3300046526 | Bacteria | 22402 |
| 346 | Ga0495642_0067132 | 3300046528 | Bacteria | 1495 |
| 347 | Ga0495652_0000050 | 3300046529 | Bacteria | 120480 |
| 348 | Ga0495652_0004378 | 3300046529 | Bacteria | 13510 |
| 349 | Ga0495652_0207375 | 3300046529 | Unclassified | 1483 |
| 350 | Ga0495652_0402941 | 3300046529 | Bacteria | 968 |
| 351 | Ga0495665_0015599 | 3300046531 | Bacteria | 4088 |
| 352 | Ga0495665_0020458 | 3300046531 | Bacteria | 3555 |
| 353 | Ga0495640_0011102 | 3300046533 | Bacteria | 6933 |
| 354 | Ga0495640_0021059 | 3300046533 | Bacteria | 4793 |
| 355 | Ga0495640_0241354 | 3300046533 | Bacteria | 1134 |
| 356 | Ga0495640_0399980 | 3300046533 | Bacteria | 843 |
| 357 | Ga0495586_0019798 | 3300046535 | Bacteria | 3583 |
| 358 | Ga0495587_0000084 | 3300046536 | Bacteria | 72926 |
| 359 | Ga0495587_0706419 | 3300046536 | Bacteria | 552 |
| 360 | Ga0495609_0161915 | 3300046538 | Bacteria | 948 |
| 361 | Ga0495609_0317979 | 3300046538 | Bacteria | 632 |
| 362 | Ga0495645_0000067 | 3300046543 | Bacteria | 73037 |
| 363 | Ga0495645_0076558 | 3300046543 | Bacteria | 2407 |
| 364 | Ga0495667_0012434 | 3300046559 | Bacteria | 5773 |
| 365 | Ga0495667_0245040 | 3300046559 | Bacteria | 1141 |
| 366 | Ga0495667_0359530 | 3300046559 | Bacteria | 919 |
| 367 | Ga0495667_0794736 | 3300046559 | Unclassified | 583 |
| 368 | Ga0495656_0100366 | 3300046615 | Bacteria | 1338 |
| 369 | Ga0495634_0009458 | 3300046642 | Bacteria | 7186 |
| 370 | Ga0495634_0036014 | 3300046642 | Bacteria | 3386 |
| 371 | Ga0495635_0008777 | 3300046663 | Bacteria | 7057 |
| 372 | Ga0495661_0166570 | 3300046665 | Bacteria | 1179 |
| 373 | Ga0495588_0137963 | 3300046674 | Unclassified | 1288 |
| 374 | Ga0495588_0302850 | 3300046674 | Bacteria | 841 |
| 375 | Ga0495657_0029681 | 3300046675 | Bacteria | 3834 |
| 376 | Ga0495657_0119531 | 3300046675 | Bacteria | 1661 |
| 377 | Ga0495657_0570093 | 3300046675 | Bacteria | 656 |
| 378 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 379 | Ga0495599_0103220 | 3300046678 | Bacteria | 1777 |
| 380 | Ga0495623_0000219 | 3300046679 | Bacteria | 36687 |
| 381 | Ga0495623_0172641 | 3300046679 | Bacteria | 1262 |
| 382 | Ga0495646_0002381 | 3300046680 | Bacteria | 11524 |
| 383 | Ga0495646_0046138 | 3300046680 | Bacteria | 2658 |
| 384 | Ga0495647_0000243 | 3300046681 | Bacteria | 14906 |
| 385 | Ga0495647_0025704 | 3300046681 | Bacteria | 2153 |
| 386 | Ga0495658_0001721 | 3300046683 | Bacteria | 11348 |
| 387 | Ga0495658_0016722 | 3300046683 | Bacteria | 3778 |
| 388 | Ga0495658_0020995 | 3300046683 | Bacteria | 3437 |
| 389 | Ga0495613_0004288 | 3300046689 | Bacteria | 10685 |
| 390 | Ga0495613_0010027 | 3300046689 | Bacteria | 7037 |
| 391 | Ga0495613_0599433 | 3300046689 | Bacteria | 733 |
| 392 | Ga0495624_0001273 | 3300046690 | Bacteria | 19870 |
| 393 | Ga0495624_0111951 | 3300046690 | Bacteria | 1678 |
| 394 | Ga0495670_0295401 | 3300046691 | Unclassified | 868 |
| 395 | Ga0495671_0411989 | 3300046692 | Bacteria | 647 |
| 396 | Ga0495589_0031980 | 3300046794 | Bacteria | 2647 |
| 397 | Ga0495589_0129439 | 3300046794 | Unclassified | 1213 |
| 398 | Ga0495589_0377305 | 3300046794 | Unclassified | 652 |
| 399 | Ga0495581_0000258 | 3300047315 | Bacteria | 25364 |
| 400 | Ga0495604_0000334 | 3300047317 | Bacteria | 42026 |
| 401 | Ga0495604_0212814 | 3300047317 | Bacteria | 1335 |
| 402 | Ga0495636_0107352 | 3300047318 | Bacteria | 1226 |
| 403 | Ga0495674_0027493 | 3300047319 | Bacteria | 5199 |
| 404 | Ga0495674_0047809 | 3300047319 | Bacteria | 3790 |
| 405 | Ga0495674_0099326 | 3300047319 | Bacteria | 2478 |
| 406 | Ga0495674_0105943 | 3300047319 | Bacteria | 2388 |
| 407 | Ga0495676_0008703 | 3300047321 | Bacteria | 9291 |
| 408 | Ga0495676_0014375 | 3300047321 | Bacteria | 7083 |
| 409 | Ga0495676_0225267 | 3300047321 | Unclassified | 1290 |
| 410 | Ga0495680_0001263 | 3300047322 | Bacteria | 27605 |
| 411 | Ga0495680_0009223 | 3300047322 | Bacteria | 8891 |
| 412 | Ga0495680_0017367 | 3300047322 | Bacteria | 6147 |
| 413 | Ga0495680_0028670 | 3300047322 | Bacteria | 4563 |
| 414 | Ga0495680_0304255 | 3300047322 | Unclassified | 1119 |
| 415 | Ga0495675_0000972 | 3300047444 | Bacteria | 17397 |
| 416 | Ga0495684_0013249 | 3300047471 | Bacteria | 6362 |
| 417 | Ga0495684_0276166 | 3300047471 | Bacteria | 1214 |
| 418 | Ga0495593_0000732 | 3300047673 | Bacteria | 19043 |
| 419 | Ga0495593_0486167 | 3300047673 | Bacteria | 619 |
| 420 | Ga0495602_0000234 | 3300048088 | Bacteria | 51947 |
| 421 | Ga0495602_0094324 | 3300048088 | Bacteria | 2473 |
| 422 | Ga0495614_0000616 | 3300048089 | Bacteria | 14926 |
| 423 | Ga0496100_0166017 | 3300048903 | Bacteria | 1586 |
| 424 | Ga0496100_0531324 | 3300048903 | Bacteria | 908 |
| 425 | Ga0496101_0068091 | 3300048904 | Bacteria | 2602 |
| 426 | Ga0496101_0285826 | 3300048904 | Bacteria | 1290 |
| 427 | Ga0496101_0513792 | 3300048904 | Bacteria | 946 |
| 428 | Ga0496102_0228019 | 3300048905 | Unclassified | 1756 |
| 429 | Ga0496102_0463473 | 3300048905 | Unclassified | 1188 |
| 430 | Ga0496102_0675566 | 3300048905 | Bacteria | 956 |
| 431 | Ga0496102_1210621 | 3300048905 | Bacteria | 675 |
| 432 | Ga0496104_0033095 | 3300048907 | Bacteria | 4812 |
| 433 | Ga0496104_0176334 | 3300048907 | Unclassified | 2048 |
| 434 | Ga0496104_0421022 | 3300048907 | Bacteria | 1247 |
| 435 | Ga0496104_0535815 | 3300048907 | Bacteria | 1082 |
| 436 | Ga0496105_0025796 | 3300048908 | Bacteria | 4788 |
| 437 | Ga0496105_0286049 | 3300048908 | Bacteria | 1328 |
| 438 | Ga0496106_0023910 | 3300048909 | Bacteria | 4540 |
| 439 | Ga0496106_0093251 | 3300048909 | Bacteria | 2327 |
| 440 | Ga0496106_0115996 | 3300048909 | Bacteria | 2089 |
| 441 | Ga0496107_0012497 | 3300048910 | Bacteria | 5926 |
| 442 | Ga0496107_0052180 | 3300048910 | Bacteria | 2950 |
| 443 | Ga0496107_0214700 | 3300048910 | Bacteria | 1431 |
| 444 | Ga0496108_0008529 | 3300048911 | Bacteria | 8313 |
| 445 | Ga0496108_0048977 | 3300048911 | Bacteria | 3533 |
| 446 | Ga0496108_0498572 | 3300048911 | Bacteria | 1063 |
| 447 | Ga0496108_0886720 | 3300048911 | Bacteria | 766 |
| 448 | Ga0496108_0985469 | 3300048911 | Unclassified | 720 |
| 449 | Ga0496109_0005099 | 3300048912 | Bacteria | 10970 |
| 450 | Ga0496109_0032899 | 3300048912 | Bacteria | 4665 |
| 451 | Ga0496109_0034817 | 3300048912 | Bacteria | 4538 |
| 452 | Ga0496109_0071829 | 3300048912 | Bacteria | 3178 |
| 453 | Ga0496109_0230125 | 3300048912 | Bacteria | 1744 |
| 454 | Ga0496109_0868403 | 3300048912 | Bacteria | 840 |
| 455 | Ga0496110_0049251 | 3300048913 | Bacteria | 3695 |
| 456 | Ga0496110_0053718 | 3300048913 | Bacteria | 3542 |
| 457 | Ga0496110_0350059 | 3300048913 | Unclassified | 1346 |
| 458 | Ga0496111_0027128 | 3300048914 | Bacteria | 4049 |
| 459 | Ga0496111_0136936 | 3300048914 | Unclassified | 1814 |
| 460 | Ga0496111_0222712 | 3300048914 | Bacteria | 1401 |
| 461 | Ga0496111_0874633 | 3300048914 | Bacteria | 648 |
| 462 | Ga0496111_1116345 | 3300048914 | Bacteria | 561 |
| 463 | Ga0496112_0022699 | 3300048915 | Bacteria | 5986 |
| 464 | Ga0496112_0138258 | 3300048915 | Bacteria | 2406 |
| 465 | Ga0496112_0224652 | 3300048915 | Bacteria | 1833 |
| 466 | Ga0496112_0252147 | 3300048915 | Bacteria | 1716 |
| 467 | Ga0496112_0311701 | 3300048915 | Bacteria | 1518 |
| 468 | Ga0496113_0230494 | 3300048916 | Bacteria | 1477 |
| 469 | Ga0496113_0317922 | 3300048916 | Bacteria | 1247 |
| 470 | Ga0496114_0016756 | 3300048917 | Bacteria | 5909 |
| 471 | Ga0496114_0074622 | 3300048917 | Bacteria | 2855 |
| 472 | Ga0496114_0135849 | 3300048917 | Unclassified | 2126 |
| 473 | Ga0496115_0147991 | 3300048918 | Unclassified | 1938 |
| 474 | Ga0501031_0001667 | 3300049568 | Bacteria | 13942 |
| 475 | Ga0501033_0015692 | 3300049570 | Bacteria | 5744 |
| 476 | Ga0501033_0046568 | 3300049570 | Bacteria | 3224 |
| 477 | Ga0501033_0170890 | 3300049570 | Bacteria | 1561 |
| 478 | Ga0501034_0587347 | 3300049571 | Bacteria | 1020 |
| 479 | Ga0501036_0005373 | 3300049572 | Bacteria | 10374 |
| 480 | Ga0501036_0089901 | 3300049572 | Bacteria | 2594 |
| 481 | Ga0501037_0085870 | 3300049573 | Bacteria | 2278 |
| 482 | Ga0501037_0119074 | 3300049573 | Unclassified | 1899 |
| 483 | Ga0501038_0003135 | 3300049574 | Bacteria | 15422 |
| 484 | Ga0501038_0057599 | 3300049574 | Bacteria | 3335 |
| 485 | Ga0501038_0097300 | 3300049574 | Bacteria | 2455 |
| 486 | Ga0501039_0007614 | 3300049575 | Bacteria | 8272 |
| 487 | Ga0501040_0004571 | 3300049576 | Bacteria | 8983 |
| 488 | Ga0501041_0001403 | 3300049577 | Bacteria | 13324 |
| 489 | Ga0501041_0024567 | 3300049577 | Bacteria | 3618 |
| 490 | Ga0501042_0005138 | 3300049578 | Bacteria | 8400 |
| 491 | Ga0501042_0115535 | 3300049578 | Bacteria | 1932 |
| 492 | Ga0501043_0002468 | 3300049579 | Bacteria | 15647 |
| 493 | Ga0501043_0034770 | 3300049579 | Bacteria | 3964 |
| 494 | Ga0501043_0196888 | 3300049579 | Bacteria | 1565 |
| 495 | Ga0501046_0001657 | 3300049580 | Bacteria | 21287 |
| 496 | Ga0501046_0031431 | 3300049580 | Bacteria | 4302 |
| 497 | Ga0501046_0045485 | 3300049580 | Bacteria | 3487 |
| 498 | Ga0501046_0725657 | 3300049580 | Bacteria | 699 |
| 499 | Ga0501047_0259191 | 3300049581 | Bacteria | 1587 |
| 500 | Ga0501048_0001556 | 3300049582 | Bacteria | 17438 |
| 501 | Ga0501048_0004495 | 3300049582 | Bacteria | 10619 |
| 502 | Ga0501048_0172712 | 3300049582 | Bacteria | 1531 |
| 503 | Ga0501067_0000303 | 3300049583 | Bacteria | 27180 |
| 504 | Ga0501068_0001015 | 3300049584 | Bacteria | 14807 |
| 505 | Ga0501068_0024770 | 3300049584 | Bacteria | 3526 |
| 506 | Ga0501068_0051273 | 3300049584 | Bacteria | 2496 |
| 507 | Ga0501069_0013558 | 3300049585 | Bacteria | 4346 |
| 508 | Ga0501069_0321040 | 3300049585 | Bacteria | 910 |
| 509 | Ga0501070_0031663 | 3300049586 | Bacteria | 4431 |
| 510 | Ga0501070_0126537 | 3300049586 | Bacteria | 2111 |
| 511 | Ga0501071_0002752 | 3300049587 | Bacteria | 10790 |
| 512 | Ga0501071_0053969 | 3300049587 | Bacteria | 2899 |
| 513 | Ga0501071_0076736 | 3300049587 | Bacteria | 2440 |
| 514 | Ga0501071_0208844 | 3300049587 | Bacteria | 1468 |
| 515 | Ga0501072_0002371 | 3300049588 | Bacteria | 14132 |
| 516 | Ga0501072_0006964 | 3300049588 | Bacteria | 8580 |
| 517 | Ga0501072_0083722 | 3300049588 | Bacteria | 2528 |
| 518 | Ga0501072_0096448 | 3300049588 | Bacteria | 2350 |
| 519 | Ga0501072_0287149 | 3300049588 | Archaea | 1308 |
| 520 | Ga0501072_0374915 | 3300049588 | Bacteria | 1129 |
| 521 | Ga0501073_0050085 | 3300049589 | Bacteria | 2928 |
| 522 | Ga0501074_0004019 | 3300049590 | Bacteria | 10488 |
| 523 | Ga0501074_0021623 | 3300049590 | Bacteria | 4670 |
| 524 | Ga0501075_0007572 | 3300049591 | Bacteria | 7532 |
| 525 | Ga0501075_0012542 | 3300049591 | Bacteria | 6028 |
| 526 | Ga0501075_0445452 | 3300049591 | Bacteria | 987 |
| 527 | Ga0501076_0004213 | 3300049592 | Bacteria | 10181 |
| 528 | Ga0501076_0011113 | 3300049592 | Bacteria | 6697 |
| 529 | Ga0501076_0451738 | 3300049592 | Bacteria | 1058 |
| 530 | Ga0501077_0009280 | 3300049593 | Bacteria | 6107 |
| 531 | Ga0501077_0053517 | 3300049593 | Bacteria | 2562 |
| 532 | Ga0501077_0056341 | 3300049593 | Bacteria | 2494 |
| 533 | Ga0501079_0006808 | 3300049741 | Bacteria | 8603 |
| 534 | Ga0501079_0010654 | 3300049741 | Bacteria | 6998 |
| 535 | Ga0501079_0213376 | 3300049741 | Bacteria | 1508 |
| 536 | Ga0501079_0217878 | 3300049741 | Bacteria | 1491 |
| 537 | Ga0501079_0352269 | 3300049741 | Bacteria | 1153 |
| 538 | Ga0501080_0023313 | 3300049742 | Bacteria | 5738 |
| 539 | Ga0501080_0069872 | 3300049742 | Bacteria | 3266 |
| 540 | Ga0501081_0001790 | 3300049743 | Bacteria | 13320 |
| 541 | Ga0501081_0002856 | 3300049743 | Bacteria | 10965 |
| 542 | Ga0501081_0368345 | 3300049743 | Unclassified | 1060 |
| 543 | Ga0501081_0988657 | 3300049743 | Unclassified | 636 |
| 544 | Ga0501083_0009783 | 3300049744 | Bacteria | 6770 |
| 545 | Ga0501083_0012154 | 3300049744 | Bacteria | 6027 |
| 546 | Ga0501083_0101123 | 3300049744 | Bacteria | 1901 |
| 547 | Ga0501035_0045069 | 3300049822 | Bacteria | 3969 |
| 548 | Ga0501035_0047542 | 3300049822 | Bacteria | 3851 |
| 549 | Ga0501035_0126023 | 3300049822 | Bacteria | 2235 |
| 550 | Ga0501044_0007755 | 3300049823 | Bacteria | 11801 |
| 551 | Ga0501045_0001730 | 3300049824 | Bacteria | 14699 |
| 552 | Ga0501045_0016613 | 3300049824 | Bacteria | 5228 |
| 553 | Ga0501045_0028491 | 3300049824 | Bacteria | 4029 |
| 554 | Ga0501045_0075789 | 3300049824 | Bacteria | 2478 |
| 555 | Ga0501045_0939298 | 3300049824 | Archaea | 635 |
| 556 | nmdc:mga03683_9129_c1 | 3300050489 | Bacteria | 3513 |
| 557 | nmdc:mga00v17_179333_c1 | 3300050491 | Unclassified | 1367 |
| 558 | nmdc:mga0yw44_481598_c1 | 3300050492 | Bacteria | 842 |
| 559 | nmdc:mga0k408_73762_c1 | 3300050493 | Bacteria | 1993 |
| 560 | nmdc:mga06z11_66985_c1 | 3300050494 | Bacteria | 1889 |
| 561 | nmdc:mga05p37_1101427_c1 | 3300050507 | Bacteria | 832 |
| 562 | nmdc:mga05p37_201809_c1 | 3300050507 | Bacteria | 2408 |
| 563 | nmdc:mga05p37_261641_c1 | 3300050507 | Bacteria | 2070 |
| 564 | nmdc:mga05p37_26741_c1 | 3300050507 | Bacteria | 7016 |
| 565 | nmdc:mga05p37_322322_c1 | 3300050507 | Unclassified | 1828 |
| 566 | nmdc:mga05p37_6125_c1 | 3300050507 | Bacteria | 14170 |
| 567 | nmdc:mga09592_176410_c1 | 3300050508 | Bacteria | 1848 |
| 568 | nmdc:mga09592_182676_c1 | 3300050508 | Bacteria | 1815 |
| 569 | nmdc:mga0qj67_6758_c1 | 3300050509 | Bacteria | 8433 |
| 570 | nmdc:mga06r32_13613_c1 | 3300050510 | Bacteria | 7375 |
| 571 | nmdc:mga06r32_286406_c1 | 3300050510 | Unclassified | 1634 |
| 572 | nmdc:mga08y16_287886_c1 | 3300050511 | Bacteria | 1694 |
| 573 | nmdc:mga08y16_762504_c1 | 3300050511 | Bacteria | 963 |
| 574 | nmdc:mga08y16_99289_c1 | 3300050511 | Bacteria | 3031 |
| 575 | nmdc:mga0n895_112175_c1 | 3300050512 | Bacteria | 2743 |
| 576 | nmdc:mga0n895_147368_c1 | 3300050512 | Bacteria | 2384 |
| 577 | nmdc:mga0n895_523073_c1 | 3300050512 | Bacteria | 1194 |
| 578 | nmdc:mga0rr50_193544_c1 | 3300050513 | Bacteria | 1668 |
| 579 | nmdc:mga0rr50_437289_c1 | 3300050513 | Bacteria | 1108 |
| 580 | nmdc:mga08x19_29607_c1 | 3300050514 | Bacteria | 3435 |
| 581 | nmdc:mga08x19_375715_c1 | 3300050514 | Bacteria | 995 |
| 582 | nmdc:mga0a205_52012_c1 | 3300050515 | Bacteria | 3954 |
| 583 | nmdc:mga0a205_60451_c1 | 3300050515 | Bacteria | 3659 |
| 584 | nmdc:mga0a205_770124_c1 | 3300050515 | Bacteria | 810 |
| 585 | nmdc:mga0a205_84357_c1 | 3300050515 | Bacteria | 3068 |
| 586 | Ga0495601_0004691 | 3300053077 | Bacteria | 7917 |
| 587 | Ga0495601_0011109 | 3300053077 | Bacteria | 5381 |
| 588 | Ga0495601_0021697 | 3300053077 | Bacteria | 3934 |
| 589 | Ga0495612_0000724 | 3300053078 | Bacteria | 13419 |
| 590 | Ga0495595_0254937 | 3300053084 | Bacteria | 879 |
| 591 | Ga0495619_0001368 | 3300053085 | Bacteria | 16040 |
| 592 | Ga0495619_0096999 | 3300053085 | Bacteria | 2002 |
| 593 | Ga0495619_0152878 | 3300053085 | Bacteria | 1592 |
| 594 | Ga0495619_0376171 | 3300053085 | Bacteria | 982 |
| 595 | Ga0501084_0002387 | 3300054114 | Bacteria | 15112 |
| 596 | Ga0501084_0041786 | 3300054114 | Bacteria | 3835 |
| 597 | Ga0501084_0153515 | 3300054114 | Bacteria | 1941 |
| 598 | Ga0501084_0674934 | 3300054114 | Bacteria | 872 |
| 599 | Ga0590075_002751 | 3300059424 | Bacteria | 4209 |
| 600 | Ga0501082_0010499 | 3300060353 | Bacteria | 7967 |
| 601 | Ga0501082_0026670 | 3300060353 | Bacteria | 4980 |
| 602 | Ga0501082_0316481 | 3300060353 | Bacteria | 1359 |
| 603 | Ga0466962_0001067 | 3300061719 | Bacteria | 12610 |
| 604 | Ga0530510_0013233 | 3300061734 | Bacteria | 5801 |
| 605 | Ga0530510_0054425 | 3300061734 | Bacteria | 2891 |
| 606 | Ga0530510_0156513 | 3300061734 | Bacteria | 1684 |
| 607 | Ga0070698_100135066 | |||
| 608 | JGI25407J50210_10002089 | |||
| 609 | JGI25407J50210_10003349 | |||
| 610 | Ga0070658_10089856 | |||
| 611 | Ga0070683_100007995 | |||
| 612 | Ga0070683_100012452 | |||
| 613 | Ga0070683_100039148 | |||
| 614 | Ga0070680_100021220 | |||
| 615 | Ga0070680_100303269 | |||
| 616 | Ga0070660_100127947 | |||
| 617 | Ga0070660_100160605 | |||
| 618 | Ga0070661_100069862 | |||
| 619 | Ga0070661_100225961 | |||
| 620 | Ga0070692_10184535 | |||
| 621 | Ga0070668_100207993 | |||
| 622 | Ga0070675_100467441 | |||
| 623 | Ga0070674_100065009 | |||
| 624 | Ga0070659_100200646 | |||
| 625 | Ga0070709_10147255 | |||
| 626 | Ga0070709_11255209 | |||
| 627 | Ga0070714_100017768 | |||
| 628 | Ga0070714_100070727 | |||
| 629 | Ga0070714_100136588 | |||
| 630 | Ga0070714_100419575 | |||
| 631 | Ga0070714_101038676 | |||
| 632 | Ga0070713_100418647 | |||
| 633 | Ga0070710_10425118 | |||
| 634 | Ga0070711_100166213 | |||
| 635 | Ga0070711_100455108 | |||
| 636 | Ga0070711_100683625 | |||
| 637 | Ga0070705_100146727 | |||
| 638 | Ga0070708_100544841 | |||
| 639 | Ga0070662_100372689 | |||
| 640 | Ga0070662_100384829 | |||
| 641 | Ga0070681_10002582 | |||
| 642 | Ga0070681_10015596 | |||
| 643 | Ga0068867_100867960 | |||
| 644 | Ga0068867_101551421 | |||
| 645 | Ga0070685_10138535 | |||
| 646 | Ga0070685_10429360 | |||
| 647 | Ga0070706_100457816 | |||
| 648 | Ga0070707_100041396 | |||
| 649 | Ga0070707_101246799 | |||
| 650 | Ga0070699_100021443 | |||
| 651 | Ga0070679_100003582 | |||
| 652 | Ga0070679_100028851 | |||
| 653 | Ga0070679_101347425 | |||
| 654 | Ga0070684_100002126 | |||
| 655 | Ga0070684_100006736 | |||
| 656 | Ga0070684_100007785 | |||
| 657 | Ga0070684_100042730 | |||
| 658 | Ga0070684_100082044 | |||
| 659 | Ga0070684_100293151 | |||
| 660 | Ga0068853_100500911 | |||
| 661 | Ga0070704_100406875 | |||
| 662 | Ga0068855_100530153 | |||
| 663 | Ga0070664_100086916 | |||
| 664 | Ga0070664_100474255 | |||
| 665 | Ga0070664_100667108 | |||
| 666 | Ga0068857_100027674 | |||
| 667 | Ga0068857_100053842 | |||
| 668 | Ga0068857_100086946 | |||
| 669 | Ga0068856_100263442 | |||
| 670 | Ga0070702_100182867 | |||
| 671 | Ga0068870_10002935 | |||
| 672 | Ga0068870_10379482 | |||
| 673 | Ga0081455_10010510 | |||
| 674 | Ga0081455_10024006 | |||
| 675 | Ga0081538_10000764 | |||
| 676 | Ga0081538_10003134 | |||
| 677 | Ga0081538_10069515 | |||
| 678 | Ga0081540_1004199 | |||
| 679 | Ga0070717_10009460 | |||
| 680 | Ga0070717_10024240 | |||
| 681 | Ga0075365_10010270 | |||
| 682 | Ga0075364_10044927 | |||
| 683 | Ga0075432_10344483 | |||
| 684 | Ga0070715_10136242 | |||
| 685 | Ga0070716_100151157 | |||
| 686 | Ga0075362_10007581 | |||
| 687 | Ga0075428_100002031 | |||
| 688 | Ga0075428_100163168 | |||
| 689 | Ga0075430_100004550 | |||
| 690 | Ga0075431_100008749 | |||
| 691 | Ga0075431_100322692 | |||
| 692 | Ga0075433_10081721 | |||
| 693 | Ga0075433_10151630 | |||
| 694 | Ga0075433_10225593 | |||
| 695 | Ga0075434_100076309 | |||
| 696 | Ga0075434_100116156 | |||
| 697 | Ga0075434_101208651 | |||
| 698 | Ga0075429_100053827 | |||
| 699 | Ga0075429_100179406 | |||
| 700 | Ga0075435_100002208 | |||
| 701 | Ga0075435_100070872 | |||
| 702 | Ga0075435_100212019 | |||
| 703 | Ga0075435_100719065 | |||
| 704 | Ga0105240_11281314 | |||
| 705 | Ga0111539_10165451 | |||
| 706 | Ga0111539_10264614 | |||
| 707 | Ga0111539_10394271 | |||
| 708 | Ga0111539_10706518 | |||
| 709 | Ga0105245_10148930 | |||
| 710 | Ga0105245_10437535 | |||
| 711 | Ga0105247_10120626 | |||
| 712 | Ga0114129_10000663 | |||
| 713 | Ga0114129_10218069 | |||
| 714 | Ga0114129_10332478 | |||
| 715 | Ga0114129_10389606 | |||
| 716 | Ga0114129_10491900 | |||
| 717 | Ga0114129_10531841 | |||
| 718 | Ga0114129_12064382 | |||
| 719 | Ga0105243_10141954 | |||
| 720 | Ga0105243_10941211 | |||
| 721 | Ga0105237_11208119 | |||
| 722 | Ga0105238_10040039 | |||
| 723 | Ga0099796_10022206 | |||
| 724 | Ga0105239_10148822 | |||
| 725 | Ga0157369_10422903 | |||
| 726 | Ga0157374_10060432 | |||
| 727 | Ga0157378_10657147 | |||
| 728 | Ga0163162_10064750 | |||
| 729 | Ga0163162_11133522 | |||
| 730 | Ga0157375_10268818 | |||
| 731 | Ga0157375_10764025 | |||
| 732 | Ga0163163_10422600 | |||
| 733 | Ga0163163_10674762 | |||
| 734 | Ga0157380_11067768 | |||
| 735 | Ga0157376_10043809 | |||
| 736 | Ga0182007_10046002 | |||
| 737 | Ga0207692_10079976 | |||
| 738 | Ga0207699_10111583 | |||
| 739 | Ga0207643_10003192 | |||
| 740 | Ga0207705_10044389 | |||
| 741 | Ga0207684_10562928 | |||
| 742 | Ga0207707_10017662 | |||
| 743 | Ga0207707_10107393 | |||
| 744 | Ga0207693_10001487 | |||
| 745 | Ga0207693_10007145 | |||
| 746 | Ga0207663_10167057 | |||
| 747 | Ga0207660_10014983 | |||
| 748 | Ga0207660_10188440 | |||
| 749 | Ga0207657_10035698 | |||
| 750 | Ga0207657_10094043 | |||
| 751 | Ga0207657_10116681 | |||
| 752 | Ga0207649_10046066 | |||
| 753 | Ga0207649_10175620 | |||
| 754 | Ga0207652_10117748 | |||
| 755 | Ga0207652_10342431 | |||
| 756 | Ga0207646_10046517 | |||
| 757 | Ga0207650_10002691 | |||
| 758 | Ga0207687_10036227 | |||
| 759 | Ga0207687_10064716 | |||
| 760 | Ga0207700_10043659 | |||
| 761 | Ga0207700_10109038 | |||
| 762 | Ga0207664_10008451 | |||
| 763 | Ga0207664_10032880 | |||
| 764 | Ga0207664_10233888 | |||
| 765 | Ga0207664_10326299 | |||
| 766 | Ga0207664_10414375 | |||
| 767 | Ga0207664_11026461 | |||
| 768 | Ga0207690_10443855 | |||
| 769 | Ga0207690_10752446 | |||
| 770 | Ga0207706_10471618 | |||
| 771 | Ga0207706_10710412 | |||
| 772 | Ga0207709_10400535 | |||
| 773 | Ga0207669_11213705 | |||
| 774 | Ga0207704_10846662 | |||
| 775 | Ga0207665_10000298 | |||
| 776 | Ga0207665_10091992 | |||
| 777 | Ga0207661_10021449 | |||
| 778 | Ga0207661_10067217 | |||
| 779 | Ga0207661_10290539 | |||
| 780 | Ga0207661_10646117 | |||
| 781 | Ga0207661_11292338 | |||
| 782 | Ga0207679_10069709 | |||
| 783 | Ga0207651_10548655 | |||
| 784 | Ga0207677_10173264 | |||
| 785 | Ga0207677_10815614 | |||
| 786 | Ga0207639_11171689 | |||
| 787 | Ga0207708_10620904 | |||
| 788 | Ga0207708_10667107 | |||
| 789 | Ga0207708_11485189 | |||
| 790 | Ga0207648_10066369 | |||
| 791 | Ga0207648_10578084 | |||
| 792 | Ga0207674_10001702 | |||
| 793 | Ga0207674_10024757 | |||
| 794 | Ga0207674_10066083 | |||
| 795 | Ga0207674_10141014 | |||
| 796 | Ga0207683_10118683 | |||
| 797 | Ga0207428_10004697 | |||
| 798 | Ga0207428_10016837 | |||
| 799 | Ga0207428_10111453 | |||
| 800 | Ga0265318_10092624 | |||
| 801 | Ga0307408_100175947 | |||
| 802 | Ga0307405_10368929 | |||
| 803 | Ga0307405_10799605 | |||
| 804 | Ga0307413_10050193 | |||
| 805 | Ga0307410_10033585 | |||
| 806 | Ga0307406_10032384 | |||
| 807 | Ga0307412_10060967 | |||
| 808 | Ga0307409_100067053 | |||
| 809 | Ga0307409_100523577 | |||
| 810 | Ga0307416_100021260 | |||
| 811 | Ga0307416_100097466 | |||
| 812 | Ga0307414_10297670 | |||
| 813 | Ga0307411_10040458 | |||
| 814 | Ga0307415_100099430 | |||
| 815 | Ga0373944_0013885 | |||
| 816 | Ga0373923_0122444 | |||
| 817 | Ga0373936_0158085 | |||
| 818 | Ga0373945_0037241 | |||
| 819 | Ga0373943_0054145 | |||
| 820 | Ga0373943_0096576 | |||
| 821 | Ga0373943_0248244 | |||
| 822 | Ga0373931_0008105 | |||
| 823 | Ga0373927_0013559 | |||
| 824 | Ga0373947_0006331 | |||
| 825 | Ga0373937_0000447 | |||
| 826 | Ga0373925_0002886 | |||
| 827 | Ga0395899_0003964 | |||
| 828 | Ga0395899_0044717 | |||
| 829 | Ga0395899_0058333 | |||
| 830 | Ga0395899_0126712 | |||
| 831 | Ga0395899_0133836 | |||
| 832 | Ga0395899_0153452 | |||
| 833 | Ga0395900_0007259 | |||
| 834 | Ga0395900_0024221 | |||
| 835 | Ga0395900_0047541 | |||
| 836 | Ga0395900_0049289 | |||
| 837 | Ga0395900_0055262 | |||
| 838 | Ga0395900_0068018 | |||
| 839 | Ga0395900_0097950 | |||
| 840 | Ga0395900_0141217 | |||
| 841 | Ga0395900_0164386 | |||
| 842 | Ga0395900_0630270 | |||
| 843 | Ga0395900_1029836 | |||
| 844 | Ga0395898_0003845 | |||
| 845 | Ga0395898_0008130 | |||
| 846 | Ga0395898_0009330 | |||
| 847 | Ga0395898_0043296 | |||
| 848 | Ga0395898_0053387 | |||
| 849 | Ga0395898_0095125 | |||
| 850 | Ga0395898_0140645 | |||
| 851 | Ga0395898_0383679 | |||
| 852 | Ga0395898_0681458 | |||
| 853 | Ga0395898_0943320 | |||
| 854 | Ga0395898_1530568 | |||
| 855 | Ga0395905_0013924 | |||
| 856 | Ga0395905_0016829 | |||
| 857 | Ga0395905_0057024 | |||
| 858 | Ga0395905_0132978 | |||
| 859 | Ga0395905_0287737 | |||
| 860 | Ga0395905_0377517 | |||
| 861 | Ga0395905_0497040 | |||
| 862 | Ga0395901_0003520 | |||
| 863 | Ga0395901_0008514 | |||
| 864 | Ga0395901_0009985 | |||
| 865 | Ga0395901_0023584 | |||
| 866 | Ga0395901_0033709 | |||
| 867 | Ga0395901_0035987 | |||
| 868 | Ga0395901_0055138 | |||
| 869 | Ga0395901_0070177 | |||
| 870 | Ga0395901_0088972 | |||
| 871 | Ga0395901_0089864 | |||
| 872 | Ga0395901_0223165 | |||
| 873 | Ga0395901_0436502 | |||
| 874 | Ga0395901_0534366 | |||
| 875 | Ga0395901_0558076 | |||
| 876 | Ga0395901_1249405 | |||
| 877 | Ga0439438_068946 | |||
| 878 | Ga0451789_0558252 | |||
| 879 | Ga0451841_0020301 | |||
| 880 | Ga0451849_1569805 | |||
| 881 | Ga0451853_0186481 | |||
| 882 | Ga0439448_0141143 | |||
| 883 | Ga0439458_0011985 | |||
| 884 | Ga0439434_0003874 | |||
| 885 | Ga0439440_0139918 | |||
| 886 | Ga0466969_0017127 | |||
| 887 | Ga0466961_0030210 | |||
| 888 | Ga0466961_0126155 | |||
| 889 | Ga0466963_0000755 | |||
| 890 | Ga0466963_0149249 | |||
| 891 | Ga0466963_0178533 | |||
| 892 | Ga0466964_0004027 | |||
| 893 | Ga0466964_0010699 | |||
| 894 | Ga0466964_0164333 | |||
| 895 | Ga0466971_0006458 | |||
| 896 | Ga0466971_0010227 | |||
| 897 | Ga0466968_0046556 | |||
| 898 | Ga0466957_0053078 | |||
| 899 | Ga0466957_0525521 | |||
| 900 | Ga0466960_0434493 | |||
| 901 | Ga0466960_0631095 | |||
| 902 | Ga0451576_1848763 | |||
| 903 | Ga0466958_0016030 | |||
| 904 | Ga0466958_0076955 | |||
| 905 | Ga0466967_0019309 | |||
| 906 | Ga0466967_0028096 | |||
| 907 | Ga0466967_0033888 | |||
| 908 | Ga0466967_0136873 | |||
| 909 | Ga0466967_0321616 | |||
| 910 | Ga0466967_0731932 | |||
| 911 | Ga0495592_0000124 | |||
| 912 | Ga0495592_0149124 | |||
| 913 | Ga0495592_0184618 | |||
| 914 | Ga0495603_0021025 | |||
| 915 | Ga0495603_0617789 | |||
| 916 | Ga0495629_0032201 | |||
| 917 | Ga0495629_0120821 | |||
| 918 | Ga0495641_0004998 | |||
| 919 | Ga0495641_0008215 | |||
| 920 | Ga0495641_0012855 | |||
| 921 | Ga0495641_0205239 | |||
| 922 | Ga0495651_0000310 | |||
| 923 | Ga0495651_0018723 | |||
| 924 | Ga0495651_0251099 | |||
| 925 | Ga0495653_0006649 | |||
| 926 | Ga0495653_0016517 | |||
| 927 | Ga0495653_0249882 | |||
| 928 | Ga0495580_0016366 | |||
| 929 | Ga0495582_0039549 | |||
| 930 | Ga0495582_0085920 | |||
| 931 | Ga0495639_0000291 | |||
| 932 | Ga0495662_0001883 | |||
| 933 | Ga0495664_0010087 | |||
| 934 | Ga0495584_0121846 | |||
| 935 | Ga0495585_0417894 | |||
| 936 | Ga0495596_0303544 | |||
| 937 | Ga0495608_0001926 | |||
| 938 | Ga0495608_0019616 | |||
| 939 | Ga0495618_0013301 | |||
| 940 | Ga0495618_0031973 | |||
| 941 | Ga0495618_0137479 | |||
| 942 | Ga0495618_0282674 | |||
| 943 | Ga0495628_0000436 | |||
| 944 | Ga0495628_0735128 | |||
| 945 | Ga0495630_0000631 | |||
| 946 | Ga0495630_0019931 | |||
| 947 | Ga0495631_0168083 | |||
| 948 | Ga0495637_0118127 | |||
| 949 | Ga0495644_0044089 | |||
| 950 | Ga0495644_0187355 | |||
| 951 | Ga0495666_0000270 | |||
| 952 | Ga0495642_0067132 | |||
| 953 | Ga0495652_0000050 | |||
| 954 | Ga0495652_0004378 | |||
| 955 | Ga0495652_0207375 | |||
| 956 | Ga0495652_0402941 | |||
| 957 | Ga0495665_0015599 | |||
| 958 | Ga0495665_0020458 | |||
| 959 | Ga0495640_0011102 | |||
| 960 | Ga0495640_0021059 | |||
| 961 | Ga0495640_0241354 | |||
| 962 | Ga0495640_0399980 | |||
| 963 | Ga0495586_0019798 | |||
| 964 | Ga0495587_0000084 | |||
| 965 | Ga0495587_0706419 | |||
| 966 | Ga0495609_0161915 | |||
| 967 | Ga0495609_0317979 | |||
| 968 | Ga0495645_0000067 | |||
| 969 | Ga0495645_0076558 | |||
| 970 | Ga0495667_0012434 | |||
| 971 | Ga0495667_0245040 | |||
| 972 | Ga0495667_0359530 | |||
| 973 | Ga0495667_0794736 | |||
| 974 | Ga0495656_0100366 | |||
| 975 | Ga0495634_0009458 | |||
| 976 | Ga0495634_0036014 | |||
| 977 | Ga0495635_0008777 | |||
| 978 | Ga0495661_0166570 | |||
| 979 | Ga0495588_0137963 | |||
| 980 | Ga0495588_0302850 | |||
| 981 | Ga0495657_0029681 | |||
| 982 | Ga0495657_0119531 | |||
| 983 | Ga0495657_0570093 | |||
| 984 | Ga0495599_0000009 | |||
| 985 | Ga0495599_0103220 | |||
| 986 | Ga0495623_0000219 | |||
| 987 | Ga0495623_0172641 | |||
| 988 | Ga0495646_0002381 | |||
| 989 | Ga0495646_0046138 | |||
| 990 | Ga0495647_0000243 | |||
| 991 | Ga0495647_0025704 | |||
| 992 | Ga0495658_0001721 | |||
| 993 | Ga0495658_0016722 | |||
| 994 | Ga0495658_0020995 | |||
| 995 | Ga0495613_0004288 | |||
| 996 | Ga0495613_0010027 | |||
| 997 | Ga0495613_0599433 | |||
| 998 | Ga0495624_0001273 | |||
| 999 | Ga0495624_0111951 | |||
| 1000 | Ga0495670_0295401 | |||
| 1001 | Ga0495671_0411989 | |||
| 1002 | Ga0495589_0031980 | |||
| 1003 | Ga0495589_0129439 | |||
| 1004 | Ga0495589_0377305 | |||
| 1005 | Ga0495581_0000258 | |||
| 1006 | Ga0495604_0000334 | |||
| 1007 | Ga0495604_0212814 | |||
| 1008 | Ga0495636_0107352 | |||
| 1009 | Ga0495674_0027493 | |||
| 1010 | Ga0495674_0047809 | |||
| 1011 | Ga0495674_0099326 | |||
| 1012 | Ga0495674_0105943 | |||
| 1013 | Ga0495676_0008703 | |||
| 1014 | Ga0495676_0014375 | |||
| 1015 | Ga0495676_0225267 | |||
| 1016 | Ga0495680_0001263 | |||
| 1017 | Ga0495680_0009223 | |||
| 1018 | Ga0495680_0017367 | |||
| 1019 | Ga0495680_0028670 | |||
| 1020 | Ga0495680_0304255 | |||
| 1021 | Ga0495675_0000972 | |||
| 1022 | Ga0495684_0013249 | |||
| 1023 | Ga0495684_0276166 | |||
| 1024 | Ga0495593_0000732 | |||
| 1025 | Ga0495593_0486167 | |||
| 1026 | Ga0495602_0000234 | |||
| 1027 | Ga0495602_0094324 | |||
| 1028 | Ga0495614_0000616 | |||
| 1029 | Ga0496100_0166017 | |||
| 1030 | Ga0496100_0531324 | |||
| 1031 | Ga0496101_0068091 | |||
| 1032 | Ga0496101_0285826 | |||
| 1033 | Ga0496101_0513792 | |||
| 1034 | Ga0496102_0228019 | |||
| 1035 | Ga0496102_0463473 | |||
| 1036 | Ga0496102_0675566 | |||
| 1037 | Ga0496102_1210621 | |||
| 1038 | Ga0496104_0033095 | |||
| 1039 | Ga0496104_0176334 | |||
| 1040 | Ga0496104_0421022 | |||
| 1041 | Ga0496104_0535815 | |||
| 1042 | Ga0496105_0025796 | |||
| 1043 | Ga0496105_0286049 | |||
| 1044 | Ga0496106_0023910 | |||
| 1045 | Ga0496106_0093251 | |||
| 1046 | Ga0496106_0115996 | |||
| 1047 | Ga0496107_0012497 | |||
| 1048 | Ga0496107_0052180 | |||
| 1049 | Ga0496107_0214700 | |||
| 1050 | Ga0496108_0008529 | |||
| 1051 | Ga0496108_0048977 | |||
| 1052 | Ga0496108_0498572 | |||
| 1053 | Ga0496108_0886720 | |||
| 1054 | Ga0496108_0985469 | |||
| 1055 | Ga0496109_0005099 | |||
| 1056 | Ga0496109_0032899 | |||
| 1057 | Ga0496109_0034817 | |||
| 1058 | Ga0496109_0071829 | |||
| 1059 | Ga0496109_0230125 | |||
| 1060 | Ga0496109_0868403 | |||
| 1061 | Ga0496110_0049251 | |||
| 1062 | Ga0496110_0053718 | |||
| 1063 | Ga0496110_0350059 | |||
| 1064 | Ga0496111_0027128 | |||
| 1065 | Ga0496111_0136936 | |||
| 1066 | Ga0496111_0222712 | |||
| 1067 | Ga0496111_0874633 | |||
| 1068 | Ga0496111_1116345 | |||
| 1069 | Ga0496112_0022699 | |||
| 1070 | Ga0496112_0138258 | |||
| 1071 | Ga0496112_0224652 | |||
| 1072 | Ga0496112_0252147 | |||
| 1073 | Ga0496112_0311701 | |||
| 1074 | Ga0496113_0230494 | |||
| 1075 | Ga0496113_0317922 | |||
| 1076 | Ga0496114_0016756 | |||
| 1077 | Ga0496114_0074622 | |||
| 1078 | Ga0496114_0135849 | |||
| 1079 | Ga0496115_0147991 | |||
| 1080 | Ga0501031_0001667 | |||
| 1081 | Ga0501033_0015692 | |||
| 1082 | Ga0501033_0046568 | |||
| 1083 | Ga0501033_0170890 | |||
| 1084 | Ga0501034_0587347 | |||
| 1085 | Ga0501036_0005373 | |||
| 1086 | Ga0501036_0089901 | |||
| 1087 | Ga0501037_0085870 | |||
| 1088 | Ga0501037_0119074 | |||
| 1089 | Ga0501038_0003135 | |||
| 1090 | Ga0501038_0057599 | |||
| 1091 | Ga0501038_0097300 | |||
| 1092 | Ga0501039_0007614 | |||
| 1093 | Ga0501040_0004571 | |||
| 1094 | Ga0501041_0001403 | |||
| 1095 | Ga0501041_0024567 | |||
| 1096 | Ga0501042_0005138 | |||
| 1097 | Ga0501042_0115535 | |||
| 1098 | Ga0501043_0002468 | |||
| 1099 | Ga0501043_0034770 | |||
| 1100 | Ga0501043_0196888 | |||
| 1101 | Ga0501046_0001657 | |||
| 1102 | Ga0501046_0031431 | |||
| 1103 | Ga0501046_0045485 | |||
| 1104 | Ga0501046_0725657 | |||
| 1105 | Ga0501047_0259191 | |||
| 1106 | Ga0501048_0001556 | |||
| 1107 | Ga0501048_0004495 | |||
| 1108 | Ga0501048_0172712 | |||
| 1109 | Ga0501067_0000303 | |||
| 1110 | Ga0501068_0001015 | |||
| 1111 | Ga0501068_0024770 | |||
| 1112 | Ga0501068_0051273 | |||
| 1113 | Ga0501069_0013558 | |||
| 1114 | Ga0501069_0321040 | |||
| 1115 | Ga0501070_0031663 | |||
| 1116 | Ga0501070_0126537 | |||
| 1117 | Ga0501071_0002752 | |||
| 1118 | Ga0501071_0053969 | |||
| 1119 | Ga0501071_0076736 | |||
| 1120 | Ga0501071_0208844 | |||
| 1121 | Ga0501072_0002371 | |||
| 1122 | Ga0501072_0006964 | |||
| 1123 | Ga0501072_0083722 | |||
| 1124 | Ga0501072_0096448 | |||
| 1125 | Ga0501072_0287149 | |||
| 1126 | Ga0501072_0374915 | |||
| 1127 | Ga0501073_0050085 | |||
| 1128 | Ga0501074_0004019 | |||
| 1129 | Ga0501074_0021623 | |||
| 1130 | Ga0501075_0007572 | |||
| 1131 | Ga0501075_0012542 | |||
| 1132 | Ga0501075_0445452 | |||
| 1133 | Ga0501076_0004213 | |||
| 1134 | Ga0501076_0011113 | |||
| 1135 | Ga0501076_0451738 | |||
| 1136 | Ga0501077_0009280 | |||
| 1137 | Ga0501077_0053517 | |||
| 1138 | Ga0501077_0056341 | |||
| 1139 | Ga0501079_0006808 | |||
| 1140 | Ga0501079_0010654 | |||
| 1141 | Ga0501079_0213376 | |||
| 1142 | Ga0501079_0217878 | |||
| 1143 | Ga0501079_0352269 | |||
| 1144 | Ga0501080_0023313 | |||
| 1145 | Ga0501080_0069872 | |||
| 1146 | Ga0501081_0001790 | |||
| 1147 | Ga0501081_0002856 | |||
| 1148 | Ga0501081_0368345 | |||
| 1149 | Ga0501081_0988657 | |||
| 1150 | Ga0501083_0009783 | |||
| 1151 | Ga0501083_0012154 | |||
| 1152 | Ga0501083_0101123 | |||
| 1153 | Ga0501035_0045069 | |||
| 1154 | Ga0501035_0047542 | |||
| 1155 | Ga0501035_0126023 | |||
| 1156 | Ga0501044_0007755 | |||
| 1157 | Ga0501045_0001730 | |||
| 1158 | Ga0501045_0016613 | |||
| 1159 | Ga0501045_0028491 | |||
| 1160 | Ga0501045_0075789 | |||
| 1161 | Ga0501045_0939298 | |||
| 1162 | nmdc:mga03683_9129_c1 | |||
| 1163 | nmdc:mga00v17_179333_c1 | |||
| 1164 | nmdc:mga0yw44_481598_c1 | |||
| 1165 | nmdc:mga0k408_73762_c1 | |||
| 1166 | nmdc:mga06z11_66985_c1 | |||
| 1167 | nmdc:mga05p37_1101427_c1 | |||
| 1168 | nmdc:mga05p37_201809_c1 | |||
| 1169 | nmdc:mga05p37_261641_c1 | |||
| 1170 | nmdc:mga05p37_26741_c1 | |||
| 1171 | nmdc:mga05p37_322322_c1 | |||
| 1172 | nmdc:mga05p37_6125_c1 | |||
| 1173 | nmdc:mga09592_176410_c1 | |||
| 1174 | nmdc:mga09592_182676_c1 | |||
| 1175 | nmdc:mga0qj67_6758_c1 | |||
| 1176 | nmdc:mga06r32_13613_c1 | |||
| 1177 | nmdc:mga06r32_286406_c1 | |||
| 1178 | nmdc:mga08y16_287886_c1 | |||
| 1179 | nmdc:mga08y16_762504_c1 | |||
| 1180 | nmdc:mga08y16_99289_c1 | |||
| 1181 | nmdc:mga0n895_112175_c1 | |||
| 1182 | nmdc:mga0n895_147368_c1 | |||
| 1183 | nmdc:mga0n895_523073_c1 | |||
| 1184 | nmdc:mga0rr50_193544_c1 | |||
| 1185 | nmdc:mga0rr50_437289_c1 | |||
| 1186 | nmdc:mga08x19_29607_c1 | |||
| 1187 | nmdc:mga08x19_375715_c1 | |||
| 1188 | nmdc:mga0a205_52012_c1 | |||
| 1189 | nmdc:mga0a205_60451_c1 | |||
| 1190 | nmdc:mga0a205_770124_c1 | |||
| 1191 | nmdc:mga0a205_84357_c1 | |||
| 1192 | Ga0495601_0004691 | |||
| 1193 | Ga0495601_0011109 | |||
| 1194 | Ga0495601_0021697 | |||
| 1195 | Ga0495612_0000724 | |||
| 1196 | Ga0495595_0254937 | |||
| 1197 | Ga0495619_0001368 | |||
| 1198 | Ga0495619_0096999 | |||
| 1199 | Ga0495619_0152878 | |||
| 1200 | Ga0495619_0376171 | |||
| 1201 | Ga0501084_0002387 | |||
| 1202 | Ga0501084_0041786 | |||
| 1203 | Ga0501084_0153515 | |||
| 1204 | Ga0501084_0674934 | |||
| 1205 | Ga0590075_002751 | |||
| 1206 | Ga0501082_0010499 | |||
| 1207 | Ga0501082_0026670 | |||
| 1208 | Ga0501082_0316481 | |||
| 1209 | Ga0466962_0001067 | |||
| 1210 | Ga0530510_0013233 | |||
| 1211 | Ga0530510_0054425 | |||
| 1212 | Ga0530510_0156513 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2v5p-assembly2.cif.gz_B | complex structure of human igf2r domains 11-13 bound to igf-ii | 0.3477 | 13 | 51 |
| 6y3d-assembly1.cif.gz_GGG | x-ray structure of thermophilic c-phycocyanin from galdiera phlegrea | 0.2697 | 50 | 149 |
| 6y3d-assembly1.cif.gz_GGG | x-ray structure of thermophilic c-phycocyanin from galdiera phlegrea | 0.1905 | 50 | 149 |
| 3zsu-assembly1.cif.gz_A | structure of the cyanoq protein from thermosynechococcus elongatus | 0.18 | 54 | 157 |
| 3zsu-assembly1.cif.gz_A | structure of the cyanoq protein from thermosynechococcus elongatus | 0.1638 | 54 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HVU6_264_505_3.60.130.30 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix; | 0.2494 | 3 | 93 | 3.60.130.30 |
| af_A0A286Y940_222_385_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.249 | 15 | 68 | 3.30.420.10 |
| af_Q10NT7_120_228_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.2207 | 57 | 149 | 1.25.40.10 |
| af_Q10NT7_120_228_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.1931 | 57 | 149 | 1.25.40.10 |
| 3zsuA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.18 | 54 | 157 | 1.20.120.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9JP12-F1-model_v4 | DUF501 domain-containing protein | 0.9879 | 1 | 160 |
|
| AF-A0A7V9CR68-F1-model_v4 | DUF501 domain-containing protein | 0.9822 | 1 | 159 |
|
| AF-A0A538DC47-F1-model_v4 | DUF501 domain-containing protein | 0.977 | 1 | 164 |
|
| AF-A0A538DC47-F1-model_v4 | DUF501 domain-containing protein | 0.9653 | 1 | 164 |
|
| AF-A0A7V9JP12-F1-model_v4 | DUF501 domain-containing protein | 0.964 | 1 | 160 |
|