F468563

General Info

Members Datasets Scaffolds Average Seq Length
606 280 1212 167

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100135066|Ga0070698_1001350663
Length 191
Sequence MGHAKESVSFPGEASEAKGDLDLVERQLGRRPRAFRRVVVRCPFGAPAVTEQAAYDASGDPFPTTYYVTCPQLVAAVSRLEAAGGVERWSEAAQREPALAESLARATAEQRRVRAELAAGELGPDAGASLDLGIGGSRNPEQLKCLHAHVAFALARPGYELGERIVAEIDPLWPRTCCMNSRGVAVSSNAP

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
136 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 8.58
Rhizosphere 89.6
Stem 0
Stem Tuber 0
Unclassified 10.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100135066 3300005471 Bacteria 2421
2 JGI25407J50210_10002089 3300003373 Bacteria 4664
3 JGI25407J50210_10003349 3300003373 Bacteria 3822
4 Ga0070658_10089856 3300005327 Bacteria 2529
5 Ga0070683_100007995 3300005329 Bacteria 8973
6 Ga0070683_100012452 3300005329 Bacteria 7394
7 Ga0070683_100039148 3300005329 Bacteria 4351
8 Ga0070680_100021220 3300005336 Bacteria 5160
9 Ga0070680_100303269 3300005336 Unclassified 1355
10 Ga0070660_100127947 3300005339 Bacteria 2030
11 Ga0070660_100160605 3300005339 Bacteria 1811
12 Ga0070661_100069862 3300005344 Bacteria 2582
13 Ga0070661_100225961 3300005344 Bacteria 1437
14 Ga0070692_10184535 3300005345 Unclassified 1211
15 Ga0070668_100207993 3300005347 Bacteria 1608
16 Ga0070675_100467441 3300005354 Bacteria 1133
17 Ga0070674_100065009 3300005356 Bacteria 2559
18 Ga0070659_100200646 3300005366 Bacteria 1642
19 Ga0070709_10147255 3300005434 Unclassified 1624
20 Ga0070709_11255209 3300005434 Unclassified 597
21 Ga0070714_100017768 3300005435 Bacteria 5766
22 Ga0070714_100070727 3300005435 Bacteria 3016
23 Ga0070714_100136588 3300005435 Bacteria 2197
24 Ga0070714_100419575 3300005435 Unclassified 1267
25 Ga0070714_101038676 3300005435 Bacteria 798
26 Ga0070713_100418647 3300005436 Bacteria 1254
27 Ga0070710_10425118 3300005437 Bacteria 895
28 Ga0070711_100166213 3300005439 Bacteria 1677
29 Ga0070711_100455108 3300005439 Bacteria 1048
30 Ga0070711_100683625 3300005439 Bacteria 863
31 Ga0070705_100146727 3300005440 Unclassified 1560
32 Ga0070708_100544841 3300005445 Bacteria 1094
33 Ga0070662_100372689 3300005457 Bacteria 1173
34 Ga0070662_100384829 3300005457 Bacteria 1155
35 Ga0070681_10002582 3300005458 Bacteria 16612
36 Ga0070681_10015596 3300005458 Bacteria 7567
37 Ga0068867_100867960 3300005459 Bacteria 810
38 Ga0068867_101551421 3300005459 Bacteria 618
39 Ga0070685_10138535 3300005466 Unclassified 1529
40 Ga0070685_10429360 3300005466 Bacteria 921
41 Ga0070706_100457816 3300005467 Unclassified 1187
42 Ga0070707_100041396 3300005468 Bacteria 4409
43 Ga0070707_101246799 3300005468 Bacteria 710
44 Ga0070699_100021443 3300005518 Bacteria 5572
45 Ga0070679_100003582 3300005530 Bacteria 14210
46 Ga0070679_100028851 3300005530 Bacteria 5473
47 Ga0070679_101347425 3300005530 Bacteria 659
48 Ga0070684_100002126 3300005535 Bacteria 14619
49 Ga0070684_100006736 3300005535 Bacteria 8912
50 Ga0070684_100007785 3300005535 Bacteria 8356
51 Ga0070684_100042730 3300005535 Bacteria 3914
52 Ga0070684_100082044 3300005535 Bacteria 2854
53 Ga0070684_100293151 3300005535 Bacteria 1492
54 Ga0068853_100500911 3300005539 Unclassified 1146
55 Ga0070704_100406875 3300005549 Bacteria 1162
56 Ga0068855_100530153 3300005563 Unclassified 1277
57 Ga0070664_100086916 3300005564 Bacteria 2702
58 Ga0070664_100474255 3300005564 Bacteria 1151
59 Ga0070664_100667108 3300005564 Bacteria 967
60 Ga0068857_100027674 3300005577 Bacteria 5001
61 Ga0068857_100053842 3300005577 Bacteria 3570
62 Ga0068857_100086946 3300005577 Bacteria 2796
63 Ga0068856_100263442 3300005614 Bacteria 1739
64 Ga0070702_100182867 3300005615 Bacteria 1373
65 Ga0068870_10002935 3300005840 Bacteria 7182
66 Ga0068870_10379482 3300005840 Bacteria 915
67 Ga0081455_10010510 3300005937 Bacteria 9380
68 Ga0081455_10024006 3300005937 Bacteria 5658
69 Ga0081538_10000764 3300005981 Bacteria 35156
70 Ga0081538_10003134 3300005981 Bacteria 15720
71 Ga0081538_10069515 3300005981 Bacteria 1950
72 Ga0081540_1004199 3300005983 Bacteria 11072
73 Ga0070717_10009460 3300006028 Bacteria 7326
74 Ga0070717_10024240 3300006028 Bacteria 4816
75 Ga0075365_10010270 3300006038 Bacteria 5441
76 Ga0075364_10044927 3300006051 Bacteria 2874
77 Ga0075432_10344483 3300006058 Unclassified 630
78 Ga0070715_10136242 3300006163 Unclassified 1187
79 Ga0070716_100151157 3300006173 Bacteria 1493
80 Ga0075362_10007581 3300006177 Bacteria 4119
81 Ga0075428_100002031 3300006844 Bacteria 21804
82 Ga0075428_100163168 3300006844 Bacteria 2418
83 Ga0075430_100004550 3300006846 Bacteria 11676
84 Ga0075431_100008749 3300006847 Bacteria 10142
85 Ga0075431_100322692 3300006847 Bacteria 1557
86 Ga0075433_10081721 3300006852 Bacteria 2849
87 Ga0075433_10151630 3300006852 Bacteria 2062
88 Ga0075433_10225593 3300006852 Bacteria 1664
89 Ga0075434_100076309 3300006871 Bacteria 3346
90 Ga0075434_100116156 3300006871 Bacteria 2689
91 Ga0075434_101208651 3300006871 Bacteria 768
92 Ga0075429_100053827 3300006880 Bacteria 3501
93 Ga0075429_100179406 3300006880 Bacteria 1856
94 Ga0075435_100002208 3300007076 Bacteria 12844
95 Ga0075435_100070872 3300007076 Bacteria 2846
96 Ga0075435_100212019 3300007076 Bacteria 1643
97 Ga0075435_100719065 3300007076 Bacteria 868
98 Ga0105240_11281314 3300009093 Bacteria 774
99 Ga0111539_10165451 3300009094 Bacteria 2586
100 Ga0111539_10264614 3300009094 Unclassified 2002
101 Ga0111539_10394271 3300009094 Bacteria 1612
102 Ga0111539_10706518 3300009094 Bacteria 1173
103 Ga0105245_10148930 3300009098 Bacteria 2211
104 Ga0105245_10437535 3300009098 Bacteria 1314
105 Ga0105247_10120626 3300009101 Bacteria 1698
106 Ga0114129_10000663 3300009147 Bacteria 43174
107 Ga0114129_10218069 3300009147 Bacteria 2576
108 Ga0114129_10332478 3300009147 Bacteria 2017
109 Ga0114129_10389606 3300009147 Unclassified 1838
110 Ga0114129_10491900 3300009147 Bacteria 1603
111 Ga0114129_10531841 3300009147 Bacteria 1531
112 Ga0114129_12064382 3300009147 Bacteria 688
113 Ga0105243_10141954 3300009148 Bacteria 2050
114 Ga0105243_10941211 3300009148 Bacteria 862
115 Ga0105237_11208119 3300009545 Bacteria 763
116 Ga0105238_10040039 3300009551 Bacteria 4750
117 Ga0099796_10022206 3300010159 Bacteria 1966
118 Ga0105239_10148822 3300010375 Bacteria 2613
119 Ga0157369_10422903 3300013105 Bacteria 1381
120 Ga0157374_10060432 3300013296 Bacteria 3546
121 Ga0157378_10657147 3300013297 Bacteria 1064
122 Ga0163162_10064750 3300013306 Bacteria 3701
123 Ga0163162_11133522 3300013306 Unclassified 887
124 Ga0157375_10268818 3300013308 Unclassified 1867
125 Ga0157375_10764025 3300013308 Bacteria 1117
126 Ga0163163_10422600 3300014325 Unclassified 1392
127 Ga0163163_10674762 3300014325 Bacteria 1097
128 Ga0157380_11067768 3300014326 Bacteria 845
129 Ga0157376_10043809 3300014969 Bacteria 3674
130 Ga0182007_10046002 3300015262 Unclassified 1445
131 Ga0207692_10079976 3300025898 Bacteria 1745
132 Ga0207699_10111583 3300025906 Bacteria 1753
133 Ga0207643_10003192 3300025908 Bacteria 8831
134 Ga0207705_10044389 3300025909 Bacteria 3194
135 Ga0207684_10562928 3300025910 Bacteria 975
136 Ga0207707_10017662 3300025912 Bacteria 6221
137 Ga0207707_10107393 3300025912 Bacteria 2440
138 Ga0207693_10001487 3300025915 Bacteria 20704
139 Ga0207693_10007145 3300025915 Bacteria 9210
140 Ga0207663_10167057 3300025916 Unclassified 1559
141 Ga0207660_10014983 3300025917 Bacteria 5109
142 Ga0207660_10188440 3300025917 Unclassified 1605
143 Ga0207657_10035698 3300025919 Bacteria 4456
144 Ga0207657_10094043 3300025919 Bacteria 2496
145 Ga0207657_10116681 3300025919 Bacteria 2199
146 Ga0207649_10046066 3300025920 Bacteria 2677
147 Ga0207649_10175620 3300025920 Bacteria 1496
148 Ga0207652_10117748 3300025921 Bacteria 2360
149 Ga0207652_10342431 3300025921 Bacteria 1350
150 Ga0207646_10046517 3300025922 Bacteria 3893
151 Ga0207650_10002691 3300025925 Bacteria 12273
152 Ga0207687_10036227 3300025927 Bacteria 3360
153 Ga0207687_10064716 3300025927 Bacteria 2594
154 Ga0207700_10043659 3300025928 Bacteria 3294
155 Ga0207700_10109038 3300025928 Bacteria 2224
156 Ga0207664_10008451 3300025929 Bacteria 7182
157 Ga0207664_10032880 3300025929 Bacteria 3979
158 Ga0207664_10233888 3300025929 Bacteria 1598
159 Ga0207664_10326299 3300025929 Unclassified 1355
160 Ga0207664_10414375 3300025929 Unclassified 1199
161 Ga0207664_11026461 3300025929 Bacteria 739
162 Ga0207690_10443855 3300025932 Unclassified 1042
163 Ga0207690_10752446 3300025932 Unclassified 803
164 Ga0207706_10471618 3300025933 Bacteria 1085
165 Ga0207706_10710412 3300025933 Bacteria 858
166 Ga0207709_10400535 3300025935 Bacteria 1049
167 Ga0207669_11213705 3300025937 Unclassified 639
168 Ga0207704_10846662 3300025938 Bacteria 766
169 Ga0207665_10000298 3300025939 Bacteria 34286
170 Ga0207665_10091992 3300025939 Bacteria 2103
171 Ga0207661_10021449 3300025944 Bacteria 4839
172 Ga0207661_10067217 3300025944 Bacteria 2914
173 Ga0207661_10290539 3300025944 Unclassified 1463
174 Ga0207661_10646117 3300025944 Bacteria 972
175 Ga0207661_11292338 3300025944 Bacteria 670
176 Ga0207679_10069709 3300025945 Bacteria 2647
177 Ga0207651_10548655 3300025960 Bacteria 1005
178 Ga0207677_10173264 3300026023 Unclassified 1690
179 Ga0207677_10815614 3300026023 Bacteria 836
180 Ga0207639_11171689 3300026041 Bacteria 721
181 Ga0207708_10620904 3300026075 Bacteria 917
182 Ga0207708_10667107 3300026075 Unclassified 886
183 Ga0207708_11485189 3300026075 Unclassified 595
184 Ga0207648_10066369 3300026089 Bacteria 3147
185 Ga0207648_10578084 3300026089 Bacteria 1034
186 Ga0207674_10001702 3300026116 Bacteria 28143
187 Ga0207674_10024757 3300026116 Bacteria 6407
188 Ga0207674_10066083 3300026116 Bacteria 3644
189 Ga0207674_10141014 3300026116 Bacteria 2369
190 Ga0207683_10118683 3300026121 Bacteria 2373
191 Ga0207428_10004697 3300027907 Bacteria 12932
192 Ga0207428_10016837 3300027907 Bacteria 6282
193 Ga0207428_10111453 3300027907 Bacteria 2105
194 Ga0265318_10092624 3300028577 Bacteria 1113
195 Ga0307408_100175947 3300031548 Bacteria 1712
196 Ga0307405_10368929 3300031731 Bacteria 1113
197 Ga0307405_10799605 3300031731 Bacteria 790
198 Ga0307413_10050193 3300031824 Bacteria 2505
199 Ga0307410_10033585 3300031852 Bacteria 3313
200 Ga0307406_10032384 3300031901 Bacteria 3191
201 Ga0307412_10060967 3300031911 Bacteria 2534
202 Ga0307409_100067053 3300031995 Bacteria 2832
203 Ga0307409_100523577 3300031995 Bacteria 1159
204 Ga0307416_100021260 3300032002 Bacteria 4654
205 Ga0307416_100097466 3300032002 Bacteria 2546
206 Ga0307414_10297670 3300032004 Bacteria 1363
207 Ga0307411_10040458 3300032005 Bacteria 2957
208 Ga0307415_100099430 3300032126 Bacteria 2129
209 Ga0373944_0013885 3300035089 Bacteria 2241
210 Ga0373923_0122444 3300035111 Bacteria 1163
211 Ga0373936_0158085 3300035113 Bacteria 986
212 Ga0373945_0037241 3300035116 Bacteria 1745
213 Ga0373943_0054145 3300035170 Bacteria 1983
214 Ga0373943_0096576 3300035170 Bacteria 1539
215 Ga0373943_0248244 3300035170 Bacteria 999
216 Ga0373931_0008105 3300035691 Bacteria 4975
217 Ga0373927_0013559 3300035695 Bacteria 5413
218 Ga0373947_0006331 3300035725 Bacteria 6877
219 Ga0373937_0000447 3300036401 Bacteria 38075
220 Ga0373925_0002886 3300037068 Bacteria 13581
221 Ga0395899_0003964 3300037312 Bacteria 11663
222 Ga0395899_0044717 3300037312 Bacteria 3299
223 Ga0395899_0058333 3300037312 Bacteria 2847
224 Ga0395899_0126712 3300037312 Bacteria 1826
225 Ga0395899_0133836 3300037312 Bacteria 1768
226 Ga0395899_0153452 3300037312 Bacteria 1631
227 Ga0395900_0007259 3300037418 Bacteria 11475
228 Ga0395900_0024221 3300037418 Bacteria 6214
229 Ga0395900_0047541 3300037418 Bacteria 4418
230 Ga0395900_0049289 3300037418 Bacteria 4339
231 Ga0395900_0055262 3300037418 Bacteria 4088
232 Ga0395900_0068018 3300037418 Bacteria 3660
233 Ga0395900_0097950 3300037418 Bacteria 3013
234 Ga0395900_0141217 3300037418 Bacteria 2466
235 Ga0395900_0164386 3300037418 Bacteria 2262
236 Ga0395900_0630270 3300037418 Bacteria 1010
237 Ga0395900_1029836 3300037418 Viruses 742
238 Ga0395898_0003845 3300037466 Bacteria 16633
239 Ga0395898_0008130 3300037466 Bacteria 11106
240 Ga0395898_0009330 3300037466 Bacteria 10310
241 Ga0395898_0043296 3300037466 Bacteria 4436
242 Ga0395898_0053387 3300037466 Bacteria 3947
243 Ga0395898_0095125 3300037466 Bacteria 2862
244 Ga0395898_0140645 3300037466 Bacteria 2311
245 Ga0395898_0383679 3300037466 Bacteria 1340
246 Ga0395898_0681458 3300037466 Viruses 970
247 Ga0395898_0943320 3300037466 Unclassified 800
248 Ga0395898_1530568 3300037466 Unclassified 592
249 Ga0395905_0013924 3300037471 Bacteria 7693
250 Ga0395905_0016829 3300037471 Bacteria 6947
251 Ga0395905_0057024 3300037471 Bacteria 3653
252 Ga0395905_0132978 3300037471 Unclassified 2340
253 Ga0395905_0287737 3300037471 Bacteria 1530
254 Ga0395905_0377517 3300037471 Bacteria 1311
255 Ga0395905_0497040 3300037471 Bacteria 1120
256 Ga0395901_0003520 3300038443 Bacteria 15772
257 Ga0395901_0008514 3300038443 Bacteria 10364
258 Ga0395901_0009985 3300038443 Bacteria 9620
259 Ga0395901_0023584 3300038443 Bacteria 6308
260 Ga0395901_0033709 3300038443 Bacteria 5287
261 Ga0395901_0035987 3300038443 Bacteria 5115
262 Ga0395901_0055138 3300038443 Bacteria 4132
263 Ga0395901_0070177 3300038443 Unclassified 3650
264 Ga0395901_0088972 3300038443 Bacteria 3230
265 Ga0395901_0089864 3300038443 Bacteria 3214
266 Ga0395901_0223165 3300038443 Unclassified 1969
267 Ga0395901_0436502 3300038443 Bacteria 1341
268 Ga0395901_0534366 3300038443 Unclassified 1190
269 Ga0395901_0558076 3300038443 Bacteria 1160
270 Ga0395901_1249405 3300038443 Bacteria 706
271 Ga0439438_068946 3300041405 Bacteria 877
272 Ga0451789_0558252 3300041443 Bacteria 744
273 Ga0451841_0020301 3300041498 Bacteria 624
274 Ga0451849_1569805 3300041505 Bacteria 839
275 Ga0451853_0186481 3300041512 Bacteria 1965
276 Ga0439448_0141143 3300042005 Bacteria 834
277 Ga0439458_0011985 3300042157 Bacteria 1942
278 Ga0439434_0003874 3300042435 Bacteria 4372
279 Ga0439440_0139918 3300042993 Bacteria 687
280 Ga0466969_0017127 3300044656 Bacteria 3787
281 Ga0466961_0030210 3300044693 Bacteria 3482
282 Ga0466961_0126155 3300044693 Unclassified 1606
283 Ga0466963_0000755 3300044694 Bacteria 15979
284 Ga0466963_0149249 3300044694 Bacteria 1623
285 Ga0466963_0178533 3300044694 Unclassified 1482
286 Ga0466964_0004027 3300044706 Bacteria 5400
287 Ga0466964_0010699 3300044706 Bacteria 3463
288 Ga0466964_0164333 3300044706 Bacteria 1040
289 Ga0466971_0006458 3300044719 Bacteria 5093
290 Ga0466971_0010227 3300044719 Bacteria 4098
291 Ga0466968_0046556 3300044735 Bacteria 1843
292 Ga0466957_0053078 3300044842 Bacteria 2470
293 Ga0466957_0525521 3300044842 Bacteria 822
294 Ga0466960_0434493 3300044901 Bacteria 761
295 Ga0466960_0631095 3300044901 Bacteria 638
296 Ga0451576_1848763 3300045051 Bacteria 624
297 Ga0466958_0016030 3300045836 Bacteria 4308
298 Ga0466958_0076955 3300045836 Unclassified 2048
299 Ga0466967_0019309 3300045976 Bacteria 5476
300 Ga0466967_0028096 3300045976 Bacteria 4691
301 Ga0466967_0033888 3300045976 Bacteria 4328
302 Ga0466967_0136873 3300045976 Bacteria 2278
303 Ga0466967_0321616 3300045976 Unclassified 1492
304 Ga0466967_0731932 3300045976 Bacteria 980
305 Ga0495592_0000124 3300046454 Bacteria 68396
306 Ga0495592_0149124 3300046454 Unclassified 1619
307 Ga0495592_0184618 3300046454 Bacteria 1418
308 Ga0495603_0021025 3300046455 Bacteria 3951
309 Ga0495603_0617789 3300046455 Bacteria 620
310 Ga0495629_0032201 3300046459 Bacteria 3712
311 Ga0495629_0120821 3300046459 Bacteria 1825
312 Ga0495641_0004998 3300046461 Bacteria 9150
313 Ga0495641_0008215 3300046461 Bacteria 6398
314 Ga0495641_0012855 3300046461 Bacteria 4645
315 Ga0495641_0205239 3300046461 Bacteria 883
316 Ga0495651_0000310 3300046462 Bacteria 37941
317 Ga0495651_0018723 3300046462 Bacteria 5364
318 Ga0495651_0251099 3300046462 Bacteria 1208
319 Ga0495653_0006649 3300046463 Bacteria 9488
320 Ga0495653_0016517 3300046463 Bacteria 6006
321 Ga0495653_0249882 3300046463 Bacteria 1177
322 Ga0495580_0016366 3300046472 Bacteria 5567
323 Ga0495582_0039549 3300046473 Bacteria 2596
324 Ga0495582_0085920 3300046473 Bacteria 1750
325 Ga0495639_0000291 3300046475 Bacteria 24492
326 Ga0495662_0001883 3300046476 Bacteria 10515
327 Ga0495664_0010087 3300046477 Bacteria 5298
328 Ga0495584_0121846 3300046491 Bacteria 1321
329 Ga0495585_0417894 3300046492 Unclassified 644
330 Ga0495596_0303544 3300046500 Bacteria 621
331 Ga0495608_0001926 3300046511 Bacteria 14894
332 Ga0495608_0019616 3300046511 Bacteria 4652
333 Ga0495618_0013301 3300046514 Bacteria 5008
334 Ga0495618_0031973 3300046514 Bacteria 3295
335 Ga0495618_0137479 3300046514 Bacteria 1563
336 Ga0495618_0282674 3300046514 Bacteria 1034
337 Ga0495628_0000436 3300046516 Bacteria 37941
338 Ga0495628_0735128 3300046516 Bacteria 694
339 Ga0495630_0000631 3300046517 Bacteria 25489
340 Ga0495630_0019931 3300046517 Bacteria 4937
341 Ga0495631_0168083 3300046518 Bacteria 941
342 Ga0495637_0118127 3300046520 Bacteria 1023
343 Ga0495644_0044089 3300046523 Bacteria 1678
344 Ga0495644_0187355 3300046523 Bacteria 796
345 Ga0495666_0000270 3300046526 Bacteria 22402
346 Ga0495642_0067132 3300046528 Bacteria 1495
347 Ga0495652_0000050 3300046529 Bacteria 120480
348 Ga0495652_0004378 3300046529 Bacteria 13510
349 Ga0495652_0207375 3300046529 Unclassified 1483
350 Ga0495652_0402941 3300046529 Bacteria 968
351 Ga0495665_0015599 3300046531 Bacteria 4088
352 Ga0495665_0020458 3300046531 Bacteria 3555
353 Ga0495640_0011102 3300046533 Bacteria 6933
354 Ga0495640_0021059 3300046533 Bacteria 4793
355 Ga0495640_0241354 3300046533 Bacteria 1134
356 Ga0495640_0399980 3300046533 Bacteria 843
357 Ga0495586_0019798 3300046535 Bacteria 3583
358 Ga0495587_0000084 3300046536 Bacteria 72926
359 Ga0495587_0706419 3300046536 Bacteria 552
360 Ga0495609_0161915 3300046538 Bacteria 948
361 Ga0495609_0317979 3300046538 Bacteria 632
362 Ga0495645_0000067 3300046543 Bacteria 73037
363 Ga0495645_0076558 3300046543 Bacteria 2407
364 Ga0495667_0012434 3300046559 Bacteria 5773
365 Ga0495667_0245040 3300046559 Bacteria 1141
366 Ga0495667_0359530 3300046559 Bacteria 919
367 Ga0495667_0794736 3300046559 Unclassified 583
368 Ga0495656_0100366 3300046615 Bacteria 1338
369 Ga0495634_0009458 3300046642 Bacteria 7186
370 Ga0495634_0036014 3300046642 Bacteria 3386
371 Ga0495635_0008777 3300046663 Bacteria 7057
372 Ga0495661_0166570 3300046665 Bacteria 1179
373 Ga0495588_0137963 3300046674 Unclassified 1288
374 Ga0495588_0302850 3300046674 Bacteria 841
375 Ga0495657_0029681 3300046675 Bacteria 3834
376 Ga0495657_0119531 3300046675 Bacteria 1661
377 Ga0495657_0570093 3300046675 Bacteria 656
378 Ga0495599_0000009 3300046678 Bacteria 217299
379 Ga0495599_0103220 3300046678 Bacteria 1777
380 Ga0495623_0000219 3300046679 Bacteria 36687
381 Ga0495623_0172641 3300046679 Bacteria 1262
382 Ga0495646_0002381 3300046680 Bacteria 11524
383 Ga0495646_0046138 3300046680 Bacteria 2658
384 Ga0495647_0000243 3300046681 Bacteria 14906
385 Ga0495647_0025704 3300046681 Bacteria 2153
386 Ga0495658_0001721 3300046683 Bacteria 11348
387 Ga0495658_0016722 3300046683 Bacteria 3778
388 Ga0495658_0020995 3300046683 Bacteria 3437
389 Ga0495613_0004288 3300046689 Bacteria 10685
390 Ga0495613_0010027 3300046689 Bacteria 7037
391 Ga0495613_0599433 3300046689 Bacteria 733
392 Ga0495624_0001273 3300046690 Bacteria 19870
393 Ga0495624_0111951 3300046690 Bacteria 1678
394 Ga0495670_0295401 3300046691 Unclassified 868
395 Ga0495671_0411989 3300046692 Bacteria 647
396 Ga0495589_0031980 3300046794 Bacteria 2647
397 Ga0495589_0129439 3300046794 Unclassified 1213
398 Ga0495589_0377305 3300046794 Unclassified 652
399 Ga0495581_0000258 3300047315 Bacteria 25364
400 Ga0495604_0000334 3300047317 Bacteria 42026
401 Ga0495604_0212814 3300047317 Bacteria 1335
402 Ga0495636_0107352 3300047318 Bacteria 1226
403 Ga0495674_0027493 3300047319 Bacteria 5199
404 Ga0495674_0047809 3300047319 Bacteria 3790
405 Ga0495674_0099326 3300047319 Bacteria 2478
406 Ga0495674_0105943 3300047319 Bacteria 2388
407 Ga0495676_0008703 3300047321 Bacteria 9291
408 Ga0495676_0014375 3300047321 Bacteria 7083
409 Ga0495676_0225267 3300047321 Unclassified 1290
410 Ga0495680_0001263 3300047322 Bacteria 27605
411 Ga0495680_0009223 3300047322 Bacteria 8891
412 Ga0495680_0017367 3300047322 Bacteria 6147
413 Ga0495680_0028670 3300047322 Bacteria 4563
414 Ga0495680_0304255 3300047322 Unclassified 1119
415 Ga0495675_0000972 3300047444 Bacteria 17397
416 Ga0495684_0013249 3300047471 Bacteria 6362
417 Ga0495684_0276166 3300047471 Bacteria 1214
418 Ga0495593_0000732 3300047673 Bacteria 19043
419 Ga0495593_0486167 3300047673 Bacteria 619
420 Ga0495602_0000234 3300048088 Bacteria 51947
421 Ga0495602_0094324 3300048088 Bacteria 2473
422 Ga0495614_0000616 3300048089 Bacteria 14926
423 Ga0496100_0166017 3300048903 Bacteria 1586
424 Ga0496100_0531324 3300048903 Bacteria 908
425 Ga0496101_0068091 3300048904 Bacteria 2602
426 Ga0496101_0285826 3300048904 Bacteria 1290
427 Ga0496101_0513792 3300048904 Bacteria 946
428 Ga0496102_0228019 3300048905 Unclassified 1756
429 Ga0496102_0463473 3300048905 Unclassified 1188
430 Ga0496102_0675566 3300048905 Bacteria 956
431 Ga0496102_1210621 3300048905 Bacteria 675
432 Ga0496104_0033095 3300048907 Bacteria 4812
433 Ga0496104_0176334 3300048907 Unclassified 2048
434 Ga0496104_0421022 3300048907 Bacteria 1247
435 Ga0496104_0535815 3300048907 Bacteria 1082
436 Ga0496105_0025796 3300048908 Bacteria 4788
437 Ga0496105_0286049 3300048908 Bacteria 1328
438 Ga0496106_0023910 3300048909 Bacteria 4540
439 Ga0496106_0093251 3300048909 Bacteria 2327
440 Ga0496106_0115996 3300048909 Bacteria 2089
441 Ga0496107_0012497 3300048910 Bacteria 5926
442 Ga0496107_0052180 3300048910 Bacteria 2950
443 Ga0496107_0214700 3300048910 Bacteria 1431
444 Ga0496108_0008529 3300048911 Bacteria 8313
445 Ga0496108_0048977 3300048911 Bacteria 3533
446 Ga0496108_0498572 3300048911 Bacteria 1063
447 Ga0496108_0886720 3300048911 Bacteria 766
448 Ga0496108_0985469 3300048911 Unclassified 720
449 Ga0496109_0005099 3300048912 Bacteria 10970
450 Ga0496109_0032899 3300048912 Bacteria 4665
451 Ga0496109_0034817 3300048912 Bacteria 4538
452 Ga0496109_0071829 3300048912 Bacteria 3178
453 Ga0496109_0230125 3300048912 Bacteria 1744
454 Ga0496109_0868403 3300048912 Bacteria 840
455 Ga0496110_0049251 3300048913 Bacteria 3695
456 Ga0496110_0053718 3300048913 Bacteria 3542
457 Ga0496110_0350059 3300048913 Unclassified 1346
458 Ga0496111_0027128 3300048914 Bacteria 4049
459 Ga0496111_0136936 3300048914 Unclassified 1814
460 Ga0496111_0222712 3300048914 Bacteria 1401
461 Ga0496111_0874633 3300048914 Bacteria 648
462 Ga0496111_1116345 3300048914 Bacteria 561
463 Ga0496112_0022699 3300048915 Bacteria 5986
464 Ga0496112_0138258 3300048915 Bacteria 2406
465 Ga0496112_0224652 3300048915 Bacteria 1833
466 Ga0496112_0252147 3300048915 Bacteria 1716
467 Ga0496112_0311701 3300048915 Bacteria 1518
468 Ga0496113_0230494 3300048916 Bacteria 1477
469 Ga0496113_0317922 3300048916 Bacteria 1247
470 Ga0496114_0016756 3300048917 Bacteria 5909
471 Ga0496114_0074622 3300048917 Bacteria 2855
472 Ga0496114_0135849 3300048917 Unclassified 2126
473 Ga0496115_0147991 3300048918 Unclassified 1938
474 Ga0501031_0001667 3300049568 Bacteria 13942
475 Ga0501033_0015692 3300049570 Bacteria 5744
476 Ga0501033_0046568 3300049570 Bacteria 3224
477 Ga0501033_0170890 3300049570 Bacteria 1561
478 Ga0501034_0587347 3300049571 Bacteria 1020
479 Ga0501036_0005373 3300049572 Bacteria 10374
480 Ga0501036_0089901 3300049572 Bacteria 2594
481 Ga0501037_0085870 3300049573 Bacteria 2278
482 Ga0501037_0119074 3300049573 Unclassified 1899
483 Ga0501038_0003135 3300049574 Bacteria 15422
484 Ga0501038_0057599 3300049574 Bacteria 3335
485 Ga0501038_0097300 3300049574 Bacteria 2455
486 Ga0501039_0007614 3300049575 Bacteria 8272
487 Ga0501040_0004571 3300049576 Bacteria 8983
488 Ga0501041_0001403 3300049577 Bacteria 13324
489 Ga0501041_0024567 3300049577 Bacteria 3618
490 Ga0501042_0005138 3300049578 Bacteria 8400
491 Ga0501042_0115535 3300049578 Bacteria 1932
492 Ga0501043_0002468 3300049579 Bacteria 15647
493 Ga0501043_0034770 3300049579 Bacteria 3964
494 Ga0501043_0196888 3300049579 Bacteria 1565
495 Ga0501046_0001657 3300049580 Bacteria 21287
496 Ga0501046_0031431 3300049580 Bacteria 4302
497 Ga0501046_0045485 3300049580 Bacteria 3487
498 Ga0501046_0725657 3300049580 Bacteria 699
499 Ga0501047_0259191 3300049581 Bacteria 1587
500 Ga0501048_0001556 3300049582 Bacteria 17438
501 Ga0501048_0004495 3300049582 Bacteria 10619
502 Ga0501048_0172712 3300049582 Bacteria 1531
503 Ga0501067_0000303 3300049583 Bacteria 27180
504 Ga0501068_0001015 3300049584 Bacteria 14807
505 Ga0501068_0024770 3300049584 Bacteria 3526
506 Ga0501068_0051273 3300049584 Bacteria 2496
507 Ga0501069_0013558 3300049585 Bacteria 4346
508 Ga0501069_0321040 3300049585 Bacteria 910
509 Ga0501070_0031663 3300049586 Bacteria 4431
510 Ga0501070_0126537 3300049586 Bacteria 2111
511 Ga0501071_0002752 3300049587 Bacteria 10790
512 Ga0501071_0053969 3300049587 Bacteria 2899
513 Ga0501071_0076736 3300049587 Bacteria 2440
514 Ga0501071_0208844 3300049587 Bacteria 1468
515 Ga0501072_0002371 3300049588 Bacteria 14132
516 Ga0501072_0006964 3300049588 Bacteria 8580
517 Ga0501072_0083722 3300049588 Bacteria 2528
518 Ga0501072_0096448 3300049588 Bacteria 2350
519 Ga0501072_0287149 3300049588 Archaea 1308
520 Ga0501072_0374915 3300049588 Bacteria 1129
521 Ga0501073_0050085 3300049589 Bacteria 2928
522 Ga0501074_0004019 3300049590 Bacteria 10488
523 Ga0501074_0021623 3300049590 Bacteria 4670
524 Ga0501075_0007572 3300049591 Bacteria 7532
525 Ga0501075_0012542 3300049591 Bacteria 6028
526 Ga0501075_0445452 3300049591 Bacteria 987
527 Ga0501076_0004213 3300049592 Bacteria 10181
528 Ga0501076_0011113 3300049592 Bacteria 6697
529 Ga0501076_0451738 3300049592 Bacteria 1058
530 Ga0501077_0009280 3300049593 Bacteria 6107
531 Ga0501077_0053517 3300049593 Bacteria 2562
532 Ga0501077_0056341 3300049593 Bacteria 2494
533 Ga0501079_0006808 3300049741 Bacteria 8603
534 Ga0501079_0010654 3300049741 Bacteria 6998
535 Ga0501079_0213376 3300049741 Bacteria 1508
536 Ga0501079_0217878 3300049741 Bacteria 1491
537 Ga0501079_0352269 3300049741 Bacteria 1153
538 Ga0501080_0023313 3300049742 Bacteria 5738
539 Ga0501080_0069872 3300049742 Bacteria 3266
540 Ga0501081_0001790 3300049743 Bacteria 13320
541 Ga0501081_0002856 3300049743 Bacteria 10965
542 Ga0501081_0368345 3300049743 Unclassified 1060
543 Ga0501081_0988657 3300049743 Unclassified 636
544 Ga0501083_0009783 3300049744 Bacteria 6770
545 Ga0501083_0012154 3300049744 Bacteria 6027
546 Ga0501083_0101123 3300049744 Bacteria 1901
547 Ga0501035_0045069 3300049822 Bacteria 3969
548 Ga0501035_0047542 3300049822 Bacteria 3851
549 Ga0501035_0126023 3300049822 Bacteria 2235
550 Ga0501044_0007755 3300049823 Bacteria 11801
551 Ga0501045_0001730 3300049824 Bacteria 14699
552 Ga0501045_0016613 3300049824 Bacteria 5228
553 Ga0501045_0028491 3300049824 Bacteria 4029
554 Ga0501045_0075789 3300049824 Bacteria 2478
555 Ga0501045_0939298 3300049824 Archaea 635
556 nmdc:mga03683_9129_c1 3300050489 Bacteria 3513
557 nmdc:mga00v17_179333_c1 3300050491 Unclassified 1367
558 nmdc:mga0yw44_481598_c1 3300050492 Bacteria 842
559 nmdc:mga0k408_73762_c1 3300050493 Bacteria 1993
560 nmdc:mga06z11_66985_c1 3300050494 Bacteria 1889
561 nmdc:mga05p37_1101427_c1 3300050507 Bacteria 832
562 nmdc:mga05p37_201809_c1 3300050507 Bacteria 2408
563 nmdc:mga05p37_261641_c1 3300050507 Bacteria 2070
564 nmdc:mga05p37_26741_c1 3300050507 Bacteria 7016
565 nmdc:mga05p37_322322_c1 3300050507 Unclassified 1828
566 nmdc:mga05p37_6125_c1 3300050507 Bacteria 14170
567 nmdc:mga09592_176410_c1 3300050508 Bacteria 1848
568 nmdc:mga09592_182676_c1 3300050508 Bacteria 1815
569 nmdc:mga0qj67_6758_c1 3300050509 Bacteria 8433
570 nmdc:mga06r32_13613_c1 3300050510 Bacteria 7375
571 nmdc:mga06r32_286406_c1 3300050510 Unclassified 1634
572 nmdc:mga08y16_287886_c1 3300050511 Bacteria 1694
573 nmdc:mga08y16_762504_c1 3300050511 Bacteria 963
574 nmdc:mga08y16_99289_c1 3300050511 Bacteria 3031
575 nmdc:mga0n895_112175_c1 3300050512 Bacteria 2743
576 nmdc:mga0n895_147368_c1 3300050512 Bacteria 2384
577 nmdc:mga0n895_523073_c1 3300050512 Bacteria 1194
578 nmdc:mga0rr50_193544_c1 3300050513 Bacteria 1668
579 nmdc:mga0rr50_437289_c1 3300050513 Bacteria 1108
580 nmdc:mga08x19_29607_c1 3300050514 Bacteria 3435
581 nmdc:mga08x19_375715_c1 3300050514 Bacteria 995
582 nmdc:mga0a205_52012_c1 3300050515 Bacteria 3954
583 nmdc:mga0a205_60451_c1 3300050515 Bacteria 3659
584 nmdc:mga0a205_770124_c1 3300050515 Bacteria 810
585 nmdc:mga0a205_84357_c1 3300050515 Bacteria 3068
586 Ga0495601_0004691 3300053077 Bacteria 7917
587 Ga0495601_0011109 3300053077 Bacteria 5381
588 Ga0495601_0021697 3300053077 Bacteria 3934
589 Ga0495612_0000724 3300053078 Bacteria 13419
590 Ga0495595_0254937 3300053084 Bacteria 879
591 Ga0495619_0001368 3300053085 Bacteria 16040
592 Ga0495619_0096999 3300053085 Bacteria 2002
593 Ga0495619_0152878 3300053085 Bacteria 1592
594 Ga0495619_0376171 3300053085 Bacteria 982
595 Ga0501084_0002387 3300054114 Bacteria 15112
596 Ga0501084_0041786 3300054114 Bacteria 3835
597 Ga0501084_0153515 3300054114 Bacteria 1941
598 Ga0501084_0674934 3300054114 Bacteria 872
599 Ga0590075_002751 3300059424 Bacteria 4209
600 Ga0501082_0010499 3300060353 Bacteria 7967
601 Ga0501082_0026670 3300060353 Bacteria 4980
602 Ga0501082_0316481 3300060353 Bacteria 1359
603 Ga0466962_0001067 3300061719 Bacteria 12610
604 Ga0530510_0013233 3300061734 Bacteria 5801
605 Ga0530510_0054425 3300061734 Bacteria 2891
606 Ga0530510_0156513 3300061734 Bacteria 1684
607 Ga0070698_100135066
608 JGI25407J50210_10002089
609 JGI25407J50210_10003349
610 Ga0070658_10089856
611 Ga0070683_100007995
612 Ga0070683_100012452
613 Ga0070683_100039148
614 Ga0070680_100021220
615 Ga0070680_100303269
616 Ga0070660_100127947
617 Ga0070660_100160605
618 Ga0070661_100069862
619 Ga0070661_100225961
620 Ga0070692_10184535
621 Ga0070668_100207993
622 Ga0070675_100467441
623 Ga0070674_100065009
624 Ga0070659_100200646
625 Ga0070709_10147255
626 Ga0070709_11255209
627 Ga0070714_100017768
628 Ga0070714_100070727
629 Ga0070714_100136588
630 Ga0070714_100419575
631 Ga0070714_101038676
632 Ga0070713_100418647
633 Ga0070710_10425118
634 Ga0070711_100166213
635 Ga0070711_100455108
636 Ga0070711_100683625
637 Ga0070705_100146727
638 Ga0070708_100544841
639 Ga0070662_100372689
640 Ga0070662_100384829
641 Ga0070681_10002582
642 Ga0070681_10015596
643 Ga0068867_100867960
644 Ga0068867_101551421
645 Ga0070685_10138535
646 Ga0070685_10429360
647 Ga0070706_100457816
648 Ga0070707_100041396
649 Ga0070707_101246799
650 Ga0070699_100021443
651 Ga0070679_100003582
652 Ga0070679_100028851
653 Ga0070679_101347425
654 Ga0070684_100002126
655 Ga0070684_100006736
656 Ga0070684_100007785
657 Ga0070684_100042730
658 Ga0070684_100082044
659 Ga0070684_100293151
660 Ga0068853_100500911
661 Ga0070704_100406875
662 Ga0068855_100530153
663 Ga0070664_100086916
664 Ga0070664_100474255
665 Ga0070664_100667108
666 Ga0068857_100027674
667 Ga0068857_100053842
668 Ga0068857_100086946
669 Ga0068856_100263442
670 Ga0070702_100182867
671 Ga0068870_10002935
672 Ga0068870_10379482
673 Ga0081455_10010510
674 Ga0081455_10024006
675 Ga0081538_10000764
676 Ga0081538_10003134
677 Ga0081538_10069515
678 Ga0081540_1004199
679 Ga0070717_10009460
680 Ga0070717_10024240
681 Ga0075365_10010270
682 Ga0075364_10044927
683 Ga0075432_10344483
684 Ga0070715_10136242
685 Ga0070716_100151157
686 Ga0075362_10007581
687 Ga0075428_100002031
688 Ga0075428_100163168
689 Ga0075430_100004550
690 Ga0075431_100008749
691 Ga0075431_100322692
692 Ga0075433_10081721
693 Ga0075433_10151630
694 Ga0075433_10225593
695 Ga0075434_100076309
696 Ga0075434_100116156
697 Ga0075434_101208651
698 Ga0075429_100053827
699 Ga0075429_100179406
700 Ga0075435_100002208
701 Ga0075435_100070872
702 Ga0075435_100212019
703 Ga0075435_100719065
704 Ga0105240_11281314
705 Ga0111539_10165451
706 Ga0111539_10264614
707 Ga0111539_10394271
708 Ga0111539_10706518
709 Ga0105245_10148930
710 Ga0105245_10437535
711 Ga0105247_10120626
712 Ga0114129_10000663
713 Ga0114129_10218069
714 Ga0114129_10332478
715 Ga0114129_10389606
716 Ga0114129_10491900
717 Ga0114129_10531841
718 Ga0114129_12064382
719 Ga0105243_10141954
720 Ga0105243_10941211
721 Ga0105237_11208119
722 Ga0105238_10040039
723 Ga0099796_10022206
724 Ga0105239_10148822
725 Ga0157369_10422903
726 Ga0157374_10060432
727 Ga0157378_10657147
728 Ga0163162_10064750
729 Ga0163162_11133522
730 Ga0157375_10268818
731 Ga0157375_10764025
732 Ga0163163_10422600
733 Ga0163163_10674762
734 Ga0157380_11067768
735 Ga0157376_10043809
736 Ga0182007_10046002
737 Ga0207692_10079976
738 Ga0207699_10111583
739 Ga0207643_10003192
740 Ga0207705_10044389
741 Ga0207684_10562928
742 Ga0207707_10017662
743 Ga0207707_10107393
744 Ga0207693_10001487
745 Ga0207693_10007145
746 Ga0207663_10167057
747 Ga0207660_10014983
748 Ga0207660_10188440
749 Ga0207657_10035698
750 Ga0207657_10094043
751 Ga0207657_10116681
752 Ga0207649_10046066
753 Ga0207649_10175620
754 Ga0207652_10117748
755 Ga0207652_10342431
756 Ga0207646_10046517
757 Ga0207650_10002691
758 Ga0207687_10036227
759 Ga0207687_10064716
760 Ga0207700_10043659
761 Ga0207700_10109038
762 Ga0207664_10008451
763 Ga0207664_10032880
764 Ga0207664_10233888
765 Ga0207664_10326299
766 Ga0207664_10414375
767 Ga0207664_11026461
768 Ga0207690_10443855
769 Ga0207690_10752446
770 Ga0207706_10471618
771 Ga0207706_10710412
772 Ga0207709_10400535
773 Ga0207669_11213705
774 Ga0207704_10846662
775 Ga0207665_10000298
776 Ga0207665_10091992
777 Ga0207661_10021449
778 Ga0207661_10067217
779 Ga0207661_10290539
780 Ga0207661_10646117
781 Ga0207661_11292338
782 Ga0207679_10069709
783 Ga0207651_10548655
784 Ga0207677_10173264
785 Ga0207677_10815614
786 Ga0207639_11171689
787 Ga0207708_10620904
788 Ga0207708_10667107
789 Ga0207708_11485189
790 Ga0207648_10066369
791 Ga0207648_10578084
792 Ga0207674_10001702
793 Ga0207674_10024757
794 Ga0207674_10066083
795 Ga0207674_10141014
796 Ga0207683_10118683
797 Ga0207428_10004697
798 Ga0207428_10016837
799 Ga0207428_10111453
800 Ga0265318_10092624
801 Ga0307408_100175947
802 Ga0307405_10368929
803 Ga0307405_10799605
804 Ga0307413_10050193
805 Ga0307410_10033585
806 Ga0307406_10032384
807 Ga0307412_10060967
808 Ga0307409_100067053
809 Ga0307409_100523577
810 Ga0307416_100021260
811 Ga0307416_100097466
812 Ga0307414_10297670
813 Ga0307411_10040458
814 Ga0307415_100099430
815 Ga0373944_0013885
816 Ga0373923_0122444
817 Ga0373936_0158085
818 Ga0373945_0037241
819 Ga0373943_0054145
820 Ga0373943_0096576
821 Ga0373943_0248244
822 Ga0373931_0008105
823 Ga0373927_0013559
824 Ga0373947_0006331
825 Ga0373937_0000447
826 Ga0373925_0002886
827 Ga0395899_0003964
828 Ga0395899_0044717
829 Ga0395899_0058333
830 Ga0395899_0126712
831 Ga0395899_0133836
832 Ga0395899_0153452
833 Ga0395900_0007259
834 Ga0395900_0024221
835 Ga0395900_0047541
836 Ga0395900_0049289
837 Ga0395900_0055262
838 Ga0395900_0068018
839 Ga0395900_0097950
840 Ga0395900_0141217
841 Ga0395900_0164386
842 Ga0395900_0630270
843 Ga0395900_1029836
844 Ga0395898_0003845
845 Ga0395898_0008130
846 Ga0395898_0009330
847 Ga0395898_0043296
848 Ga0395898_0053387
849 Ga0395898_0095125
850 Ga0395898_0140645
851 Ga0395898_0383679
852 Ga0395898_0681458
853 Ga0395898_0943320
854 Ga0395898_1530568
855 Ga0395905_0013924
856 Ga0395905_0016829
857 Ga0395905_0057024
858 Ga0395905_0132978
859 Ga0395905_0287737
860 Ga0395905_0377517
861 Ga0395905_0497040
862 Ga0395901_0003520
863 Ga0395901_0008514
864 Ga0395901_0009985
865 Ga0395901_0023584
866 Ga0395901_0033709
867 Ga0395901_0035987
868 Ga0395901_0055138
869 Ga0395901_0070177
870 Ga0395901_0088972
871 Ga0395901_0089864
872 Ga0395901_0223165
873 Ga0395901_0436502
874 Ga0395901_0534366
875 Ga0395901_0558076
876 Ga0395901_1249405
877 Ga0439438_068946
878 Ga0451789_0558252
879 Ga0451841_0020301
880 Ga0451849_1569805
881 Ga0451853_0186481
882 Ga0439448_0141143
883 Ga0439458_0011985
884 Ga0439434_0003874
885 Ga0439440_0139918
886 Ga0466969_0017127
887 Ga0466961_0030210
888 Ga0466961_0126155
889 Ga0466963_0000755
890 Ga0466963_0149249
891 Ga0466963_0178533
892 Ga0466964_0004027
893 Ga0466964_0010699
894 Ga0466964_0164333
895 Ga0466971_0006458
896 Ga0466971_0010227
897 Ga0466968_0046556
898 Ga0466957_0053078
899 Ga0466957_0525521
900 Ga0466960_0434493
901 Ga0466960_0631095
902 Ga0451576_1848763
903 Ga0466958_0016030
904 Ga0466958_0076955
905 Ga0466967_0019309
906 Ga0466967_0028096
907 Ga0466967_0033888
908 Ga0466967_0136873
909 Ga0466967_0321616
910 Ga0466967_0731932
911 Ga0495592_0000124
912 Ga0495592_0149124
913 Ga0495592_0184618
914 Ga0495603_0021025
915 Ga0495603_0617789
916 Ga0495629_0032201
917 Ga0495629_0120821
918 Ga0495641_0004998
919 Ga0495641_0008215
920 Ga0495641_0012855
921 Ga0495641_0205239
922 Ga0495651_0000310
923 Ga0495651_0018723
924 Ga0495651_0251099
925 Ga0495653_0006649
926 Ga0495653_0016517
927 Ga0495653_0249882
928 Ga0495580_0016366
929 Ga0495582_0039549
930 Ga0495582_0085920
931 Ga0495639_0000291
932 Ga0495662_0001883
933 Ga0495664_0010087
934 Ga0495584_0121846
935 Ga0495585_0417894
936 Ga0495596_0303544
937 Ga0495608_0001926
938 Ga0495608_0019616
939 Ga0495618_0013301
940 Ga0495618_0031973
941 Ga0495618_0137479
942 Ga0495618_0282674
943 Ga0495628_0000436
944 Ga0495628_0735128
945 Ga0495630_0000631
946 Ga0495630_0019931
947 Ga0495631_0168083
948 Ga0495637_0118127
949 Ga0495644_0044089
950 Ga0495644_0187355
951 Ga0495666_0000270
952 Ga0495642_0067132
953 Ga0495652_0000050
954 Ga0495652_0004378
955 Ga0495652_0207375
956 Ga0495652_0402941
957 Ga0495665_0015599
958 Ga0495665_0020458
959 Ga0495640_0011102
960 Ga0495640_0021059
961 Ga0495640_0241354
962 Ga0495640_0399980
963 Ga0495586_0019798
964 Ga0495587_0000084
965 Ga0495587_0706419
966 Ga0495609_0161915
967 Ga0495609_0317979
968 Ga0495645_0000067
969 Ga0495645_0076558
970 Ga0495667_0012434
971 Ga0495667_0245040
972 Ga0495667_0359530
973 Ga0495667_0794736
974 Ga0495656_0100366
975 Ga0495634_0009458
976 Ga0495634_0036014
977 Ga0495635_0008777
978 Ga0495661_0166570
979 Ga0495588_0137963
980 Ga0495588_0302850
981 Ga0495657_0029681
982 Ga0495657_0119531
983 Ga0495657_0570093
984 Ga0495599_0000009
985 Ga0495599_0103220
986 Ga0495623_0000219
987 Ga0495623_0172641
988 Ga0495646_0002381
989 Ga0495646_0046138
990 Ga0495647_0000243
991 Ga0495647_0025704
992 Ga0495658_0001721
993 Ga0495658_0016722
994 Ga0495658_0020995
995 Ga0495613_0004288
996 Ga0495613_0010027
997 Ga0495613_0599433
998 Ga0495624_0001273
999 Ga0495624_0111951
1000 Ga0495670_0295401
1001 Ga0495671_0411989
1002 Ga0495589_0031980
1003 Ga0495589_0129439
1004 Ga0495589_0377305
1005 Ga0495581_0000258
1006 Ga0495604_0000334
1007 Ga0495604_0212814
1008 Ga0495636_0107352
1009 Ga0495674_0027493
1010 Ga0495674_0047809
1011 Ga0495674_0099326
1012 Ga0495674_0105943
1013 Ga0495676_0008703
1014 Ga0495676_0014375
1015 Ga0495676_0225267
1016 Ga0495680_0001263
1017 Ga0495680_0009223
1018 Ga0495680_0017367
1019 Ga0495680_0028670
1020 Ga0495680_0304255
1021 Ga0495675_0000972
1022 Ga0495684_0013249
1023 Ga0495684_0276166
1024 Ga0495593_0000732
1025 Ga0495593_0486167
1026 Ga0495602_0000234
1027 Ga0495602_0094324
1028 Ga0495614_0000616
1029 Ga0496100_0166017
1030 Ga0496100_0531324
1031 Ga0496101_0068091
1032 Ga0496101_0285826
1033 Ga0496101_0513792
1034 Ga0496102_0228019
1035 Ga0496102_0463473
1036 Ga0496102_0675566
1037 Ga0496102_1210621
1038 Ga0496104_0033095
1039 Ga0496104_0176334
1040 Ga0496104_0421022
1041 Ga0496104_0535815
1042 Ga0496105_0025796
1043 Ga0496105_0286049
1044 Ga0496106_0023910
1045 Ga0496106_0093251
1046 Ga0496106_0115996
1047 Ga0496107_0012497
1048 Ga0496107_0052180
1049 Ga0496107_0214700
1050 Ga0496108_0008529
1051 Ga0496108_0048977
1052 Ga0496108_0498572
1053 Ga0496108_0886720
1054 Ga0496108_0985469
1055 Ga0496109_0005099
1056 Ga0496109_0032899
1057 Ga0496109_0034817
1058 Ga0496109_0071829
1059 Ga0496109_0230125
1060 Ga0496109_0868403
1061 Ga0496110_0049251
1062 Ga0496110_0053718
1063 Ga0496110_0350059
1064 Ga0496111_0027128
1065 Ga0496111_0136936
1066 Ga0496111_0222712
1067 Ga0496111_0874633
1068 Ga0496111_1116345
1069 Ga0496112_0022699
1070 Ga0496112_0138258
1071 Ga0496112_0224652
1072 Ga0496112_0252147
1073 Ga0496112_0311701
1074 Ga0496113_0230494
1075 Ga0496113_0317922
1076 Ga0496114_0016756
1077 Ga0496114_0074622
1078 Ga0496114_0135849
1079 Ga0496115_0147991
1080 Ga0501031_0001667
1081 Ga0501033_0015692
1082 Ga0501033_0046568
1083 Ga0501033_0170890
1084 Ga0501034_0587347
1085 Ga0501036_0005373
1086 Ga0501036_0089901
1087 Ga0501037_0085870
1088 Ga0501037_0119074
1089 Ga0501038_0003135
1090 Ga0501038_0057599
1091 Ga0501038_0097300
1092 Ga0501039_0007614
1093 Ga0501040_0004571
1094 Ga0501041_0001403
1095 Ga0501041_0024567
1096 Ga0501042_0005138
1097 Ga0501042_0115535
1098 Ga0501043_0002468
1099 Ga0501043_0034770
1100 Ga0501043_0196888
1101 Ga0501046_0001657
1102 Ga0501046_0031431
1103 Ga0501046_0045485
1104 Ga0501046_0725657
1105 Ga0501047_0259191
1106 Ga0501048_0001556
1107 Ga0501048_0004495
1108 Ga0501048_0172712
1109 Ga0501067_0000303
1110 Ga0501068_0001015
1111 Ga0501068_0024770
1112 Ga0501068_0051273
1113 Ga0501069_0013558
1114 Ga0501069_0321040
1115 Ga0501070_0031663
1116 Ga0501070_0126537
1117 Ga0501071_0002752
1118 Ga0501071_0053969
1119 Ga0501071_0076736
1120 Ga0501071_0208844
1121 Ga0501072_0002371
1122 Ga0501072_0006964
1123 Ga0501072_0083722
1124 Ga0501072_0096448
1125 Ga0501072_0287149
1126 Ga0501072_0374915
1127 Ga0501073_0050085
1128 Ga0501074_0004019
1129 Ga0501074_0021623
1130 Ga0501075_0007572
1131 Ga0501075_0012542
1132 Ga0501075_0445452
1133 Ga0501076_0004213
1134 Ga0501076_0011113
1135 Ga0501076_0451738
1136 Ga0501077_0009280
1137 Ga0501077_0053517
1138 Ga0501077_0056341
1139 Ga0501079_0006808
1140 Ga0501079_0010654
1141 Ga0501079_0213376
1142 Ga0501079_0217878
1143 Ga0501079_0352269
1144 Ga0501080_0023313
1145 Ga0501080_0069872
1146 Ga0501081_0001790
1147 Ga0501081_0002856
1148 Ga0501081_0368345
1149 Ga0501081_0988657
1150 Ga0501083_0009783
1151 Ga0501083_0012154
1152 Ga0501083_0101123
1153 Ga0501035_0045069
1154 Ga0501035_0047542
1155 Ga0501035_0126023
1156 Ga0501044_0007755
1157 Ga0501045_0001730
1158 Ga0501045_0016613
1159 Ga0501045_0028491
1160 Ga0501045_0075789
1161 Ga0501045_0939298
1162 nmdc:mga03683_9129_c1
1163 nmdc:mga00v17_179333_c1
1164 nmdc:mga0yw44_481598_c1
1165 nmdc:mga0k408_73762_c1
1166 nmdc:mga06z11_66985_c1
1167 nmdc:mga05p37_1101427_c1
1168 nmdc:mga05p37_201809_c1
1169 nmdc:mga05p37_261641_c1
1170 nmdc:mga05p37_26741_c1
1171 nmdc:mga05p37_322322_c1
1172 nmdc:mga05p37_6125_c1
1173 nmdc:mga09592_176410_c1
1174 nmdc:mga09592_182676_c1
1175 nmdc:mga0qj67_6758_c1
1176 nmdc:mga06r32_13613_c1
1177 nmdc:mga06r32_286406_c1
1178 nmdc:mga08y16_287886_c1
1179 nmdc:mga08y16_762504_c1
1180 nmdc:mga08y16_99289_c1
1181 nmdc:mga0n895_112175_c1
1182 nmdc:mga0n895_147368_c1
1183 nmdc:mga0n895_523073_c1
1184 nmdc:mga0rr50_193544_c1
1185 nmdc:mga0rr50_437289_c1
1186 nmdc:mga08x19_29607_c1
1187 nmdc:mga08x19_375715_c1
1188 nmdc:mga0a205_52012_c1
1189 nmdc:mga0a205_60451_c1
1190 nmdc:mga0a205_770124_c1
1191 nmdc:mga0a205_84357_c1
1192 Ga0495601_0004691
1193 Ga0495601_0011109
1194 Ga0495601_0021697
1195 Ga0495612_0000724
1196 Ga0495595_0254937
1197 Ga0495619_0001368
1198 Ga0495619_0096999
1199 Ga0495619_0152878
1200 Ga0495619_0376171
1201 Ga0501084_0002387
1202 Ga0501084_0041786
1203 Ga0501084_0153515
1204 Ga0501084_0674934
1205 Ga0590075_002751
1206 Ga0501082_0010499
1207 Ga0501082_0026670
1208 Ga0501082_0316481
1209 Ga0466962_0001067
1210 Ga0530510_0013233
1211 Ga0530510_0054425
1212 Ga0530510_0156513

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04417

DUF501

Protein of unknown function (DUF501)

38

167

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v5p-assembly2.cif.gz_B complex structure of human igf2r domains 11-13 bound to igf-ii 0.3477 13 51
6y3d-assembly1.cif.gz_GGG x-ray structure of thermophilic c-phycocyanin from galdiera phlegrea 0.2697 50 149
6y3d-assembly1.cif.gz_GGG x-ray structure of thermophilic c-phycocyanin from galdiera phlegrea 0.1905 50 149
3zsu-assembly1.cif.gz_A structure of the cyanoq protein from thermosynechococcus elongatus 0.18 54 157
3zsu-assembly1.cif.gz_A structure of the cyanoq protein from thermosynechococcus elongatus 0.1638 54 157
ID Description Score Start End Superfamily
af_A4HVU6_264_505_3.60.130.30 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix; 0.2494 3 93 3.60.130.30
af_A0A286Y940_222_385_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.249 15 68 3.30.420.10
af_Q10NT7_120_228_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2207 57 149 1.25.40.10
af_Q10NT7_120_228_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.1931 57 149 1.25.40.10
3zsuA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.18 54 157 1.20.120.290
ID Description Score Start End GO Terms
AF-A0A7V9JP12-F1-model_v4 DUF501 domain-containing protein 0.9879 1 160
AF-A0A7V9CR68-F1-model_v4 DUF501 domain-containing protein 0.9822 1 159
AF-A0A538DC47-F1-model_v4 DUF501 domain-containing protein 0.977 1 164
AF-A0A538DC47-F1-model_v4 DUF501 domain-containing protein 0.9653 1 164
AF-A0A7V9JP12-F1-model_v4 DUF501 domain-containing protein 0.964 1 160

Map