F468558
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 606 | 273 | 606 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_101879294|Ga0070708_1018792941 |
| Length | 149 |
| Sequence | MTKPVYILNGPNLDRLGTREPEIYGRTTLDEIHAMIRTRAGELGLEIVDCFQSNHEGELIDRLHRRDFDVSVVNAAGLTHTSVSLRDALTGIGRPFIEVHLSDPWERDAFRKVNFIHDVAFETIKGQGPKGYLFALEVIAERLTGATNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 184 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 185 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 188 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 191 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 192 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 193 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 194 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 195 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 196 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 7.76 |
| Rhizosphere | 91.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100068392 | 3300005330 | Bacteria | 2304 |
| 2 | Ga0070670_100749214 | 3300005331 | Bacteria | 880 |
| 3 | Ga0070670_101426507 | 3300005331 | Bacteria | 635 |
| 4 | Ga0068869_100123624 | 3300005334 | Bacteria | 1982 |
| 5 | Ga0068869_100136839 | 3300005334 | Bacteria | 1888 |
| 6 | Ga0070666_10193615 | 3300005335 | Bacteria | 1429 |
| 7 | Ga0070680_100000064 | 3300005336 | Bacteria | 55845 |
| 8 | Ga0070680_100109073 | 3300005336 | Bacteria | 2303 |
| 9 | Ga0070682_100072469 | 3300005337 | Bacteria | 2208 |
| 10 | Ga0070682_100320174 | 3300005337 | Bacteria | 1145 |
| 11 | Ga0070682_100887105 | 3300005337 | Bacteria | 732 |
| 12 | Ga0068868_100093433 | 3300005338 | Bacteria | 2425 |
| 13 | Ga0068868_100220440 | 3300005338 | Bacteria | 1588 |
| 14 | Ga0068868_100230998 | 3300005338 | Bacteria | 1552 |
| 15 | Ga0068868_101130455 | 3300005338 | Bacteria | 722 |
| 16 | Ga0070660_100213094 | 3300005339 | Bacteria | 1569 |
| 17 | Ga0070689_100037490 | 3300005340 | Bacteria | 3706 |
| 18 | Ga0070689_101152026 | 3300005340 | Bacteria | 695 |
| 19 | Ga0070691_10120011 | 3300005341 | Bacteria | 1323 |
| 20 | Ga0070691_10123398 | 3300005341 | Bacteria | 1306 |
| 21 | Ga0070687_100188326 | 3300005343 | Unclassified | 1241 |
| 22 | Ga0070661_100197565 | 3300005344 | Bacteria | 1536 |
| 23 | Ga0070692_10012592 | 3300005345 | Bacteria | 3920 |
| 24 | Ga0070692_10270976 | 3300005345 | Bacteria | 1025 |
| 25 | Ga0070668_100102089 | 3300005347 | Unclassified | 2274 |
| 26 | Ga0070668_100224078 | 3300005347 | Bacteria | 1552 |
| 27 | Ga0070668_100826879 | 3300005347 | Bacteria | 824 |
| 28 | Ga0070668_101212462 | 3300005347 | Bacteria | 684 |
| 29 | Ga0070669_100016773 | 3300005353 | Bacteria | 5227 |
| 30 | Ga0070669_100319632 | 3300005353 | Bacteria | 1253 |
| 31 | Ga0070675_100013259 | 3300005354 | Bacteria | 6477 |
| 32 | Ga0070675_100855712 | 3300005354 | Bacteria | 832 |
| 33 | Ga0070671_100582137 | 3300005355 | Bacteria | 967 |
| 34 | Ga0070674_100038948 | 3300005356 | Bacteria | 3207 |
| 35 | Ga0070674_100462924 | 3300005356 | Bacteria | 1049 |
| 36 | Ga0070673_100231631 | 3300005364 | Bacteria | 1602 |
| 37 | Ga0070659_100843351 | 3300005366 | Bacteria | 798 |
| 38 | Ga0070714_101172012 | 3300005435 | Unclassified | 749 |
| 39 | Ga0070701_10023624 | 3300005438 | Unclassified | 2964 |
| 40 | Ga0070701_10436690 | 3300005438 | Bacteria | 837 |
| 41 | Ga0070705_100034043 | 3300005440 | Bacteria | 2845 |
| 42 | Ga0070705_100076960 | 3300005440 | Bacteria | 2036 |
| 43 | Ga0070705_100178886 | 3300005440 | Bacteria | 1435 |
| 44 | Ga0070705_100246413 | 3300005440 | Bacteria | 1252 |
| 45 | Ga0070705_100495666 | 3300005440 | Bacteria | 926 |
| 46 | Ga0070700_100061043 | 3300005441 | Bacteria | 2377 |
| 47 | Ga0070700_100146502 | 3300005441 | Bacteria | 1610 |
| 48 | Ga0070700_100212175 | 3300005441 | Bacteria | 1367 |
| 49 | Ga0070700_100242695 | 3300005441 | Bacteria | 1288 |
| 50 | Ga0070694_100109660 | 3300005444 | Bacteria | 1965 |
| 51 | Ga0070694_100476323 | 3300005444 | Bacteria | 990 |
| 52 | Ga0070694_100500502 | 3300005444 | Bacteria | 967 |
| 53 | Ga0070708_100029319 | 3300005445 | Bacteria | 4744 |
| 54 | Ga0070708_100030313 | 3300005445 | Bacteria | 4675 |
| 55 | Ga0070708_100458916 | 3300005445 | Bacteria | 1202 |
| 56 | Ga0070708_101879294 | 3300005445 | Bacteria | 555 |
| 57 | Ga0070678_100155180 | 3300005456 | Bacteria | 1848 |
| 58 | Ga0070678_101938210 | 3300005456 | Bacteria | 557 |
| 59 | Ga0070662_100262510 | 3300005457 | Bacteria | 1392 |
| 60 | Ga0070681_11075180 | 3300005458 | Unclassified | 725 |
| 61 | Ga0068867_100236391 | 3300005459 | Bacteria | 1479 |
| 62 | Ga0070706_100005018 | 3300005467 | Bacteria | 12654 |
| 63 | Ga0070706_100047843 | 3300005467 | Bacteria | 3947 |
| 64 | Ga0070706_100553818 | 3300005467 | Bacteria | 1070 |
| 65 | Ga0070707_100006720 | 3300005468 | Bacteria | 10659 |
| 66 | Ga0070707_100011522 | 3300005468 | Bacteria | 8244 |
| 67 | Ga0070707_100064043 | 3300005468 | Bacteria | 3529 |
| 68 | Ga0070707_100328616 | 3300005468 | Bacteria | 1486 |
| 69 | Ga0070698_100003028 | 3300005471 | Bacteria | 18521 |
| 70 | Ga0070698_100011233 | 3300005471 | Bacteria | 9511 |
| 71 | Ga0070698_100071030 | 3300005471 | Bacteria | 3492 |
| 72 | Ga0070698_100303809 | 3300005471 | Bacteria | 1526 |
| 73 | Ga0070698_101710385 | 3300005471 | Bacteria | 581 |
| 74 | Ga0070699_100009488 | 3300005518 | Bacteria | 8427 |
| 75 | Ga0070699_100470666 | 3300005518 | Bacteria | 1140 |
| 76 | Ga0070699_100940783 | 3300005518 | Bacteria | 792 |
| 77 | Ga0070699_101196585 | 3300005518 | Bacteria | 697 |
| 78 | Ga0070679_100483867 | 3300005530 | Bacteria | 1182 |
| 79 | Ga0070684_101453023 | 3300005535 | Bacteria | 646 |
| 80 | Ga0070697_100018732 | 3300005536 | Bacteria | 5462 |
| 81 | Ga0070697_100021089 | 3300005536 | Bacteria | 5160 |
| 82 | Ga0070697_100093146 | 3300005536 | Bacteria | 2494 |
| 83 | Ga0070697_100105447 | 3300005536 | Bacteria | 2345 |
| 84 | Ga0070697_100930605 | 3300005536 | Bacteria | 772 |
| 85 | Ga0070697_101465874 | 3300005536 | Bacteria | 610 |
| 86 | Ga0068853_100635447 | 3300005539 | Bacteria | 1015 |
| 87 | Ga0070686_100051300 | 3300005544 | Bacteria | 2625 |
| 88 | Ga0070686_100138261 | 3300005544 | Bacteria | 1693 |
| 89 | Ga0070686_100245029 | 3300005544 | Bacteria | 1307 |
| 90 | Ga0070686_101178098 | 3300005544 | Bacteria | 636 |
| 91 | Ga0070695_100043376 | 3300005545 | Bacteria | 2860 |
| 92 | Ga0070695_100370184 | 3300005545 | Bacteria | 1079 |
| 93 | Ga0070695_100476566 | 3300005545 | Bacteria | 961 |
| 94 | Ga0070696_100005146 | 3300005546 | Bacteria | 8742 |
| 95 | Ga0070696_100101674 | 3300005546 | Bacteria | 2060 |
| 96 | Ga0070696_100335096 | 3300005546 | Bacteria | 1168 |
| 97 | Ga0070696_101022048 | 3300005546 | Bacteria | 691 |
| 98 | Ga0070693_100059608 | 3300005547 | Bacteria | 2213 |
| 99 | Ga0070693_100873944 | 3300005547 | Bacteria | 672 |
| 100 | Ga0070693_100881419 | 3300005547 | Bacteria | 669 |
| 101 | Ga0070704_100054595 | 3300005549 | Bacteria | 2828 |
| 102 | Ga0068855_100585401 | 3300005563 | Bacteria | 1205 |
| 103 | Ga0070664_101121284 | 3300005564 | Bacteria | 741 |
| 104 | Ga0068857_100085746 | 3300005577 | Bacteria | 2815 |
| 105 | Ga0068857_100195777 | 3300005577 | Bacteria | 1841 |
| 106 | Ga0068857_100405852 | 3300005577 | Unclassified | 1268 |
| 107 | Ga0068854_100079223 | 3300005578 | Bacteria | 2422 |
| 108 | Ga0068854_100211304 | 3300005578 | Bacteria | 1530 |
| 109 | Ga0068854_100307982 | 3300005578 | Bacteria | 1284 |
| 110 | Ga0070702_100038924 | 3300005615 | Bacteria | 2651 |
| 111 | Ga0070702_100084196 | 3300005615 | Bacteria | 1912 |
| 112 | Ga0068852_100258049 | 3300005616 | Bacteria | 1672 |
| 113 | Ga0068859_100267721 | 3300005617 | Bacteria | 1801 |
| 114 | Ga0068859_100485362 | 3300005617 | Bacteria | 1331 |
| 115 | Ga0068864_100034436 | 3300005618 | Bacteria | 4308 |
| 116 | Ga0068866_10053756 | 3300005718 | Bacteria | 2060 |
| 117 | Ga0068866_10491641 | 3300005718 | Bacteria | 810 |
| 118 | Ga0068861_100316862 | 3300005719 | Bacteria | 1357 |
| 119 | Ga0068861_101580160 | 3300005719 | Bacteria | 646 |
| 120 | Ga0068870_10118048 | 3300005840 | Bacteria | 1524 |
| 121 | Ga0068870_10167404 | 3300005840 | Bacteria | 1309 |
| 122 | Ga0068870_10172368 | 3300005840 | Bacteria | 1292 |
| 123 | Ga0068858_100526779 | 3300005842 | Bacteria | 1143 |
| 124 | Ga0068860_100083011 | 3300005843 | Bacteria | 3047 |
| 125 | Ga0068862_100130184 | 3300005844 | Bacteria | 2225 |
| 126 | Ga0068862_100141175 | 3300005844 | Bacteria | 2138 |
| 127 | Ga0068862_100228015 | 3300005844 | Bacteria | 1689 |
| 128 | Ga0081455_10357646 | 3300005937 | Bacteria | 1028 |
| 129 | Ga0070712_100511237 | 3300006175 | Bacteria | 1008 |
| 130 | Ga0097621_100225314 | 3300006237 | Bacteria | 1635 |
| 131 | Ga0068871_100832165 | 3300006358 | Unclassified | 852 |
| 132 | Ga0075428_100867293 | 3300006844 | Bacteria | 958 |
| 133 | Ga0075431_100217820 | 3300006847 | Bacteria | 1948 |
| 134 | Ga0075433_11336032 | 3300006852 | Bacteria | 621 |
| 135 | Ga0075434_100223052 | 3300006871 | Bacteria | 1905 |
| 136 | Ga0075434_100287007 | 3300006871 | Bacteria | 1665 |
| 137 | Ga0075434_100412327 | 3300006871 | Bacteria | 1372 |
| 138 | Ga0068865_100064837 | 3300006881 | Bacteria | 2572 |
| 139 | Ga0068865_100118074 | 3300006881 | Bacteria | 1967 |
| 140 | Ga0075436_100314098 | 3300006914 | Bacteria | 1125 |
| 141 | Ga0075436_100756326 | 3300006914 | Bacteria | 722 |
| 142 | Ga0097620_100267728 | 3300006931 | Bacteria | 1801 |
| 143 | Ga0097620_100485312 | 3300006931 | Bacteria | 1331 |
| 144 | Ga0075435_100049453 | 3300007076 | Bacteria | 3382 |
| 145 | Ga0111539_10040579 | 3300009094 | Bacteria | 5601 |
| 146 | Ga0111539_10176858 | 3300009094 | Bacteria | 2493 |
| 147 | Ga0111539_10215328 | 3300009094 | Bacteria | 2238 |
| 148 | Ga0111539_10666138 | 3300009094 | Bacteria | 1212 |
| 149 | Ga0111539_10950171 | 3300009094 | Bacteria | 999 |
| 150 | Ga0105245_10016155 | 3300009098 | Bacteria | 6505 |
| 151 | Ga0105245_10063385 | 3300009098 | Bacteria | 3337 |
| 152 | Ga0105245_10189985 | 3300009098 | Bacteria | 1967 |
| 153 | Ga0114129_10260085 | 3300009147 | Bacteria | 2327 |
| 154 | Ga0114129_10376129 | 3300009147 | Bacteria | 1877 |
| 155 | Ga0114129_10488095 | 3300009147 | Bacteria | 1611 |
| 156 | Ga0114129_11124739 | 3300009147 | Bacteria | 982 |
| 157 | Ga0114129_11983200 | 3300009147 | Bacteria | 704 |
| 158 | Ga0105243_10021952 | 3300009148 | Bacteria | 4848 |
| 159 | Ga0105243_10052898 | 3300009148 | Bacteria | 3218 |
| 160 | Ga0105243_10463787 | 3300009148 | Bacteria | 1192 |
| 161 | Ga0105243_11115908 | 3300009148 | Bacteria | 798 |
| 162 | Ga0105243_11211641 | 3300009148 | Bacteria | 768 |
| 163 | Ga0105241_10747713 | 3300009174 | Bacteria | 896 |
| 164 | Ga0105242_10031514 | 3300009176 | Bacteria | 4236 |
| 165 | Ga0105242_10141908 | 3300009176 | Bacteria | 2085 |
| 166 | Ga0105242_11042471 | 3300009176 | Bacteria | 828 |
| 167 | Ga0105242_11680178 | 3300009176 | Bacteria | 671 |
| 168 | Ga0105242_11727077 | 3300009176 | Bacteria | 663 |
| 169 | Ga0105248_10242749 | 3300009177 | Bacteria | 2028 |
| 170 | Ga0105248_11176222 | 3300009177 | Bacteria | 867 |
| 171 | Ga0105238_10093432 | 3300009551 | Bacteria | 2996 |
| 172 | Ga0105249_10175104 | 3300009553 | Bacteria | 2083 |
| 173 | Ga0105249_10320768 | 3300009553 | Bacteria | 1560 |
| 174 | Ga0105249_10701692 | 3300009553 | Bacteria | 1072 |
| 175 | Ga0105249_10866895 | 3300009553 | Bacteria | 969 |
| 176 | Ga0105249_11833816 | 3300009553 | Bacteria | 679 |
| 177 | Ga0105239_10381642 | 3300010375 | Bacteria | 1593 |
| 178 | Ga0105239_10445367 | 3300010375 | Bacteria | 1469 |
| 179 | Ga0105239_11349683 | 3300010375 | Bacteria | 823 |
| 180 | Ga0105246_10175913 | 3300011119 | Bacteria | 1643 |
| 181 | Ga0105246_10211192 | 3300011119 | Bacteria | 1515 |
| 182 | Ga0157371_10915854 | 3300013102 | Bacteria | 665 |
| 183 | Ga0157374_11878538 | 3300013296 | Bacteria | 625 |
| 184 | Ga0157378_10003032 | 3300013297 | Bacteria | 14929 |
| 185 | Ga0157378_10024428 | 3300013297 | Bacteria | 5318 |
| 186 | Ga0157378_10307421 | 3300013297 | Bacteria | 1536 |
| 187 | Ga0157378_10434883 | 3300013297 | Unclassified | 1299 |
| 188 | Ga0157372_10883564 | 3300013307 | Bacteria | 1037 |
| 189 | Ga0157375_10151635 | 3300013308 | Bacteria | 2454 |
| 190 | Ga0157375_10313520 | 3300013308 | Bacteria | 1733 |
| 191 | Ga0157375_12144122 | 3300013308 | Bacteria | 665 |
| 192 | Ga0163163_10105205 | 3300014325 | Bacteria | 2848 |
| 193 | Ga0157380_10148624 | 3300014326 | Bacteria | 2022 |
| 194 | Ga0157380_10248278 | 3300014326 | Bacteria | 1609 |
| 195 | Ga0157380_12551356 | 3300014326 | Bacteria | 577 |
| 196 | Ga0182008_10521155 | 3300014497 | Bacteria | 656 |
| 197 | Ga0157377_10042535 | 3300014745 | Bacteria | 2523 |
| 198 | Ga0157379_10057781 | 3300014968 | Bacteria | 3467 |
| 199 | Ga0157379_10477344 | 3300014968 | Bacteria | 1154 |
| 200 | Ga0157379_11070740 | 3300014968 | Bacteria | 771 |
| 201 | Ga0157376_10177650 | 3300014969 | Bacteria | 1943 |
| 202 | Ga0207642_10032317 | 3300025899 | Bacteria | 2202 |
| 203 | Ga0207688_10115639 | 3300025901 | Bacteria | 1561 |
| 204 | Ga0207688_10259718 | 3300025901 | Bacteria | 1054 |
| 205 | Ga0207647_10389793 | 3300025904 | Unclassified | 786 |
| 206 | Ga0207645_10045596 | 3300025907 | Bacteria | 2801 |
| 207 | Ga0207645_10077240 | 3300025907 | Bacteria | 2133 |
| 208 | Ga0207643_10067417 | 3300025908 | Bacteria | 2054 |
| 209 | Ga0207643_10491262 | 3300025908 | Bacteria | 784 |
| 210 | Ga0207684_10017135 | 3300025910 | Bacteria | 6218 |
| 211 | Ga0207684_10058459 | 3300025910 | Bacteria | 3272 |
| 212 | Ga0207660_10000002 | 3300025917 | Bacteria | 883566 |
| 213 | Ga0207660_10377251 | 3300025917 | Bacteria | 1139 |
| 214 | Ga0207660_10737097 | 3300025917 | Bacteria | 804 |
| 215 | Ga0207660_11057548 | 3300025917 | Bacteria | 662 |
| 216 | Ga0207662_10008434 | 3300025918 | Bacteria | 5640 |
| 217 | Ga0207662_10025525 | 3300025918 | Bacteria | 3403 |
| 218 | Ga0207662_10381392 | 3300025918 | Bacteria | 952 |
| 219 | Ga0207657_10300253 | 3300025919 | Bacteria | 1272 |
| 220 | Ga0207649_10374254 | 3300025920 | Unclassified | 1060 |
| 221 | Ga0207646_10141769 | 3300025922 | Bacteria | 2165 |
| 222 | Ga0207646_10231031 | 3300025922 | Unclassified | 1671 |
| 223 | Ga0207646_10237906 | 3300025922 | Bacteria | 1645 |
| 224 | Ga0207646_10388851 | 3300025922 | Bacteria | 1260 |
| 225 | Ga0207681_10023657 | 3300025923 | Bacteria | 3933 |
| 226 | Ga0207650_10115980 | 3300025925 | Bacteria | 2079 |
| 227 | Ga0207650_10348816 | 3300025925 | Bacteria | 1217 |
| 228 | Ga0207659_10131662 | 3300025926 | Bacteria | 1931 |
| 229 | Ga0207687_10053169 | 3300025927 | Bacteria | 2828 |
| 230 | Ga0207687_10072848 | 3300025927 | Bacteria | 2458 |
| 231 | Ga0207687_11348594 | 3300025927 | Bacteria | 613 |
| 232 | Ga0207664_11351570 | 3300025929 | Unclassified | 633 |
| 233 | Ga0207690_10077228 | 3300025932 | Bacteria | 2314 |
| 234 | Ga0207706_10049698 | 3300025933 | Bacteria | 3705 |
| 235 | Ga0207706_10117031 | 3300025933 | Bacteria | 2344 |
| 236 | Ga0207706_10207558 | 3300025933 | Bacteria | 1717 |
| 237 | Ga0207686_10615321 | 3300025934 | Bacteria | 856 |
| 238 | Ga0207709_10029558 | 3300025935 | Bacteria | 3180 |
| 239 | Ga0207709_10300355 | 3300025935 | Bacteria | 1193 |
| 240 | Ga0207709_10433971 | 3300025935 | Bacteria | 1012 |
| 241 | Ga0207709_10670865 | 3300025935 | Bacteria | 827 |
| 242 | Ga0207670_10323127 | 3300025936 | Bacteria | 1215 |
| 243 | Ga0207669_10007889 | 3300025937 | Bacteria | 4962 |
| 244 | Ga0207669_10012039 | 3300025937 | Bacteria | 4237 |
| 245 | Ga0207669_11561848 | 3300025937 | Bacteria | 563 |
| 246 | Ga0207704_10026976 | 3300025938 | Bacteria | 3159 |
| 247 | Ga0207704_10068329 | 3300025938 | Bacteria | 2239 |
| 248 | Ga0207691_10053258 | 3300025940 | Bacteria | 3695 |
| 249 | Ga0207691_10373837 | 3300025940 | Bacteria | 1217 |
| 250 | Ga0207711_10816570 | 3300025941 | Bacteria | 868 |
| 251 | Ga0207711_11615396 | 3300025941 | Unclassified | 592 |
| 252 | Ga0207689_10036967 | 3300025942 | Bacteria | 4053 |
| 253 | Ga0207689_10063130 | 3300025942 | Bacteria | 3047 |
| 254 | Ga0207689_10265201 | 3300025942 | Bacteria | 1421 |
| 255 | Ga0207661_10312778 | 3300025944 | Bacteria | 1410 |
| 256 | Ga0207679_11421655 | 3300025945 | Bacteria | 636 |
| 257 | Ga0207667_10501174 | 3300025949 | Bacteria | 1232 |
| 258 | Ga0207651_10295496 | 3300025960 | Bacteria | 1345 |
| 259 | Ga0207651_10353110 | 3300025960 | Bacteria | 1239 |
| 260 | Ga0207712_10083803 | 3300025961 | Bacteria | 2328 |
| 261 | Ga0207668_10035673 | 3300025972 | Bacteria | 3314 |
| 262 | Ga0207668_10165812 | 3300025972 | Bacteria | 1727 |
| 263 | Ga0207640_10157200 | 3300025981 | Bacteria | 1677 |
| 264 | Ga0207640_10216180 | 3300025981 | Bacteria | 1464 |
| 265 | Ga0207640_10834628 | 3300025981 | Bacteria | 801 |
| 266 | Ga0207640_11408445 | 3300025981 | Bacteria | 625 |
| 267 | Ga0207677_10241468 | 3300026023 | Bacteria | 1462 |
| 268 | Ga0207677_10382496 | 3300026023 | Bacteria | 1188 |
| 269 | Ga0207703_10283885 | 3300026035 | Bacteria | 1504 |
| 270 | Ga0207703_10375552 | 3300026035 | Bacteria | 1314 |
| 271 | Ga0207639_10985834 | 3300026041 | Bacteria | 789 |
| 272 | Ga0207678_11483552 | 3300026067 | Bacteria | 599 |
| 273 | Ga0207708_10091470 | 3300026075 | Bacteria | 2346 |
| 274 | Ga0207708_10128466 | 3300026075 | Bacteria | 1980 |
| 275 | Ga0207708_10292774 | 3300026075 | Bacteria | 1322 |
| 276 | Ga0207708_10452371 | 3300026075 | Bacteria | 1070 |
| 277 | Ga0207708_10533597 | 3300026075 | Bacteria | 987 |
| 278 | Ga0207648_10011867 | 3300026089 | Bacteria | 8188 |
| 279 | Ga0207674_10024303 | 3300026116 | Bacteria | 6478 |
| 280 | Ga0207674_10192470 | 3300026116 | Bacteria | 1989 |
| 281 | Ga0207674_10212681 | 3300026116 | Bacteria | 1882 |
| 282 | Ga0207675_100044545 | 3300026118 | Bacteria | 4147 |
| 283 | Ga0207675_100071553 | 3300026118 | Bacteria | 3243 |
| 284 | Ga0207683_11756630 | 3300026121 | Bacteria | 569 |
| 285 | Ga0207698_10308948 | 3300026142 | Bacteria | 1475 |
| 286 | Ga0209983_1021016 | 3300027665 | Bacteria | 1363 |
| 287 | Ga0209998_10023192 | 3300027717 | Bacteria | 1341 |
| 288 | Ga0209998_10033015 | 3300027717 | Bacteria | 1152 |
| 289 | Ga0209974_10215002 | 3300027876 | Bacteria | 714 |
| 290 | Ga0207428_10051142 | 3300027907 | Bacteria | 3303 |
| 291 | Ga0207428_10119707 | 3300027907 | Bacteria | 2020 |
| 292 | Ga0268266_10230517 | 3300028379 | Bacteria | 1706 |
| 293 | Ga0268265_10771492 | 3300028380 | Bacteria | 935 |
| 294 | Ga0268264_10472653 | 3300028381 | Bacteria | 1218 |
| 295 | Ga0265326_10025190 | 3300028558 | Bacteria | 1696 |
| 296 | Ga0265319_1002616 | 3300028563 | Bacteria | 9700 |
| 297 | Ga0265334_10101765 | 3300028573 | Bacteria | 1039 |
| 298 | Ga0265334_10162197 | 3300028573 | Bacteria | 785 |
| 299 | Ga0265318_10015272 | 3300028577 | Bacteria | 3199 |
| 300 | Ga0265318_10020174 | 3300028577 | Bacteria | 2692 |
| 301 | Ga0265318_10038176 | 3300028577 | Bacteria | 1837 |
| 302 | Ga0265318_10149004 | 3300028577 | Bacteria | 858 |
| 303 | Ga0265322_10011152 | 3300028654 | Bacteria | 2607 |
| 304 | Ga0265322_10025135 | 3300028654 | Bacteria | 1703 |
| 305 | Ga0265336_10010948 | 3300028666 | Bacteria | 3092 |
| 306 | Ga0265336_10117665 | 3300028666 | Bacteria | 791 |
| 307 | Ga0265338_10075958 | 3300028800 | Bacteria | 2848 |
| 308 | Ga0265338_10699813 | 3300028800 | Bacteria | 699 |
| 309 | Ga0265338_10967764 | 3300028800 | Bacteria | 577 |
| 310 | Ga0265324_10008203 | 3300029957 | Bacteria | 4168 |
| 311 | Ga0265324_10014166 | 3300029957 | Bacteria | 2957 |
| 312 | Ga0265330_10024642 | 3300031235 | Bacteria | 2729 |
| 313 | Ga0265330_10068322 | 3300031235 | Bacteria | 1539 |
| 314 | Ga0265328_10045638 | 3300031239 | Bacteria | 1611 |
| 315 | Ga0265320_10001226 | 3300031240 | Bacteria | 18848 |
| 316 | Ga0265320_10009070 | 3300031240 | Bacteria | 6032 |
| 317 | Ga0265320_10039466 | 3300031240 | Bacteria | 2361 |
| 318 | Ga0265325_10017224 | 3300031241 | Bacteria | 4018 |
| 319 | Ga0265325_10021027 | 3300031241 | Bacteria | 3591 |
| 320 | Ga0265325_10064891 | 3300031241 | Bacteria | 1845 |
| 321 | Ga0265325_10337454 | 3300031241 | Bacteria | 667 |
| 322 | Ga0265329_10004843 | 3300031242 | Bacteria | 5527 |
| 323 | Ga0265329_10007411 | 3300031242 | Bacteria | 4248 |
| 324 | Ga0265329_10022566 | 3300031242 | Bacteria | 2104 |
| 325 | Ga0265329_10299750 | 3300031242 | Bacteria | 543 |
| 326 | Ga0265340_10004346 | 3300031247 | Bacteria | 7939 |
| 327 | Ga0265339_10010068 | 3300031249 | Bacteria | 5892 |
| 328 | Ga0265339_10190920 | 3300031249 | Bacteria | 1015 |
| 329 | Ga0265327_10130370 | 3300031251 | Bacteria | 1184 |
| 330 | Ga0265316_10052534 | 3300031344 | Bacteria | 3196 |
| 331 | Ga0265316_10055834 | 3300031344 | Bacteria | 3087 |
| 332 | Ga0265316_10144264 | 3300031344 | Bacteria | 1786 |
| 333 | Ga0307408_100185473 | 3300031548 | Bacteria | 1672 |
| 334 | Ga0265313_10032782 | 3300031595 | Bacteria | 2647 |
| 335 | Ga0265313_10035007 | 3300031595 | Bacteria | 2533 |
| 336 | Ga0265314_10002544 | 3300031711 | Bacteria | 18542 |
| 337 | Ga0265314_10198205 | 3300031711 | Bacteria | 1189 |
| 338 | Ga0265342_10004323 | 3300031712 | Bacteria | 11242 |
| 339 | Ga0316576_10078218 | 3300031727 | Bacteria | 2451 |
| 340 | Ga0316576_10615296 | 3300031727 | Bacteria | 792 |
| 341 | Ga0307405_11056533 | 3300031731 | Bacteria | 696 |
| 342 | Ga0316577_10036067 | 3300031733 | Bacteria | 2764 |
| 343 | Ga0307410_10578661 | 3300031852 | Bacteria | 934 |
| 344 | Ga0307407_10255084 | 3300031903 | Bacteria | 1204 |
| 345 | Ga0307407_10409024 | 3300031903 | Unclassified | 975 |
| 346 | Ga0307409_100061092 | 3300031995 | Bacteria | 2943 |
| 347 | Ga0307416_100116570 | 3300032002 | Bacteria | 2368 |
| 348 | Ga0307416_100345429 | 3300032002 | Bacteria | 1503 |
| 349 | Ga0307411_11519720 | 3300032005 | Bacteria | 616 |
| 350 | Ga0307415_100004806 | 3300032126 | Bacteria | 7085 |
| 351 | Ga0316583_10171845 | 3300032133 | Bacteria | 754 |
| 352 | Ga0373932_0030008 | 3300035112 | Bacteria | 1505 |
| 353 | Ga0373962_0086642 | 3300035242 | Bacteria | 959 |
| 354 | Ga0316574_0124590 | 3300035398 | Bacteria | 1655 |
| 355 | Ga0373931_0062743 | 3300035691 | Bacteria | 2007 |
| 356 | Ga0373931_0420444 | 3300035691 | Bacteria | 850 |
| 357 | Ga0373937_1417881 | 3300036401 | Bacteria | 642 |
| 358 | Ga0316582_0044485 | 3300036647 | Bacteria | 2791 |
| 359 | Ga0316582_0257041 | 3300036647 | Bacteria | 1197 |
| 360 | Ga0395905_0581528 | 3300037471 | Bacteria | 1021 |
| 361 | Ga0316581_0072732 | 3300037588 | Bacteria | 1056 |
| 362 | Ga0395901_0293125 | 3300038443 | Bacteria | 1688 |
| 363 | Ga0436365_0347259 | 3300039437 | Bacteria | 3323 |
| 364 | Ga0439438_088329 | 3300041405 | Bacteria | 757 |
| 365 | Ga0439466_0054668 | 3300041411 | Bacteria | 1300 |
| 366 | Ga0439466_0116324 | 3300041411 | Bacteria | 827 |
| 367 | Ga0451793_0196950 | 3300041452 | Bacteria | 584 |
| 368 | Ga0451807_1643506 | 3300041486 | Bacteria | 790 |
| 369 | Ga0451841_1279542 | 3300041498 | Bacteria | 707 |
| 370 | Ga0451851_0789716 | 3300041507 | Bacteria | 848 |
| 371 | Ga0451853_0662573 | 3300041512 | Unclassified | 953 |
| 372 | Ga0439441_001582 | 3300042001 | Bacteria | 3025 |
| 373 | Ga0450923_156723 | 3300042125 | Bacteria | 553 |
| 374 | Ga0450923_173881 | 3300042125 | Bacteria | 528 |
| 375 | Ga0450910_004004 | 3300042147 | Bacteria | 1979 |
| 376 | Ga0450910_019691 | 3300042147 | Bacteria | 1015 |
| 377 | Ga0450908_035093 | 3300042184 | Bacteria | 870 |
| 378 | Ga0450909_034182 | 3300042185 | Bacteria | 775 |
| 379 | Ga0451577_1172157 | 3300042876 | Bacteria | 686 |
| 380 | Ga0453683_0192239 | 3300044673 | Bacteria | 1295 |
| 381 | Ga0451576_1006894 | 3300045051 | Bacteria | 873 |
| 382 | Ga0495641_0117312 | 3300046461 | Bacteria | 1187 |
| 383 | Ga0495651_0023352 | 3300046462 | Bacteria | 4808 |
| 384 | Ga0495651_0433057 | 3300046462 | Bacteria | 853 |
| 385 | Ga0495618_0782455 | 3300046514 | Bacteria | 557 |
| 386 | Ga0495630_0132659 | 3300046517 | Bacteria | 1892 |
| 387 | Ga0495640_0373403 | 3300046533 | Bacteria | 878 |
| 388 | Ga0495634_0192317 | 3300046642 | Bacteria | 1272 |
| 389 | Ga0495657_0646914 | 3300046675 | Bacteria | 610 |
| 390 | Ga0495599_0424970 | 3300046678 | Bacteria | 789 |
| 391 | Ga0495624_0643505 | 3300046690 | Bacteria | 631 |
| 392 | Ga0495600_0439443 | 3300046809 | Bacteria | 808 |
| 393 | Ga0495604_0308816 | 3300047317 | Bacteria | 1060 |
| 394 | Ga0495674_0891033 | 3300047319 | Bacteria | 687 |
| 395 | Ga0495675_0404711 | 3300047444 | Bacteria | 795 |
| 396 | Ga0495677_0336143 | 3300047445 | Bacteria | 595 |
| 397 | Ga0495602_0100628 | 3300048088 | Bacteria | 2373 |
| 398 | Ga0495602_0190879 | 3300048088 | Bacteria | 1571 |
| 399 | Ga0496100_1062761 | 3300048903 | Bacteria | 637 |
| 400 | Ga0496100_1623782 | 3300048903 | Unclassified | 511 |
| 401 | Ga0496101_0006551 | 3300048904 | Bacteria | 7500 |
| 402 | Ga0496101_0514735 | 3300048904 | Bacteria | 946 |
| 403 | Ga0496102_0136558 | 3300048905 | Bacteria | 2298 |
| 404 | Ga0496102_0182680 | 3300048905 | Bacteria | 1976 |
| 405 | Ga0496102_0894371 | 3300048905 | Bacteria | 810 |
| 406 | Ga0496102_1742865 | 3300048905 | Bacteria | 540 |
| 407 | Ga0496103_0179915 | 3300048906 | Bacteria | 1359 |
| 408 | Ga0496104_0182135 | 3300048907 | Bacteria | 2011 |
| 409 | Ga0496104_0313586 | 3300048907 | Bacteria | 1481 |
| 410 | Ga0496104_1009341 | 3300048907 | Bacteria | 736 |
| 411 | Ga0496105_0025812 | 3300048908 | Bacteria | 4786 |
| 412 | Ga0496105_0064463 | 3300048908 | Bacteria | 3023 |
| 413 | Ga0496105_0348511 | 3300048908 | Bacteria | 1183 |
| 414 | Ga0496105_0824766 | 3300048908 | Bacteria | 704 |
| 415 | Ga0496106_1454746 | 3300048909 | Bacteria | 528 |
| 416 | Ga0496107_0100929 | 3300048910 | Bacteria | 2116 |
| 417 | Ga0496107_0428827 | 3300048910 | Unclassified | 983 |
| 418 | Ga0496108_0025060 | 3300048911 | Bacteria | 4915 |
| 419 | Ga0496108_0060962 | 3300048911 | Bacteria | 3174 |
| 420 | Ga0496108_0144050 | 3300048911 | Bacteria | 2053 |
| 421 | Ga0496108_0166394 | 3300048911 | Bacteria | 1907 |
| 422 | Ga0496109_0009839 | 3300048912 | Bacteria | 8161 |
| 423 | Ga0496109_0069119 | 3300048912 | Bacteria | 3238 |
| 424 | Ga0496109_0156520 | 3300048912 | Bacteria | 2134 |
| 425 | Ga0496109_0157410 | 3300048912 | Bacteria | 2128 |
| 426 | Ga0496109_0629679 | 3300048912 | Bacteria | 1009 |
| 427 | Ga0496110_0091358 | 3300048913 | Bacteria | 2723 |
| 428 | Ga0496110_0134063 | 3300048913 | Bacteria | 2238 |
| 429 | Ga0496110_0175716 | 3300048913 | Bacteria | 1944 |
| 430 | Ga0496111_0271503 | 3300048914 | Bacteria | 1258 |
| 431 | Ga0496112_0000098 | 3300048915 | Bacteria | 56421 |
| 432 | Ga0496112_0112510 | 3300048915 | Bacteria | 2693 |
| 433 | Ga0496112_0261497 | 3300048915 | Bacteria | 1680 |
| 434 | Ga0496112_0519953 | 3300048915 | Bacteria | 1125 |
| 435 | Ga0496112_0567524 | 3300048915 | Bacteria | 1068 |
| 436 | Ga0496113_0016363 | 3300048916 | Bacteria | 5122 |
| 437 | Ga0496113_0049277 | 3300048916 | Unclassified | 3136 |
| 438 | Ga0496113_0141285 | 3300048916 | Bacteria | 1895 |
| 439 | Ga0496113_0541861 | 3300048916 | Bacteria | 934 |
| 440 | Ga0496114_0005648 | 3300048917 | Bacteria | 9808 |
| 441 | Ga0496114_0649343 | 3300048917 | Bacteria | 928 |
| 442 | Ga0496114_1078640 | 3300048917 | Bacteria | 688 |
| 443 | Ga0496114_1359364 | 3300048917 | Bacteria | 597 |
| 444 | Ga0501031_0012895 | 3300049568 | Bacteria | 5460 |
| 445 | Ga0501031_0112241 | 3300049568 | Bacteria | 1780 |
| 446 | Ga0501031_0123908 | 3300049568 | Bacteria | 1688 |
| 447 | Ga0501031_0793235 | 3300049568 | Bacteria | 607 |
| 448 | Ga0501032_0651644 | 3300049569 | Bacteria | 669 |
| 449 | Ga0501033_0070780 | 3300049570 | Bacteria | 2562 |
| 450 | Ga0501036_0049920 | 3300049572 | Bacteria | 3544 |
| 451 | Ga0501036_0133330 | 3300049572 | Bacteria | 2096 |
| 452 | Ga0501036_0388146 | 3300049572 | Bacteria | 1165 |
| 453 | Ga0501036_0841775 | 3300049572 | Bacteria | 754 |
| 454 | Ga0501036_1231487 | 3300049572 | Bacteria | 609 |
| 455 | Ga0501037_0044880 | 3300049573 | Bacteria | 3245 |
| 456 | Ga0501037_0323223 | 3300049573 | Bacteria | 1068 |
| 457 | Ga0501037_1124276 | 3300049573 | Bacteria | 508 |
| 458 | Ga0501038_0033237 | 3300049574 | Bacteria | 4544 |
| 459 | Ga0501038_0132177 | 3300049574 | Bacteria | 2048 |
| 460 | Ga0501038_0212084 | 3300049574 | Bacteria | 1549 |
| 461 | Ga0501038_0464997 | 3300049574 | Bacteria | 971 |
| 462 | Ga0501038_0881486 | 3300049574 | Bacteria | 661 |
| 463 | Ga0501039_0048851 | 3300049575 | Bacteria | 3271 |
| 464 | Ga0501039_0052113 | 3300049575 | Bacteria | 3166 |
| 465 | Ga0501039_0253543 | 3300049575 | Bacteria | 1383 |
| 466 | Ga0501039_0371126 | 3300049575 | Bacteria | 1124 |
| 467 | Ga0501040_0003818 | 3300049576 | Bacteria | 9774 |
| 468 | Ga0501040_0021971 | 3300049576 | Bacteria | 4266 |
| 469 | Ga0501040_0032384 | 3300049576 | Bacteria | 3537 |
| 470 | Ga0501040_0058738 | 3300049576 | Bacteria | 2642 |
| 471 | Ga0501040_0120915 | 3300049576 | Bacteria | 1837 |
| 472 | Ga0501040_0178934 | 3300049576 | Bacteria | 1503 |
| 473 | Ga0501041_0014508 | 3300049577 | Bacteria | 4680 |
| 474 | Ga0501041_0020238 | 3300049577 | Bacteria | 3976 |
| 475 | Ga0501041_0039211 | 3300049577 | Bacteria | 2875 |
| 476 | Ga0501041_0042474 | 3300049577 | Bacteria | 2763 |
| 477 | Ga0501041_0075737 | 3300049577 | Bacteria | 2070 |
| 478 | Ga0501041_0079735 | 3300049577 | Bacteria | 2015 |
| 479 | Ga0501042_0093254 | 3300049578 | Bacteria | 2162 |
| 480 | Ga0501042_0107737 | 3300049578 | Bacteria | 2006 |
| 481 | Ga0501042_0164726 | 3300049578 | Bacteria | 1599 |
| 482 | Ga0501042_0339815 | 3300049578 | Bacteria | 1085 |
| 483 | Ga0501042_0662065 | 3300049578 | Bacteria | 759 |
| 484 | Ga0501042_0690799 | 3300049578 | Bacteria | 742 |
| 485 | Ga0501043_0023595 | 3300049579 | Bacteria | 4825 |
| 486 | Ga0501043_0270823 | 3300049579 | Bacteria | 1304 |
| 487 | Ga0501046_0068309 | 3300049580 | Bacteria | 2767 |
| 488 | Ga0501046_0076648 | 3300049580 | Bacteria | 2590 |
| 489 | Ga0501046_0330019 | 3300049580 | Bacteria | 1110 |
| 490 | Ga0501047_1104934 | 3300049581 | Bacteria | 606 |
| 491 | Ga0501048_0062362 | 3300049582 | Bacteria | 2638 |
| 492 | Ga0501048_0116204 | 3300049582 | Bacteria | 1890 |
| 493 | Ga0501048_0261926 | 3300049582 | Bacteria | 1228 |
| 494 | Ga0501048_0285276 | 3300049582 | Bacteria | 1174 |
| 495 | Ga0501048_0718455 | 3300049582 | Bacteria | 717 |
| 496 | Ga0501067_0212450 | 3300049583 | Bacteria | 1077 |
| 497 | Ga0501068_0550259 | 3300049584 | Bacteria | 750 |
| 498 | Ga0501068_0557647 | 3300049584 | Bacteria | 745 |
| 499 | Ga0501069_0016906 | 3300049585 | Bacteria | 3920 |
| 500 | Ga0501069_0022459 | 3300049585 | Bacteria | 3432 |
| 501 | Ga0501070_0120823 | 3300049586 | Bacteria | 2165 |
| 502 | Ga0501070_0178885 | 3300049586 | Bacteria | 1746 |
| 503 | Ga0501071_0012113 | 3300049587 | Bacteria | 5833 |
| 504 | Ga0501071_0029835 | 3300049587 | Bacteria | 3852 |
| 505 | Ga0501071_0088916 | 3300049587 | Bacteria | 2266 |
| 506 | Ga0501071_0123344 | 3300049587 | Bacteria | 1921 |
| 507 | Ga0501071_0236032 | 3300049587 | Bacteria | 1378 |
| 508 | Ga0501071_0315794 | 3300049587 | Bacteria | 1186 |
| 509 | Ga0501071_0372121 | 3300049587 | Bacteria | 1089 |
| 510 | Ga0501072_0011361 | 3300049588 | Bacteria | 6805 |
| 511 | Ga0501072_0049781 | 3300049588 | Bacteria | 3298 |
| 512 | Ga0501072_0104541 | 3300049588 | Bacteria | 2251 |
| 513 | Ga0501072_0334369 | 3300049588 | Bacteria | 1203 |
| 514 | Ga0501072_0733308 | 3300049588 | Bacteria | 776 |
| 515 | Ga0501073_0044364 | 3300049589 | Bacteria | 3134 |
| 516 | Ga0501073_0701719 | 3300049589 | Bacteria | 698 |
| 517 | Ga0501074_0034551 | 3300049590 | Bacteria | 3664 |
| 518 | Ga0501074_0161060 | 3300049590 | Bacteria | 1603 |
| 519 | Ga0501074_0298494 | 3300049590 | Bacteria | 1144 |
| 520 | Ga0501075_0007785 | 3300049591 | Bacteria | 7438 |
| 521 | Ga0501075_0009521 | 3300049591 | Bacteria | 6799 |
| 522 | Ga0501075_0037370 | 3300049591 | Bacteria | 3627 |
| 523 | Ga0501075_0047359 | 3300049591 | Bacteria | 3231 |
| 524 | Ga0501075_0187626 | 3300049591 | Bacteria | 1577 |
| 525 | Ga0501075_0417107 | 3300049591 | Bacteria | 1024 |
| 526 | Ga0501075_0649592 | 3300049591 | Bacteria | 804 |
| 527 | Ga0501075_0955425 | 3300049591 | Unclassified | 651 |
| 528 | Ga0501075_1239405 | 3300049591 | Bacteria | 566 |
| 529 | Ga0501076_0071511 | 3300049592 | Bacteria | 2775 |
| 530 | Ga0501076_0153849 | 3300049592 | Bacteria | 1871 |
| 531 | Ga0501076_0185167 | 3300049592 | Bacteria | 1698 |
| 532 | Ga0501076_0214259 | 3300049592 | Bacteria | 1574 |
| 533 | Ga0501076_0288909 | 3300049592 | Bacteria | 1343 |
| 534 | Ga0501076_1048380 | 3300049592 | Bacteria | 672 |
| 535 | Ga0501077_0012888 | 3300049593 | Bacteria | 5237 |
| 536 | Ga0501077_0025972 | 3300049593 | Bacteria | 3715 |
| 537 | Ga0501077_0032309 | 3300049593 | Bacteria | 3332 |
| 538 | Ga0501077_0034977 | 3300049593 | Bacteria | 3198 |
| 539 | Ga0501079_0032539 | 3300049741 | Bacteria | 4010 |
| 540 | Ga0501079_0037474 | 3300049741 | Bacteria | 3737 |
| 541 | Ga0501079_0054487 | 3300049741 | Bacteria | 3084 |
| 542 | Ga0501079_0103590 | 3300049741 | Bacteria | 2207 |
| 543 | Ga0501079_0103887 | 3300049741 | Bacteria | 2204 |
| 544 | Ga0501079_0131802 | 3300049741 | Bacteria | 1945 |
| 545 | Ga0501080_0029655 | 3300049742 | Bacteria | 5092 |
| 546 | Ga0501080_0034338 | 3300049742 | Bacteria | 4734 |
| 547 | Ga0501080_0101670 | 3300049742 | Bacteria | 2667 |
| 548 | Ga0501080_1013706 | 3300049742 | Bacteria | 720 |
| 549 | Ga0501081_0024997 | 3300049743 | Bacteria | 4015 |
| 550 | Ga0501081_0084743 | 3300049743 | Bacteria | 2223 |
| 551 | Ga0501081_0096676 | 3300049743 | Bacteria | 2083 |
| 552 | Ga0501081_0242711 | 3300049743 | Bacteria | 1314 |
| 553 | Ga0501081_0625964 | 3300049743 | Bacteria | 806 |
| 554 | Ga0501083_0112226 | 3300049744 | Bacteria | 1791 |
| 555 | Ga0501035_0089541 | 3300049822 | Bacteria | 2710 |
| 556 | Ga0501035_0217364 | 3300049822 | Bacteria | 1633 |
| 557 | Ga0501044_0318432 | 3300049823 | Bacteria | 1480 |
| 558 | Ga0501045_0005760 | 3300049824 | Bacteria | 8573 |
| 559 | Ga0501045_0014739 | 3300049824 | Bacteria | 5542 |
| 560 | Ga0501045_0051355 | 3300049824 | Bacteria | 3009 |
| 561 | Ga0501045_0064976 | 3300049824 | Bacteria | 2679 |
| 562 | Ga0501045_0118173 | 3300049824 | Bacteria | 1967 |
| 563 | Ga0501045_0143371 | 3300049824 | Bacteria | 1777 |
| 564 | Ga0501045_0206460 | 3300049824 | Bacteria | 1464 |
| 565 | nmdc:mga0yw44_207652_c1 | 3300050492 | Bacteria | 1295 |
| 566 | nmdc:mga05p37_291185_c1 | 3300050507 | Bacteria | 1943 |
| 567 | nmdc:mga05p37_342691_c1 | 3300050507 | Bacteria | 1762 |
| 568 | nmdc:mga05p37_824661_c1 | 3300050507 | Bacteria | 1011 |
| 569 | nmdc:mga06r32_119337_c1 | 3300050510 | Bacteria | 2600 |
| 570 | nmdc:mga08y16_1148637_c1 | 3300050511 | Bacteria | 749 |
| 571 | nmdc:mga08y16_181149_c1 | 3300050511 | Bacteria | 2188 |
| 572 | nmdc:mga08y16_94926_c1 | 3300050511 | Bacteria | 3107 |
| 573 | nmdc:mga0n895_189236_c1 | 3300050512 | Bacteria | 2089 |
| 574 | nmdc:mga0n895_317692_c1 | 3300050512 | Bacteria | 1578 |
| 575 | nmdc:mga0rr50_110431_c1 | 3300050513 | Bacteria | 2175 |
| 576 | nmdc:mga0rr50_59636_c1 | 3300050513 | Bacteria | 2866 |
| 577 | nmdc:mga08x19_1021961_c1 | 3300050514 | Bacteria | 587 |
| 578 | nmdc:mga08x19_328459_c1 | 3300050514 | Bacteria | 1065 |
| 579 | nmdc:mga0a205_1182214_c1 | 3300050515 | Bacteria | 612 |
| 580 | nmdc:mga0a205_156715_c1 | 3300050515 | Bacteria | 2175 |
| 581 | nmdc:mga0a205_63714_c1 | 3300050515 | Bacteria | 3561 |
| 582 | Ga0495601_0355096 | 3300053077 | Bacteria | 953 |
| 583 | Ga0495612_0351531 | 3300053078 | Bacteria | 666 |
| 584 | Ga0495595_0403847 | 3300053084 | Bacteria | 692 |
| 585 | Ga0501084_0016480 | 3300054114 | Bacteria | 6136 |
| 586 | Ga0501084_0079234 | 3300054114 | Bacteria | 2753 |
| 587 | Ga0501084_0119763 | 3300054114 | Bacteria | 2213 |
| 588 | Ga0501084_0128484 | 3300054114 | Bacteria | 2133 |
| 589 | Ga0501084_0373527 | 3300054114 | Bacteria | 1205 |
| 590 | Ga0501084_0695825 | 3300054114 | Bacteria | 857 |
| 591 | Ga0501084_1079535 | 3300054114 | Bacteria | 674 |
| 592 | Ga0501082_0046235 | 3300060353 | Bacteria | 3752 |
| 593 | Ga0501082_0048928 | 3300060353 | Bacteria | 3645 |
| 594 | Ga0501082_0053683 | 3300060353 | Bacteria | 3473 |
| 595 | Ga0501082_0179399 | 3300060353 | Bacteria | 1842 |
| 596 | Ga0501082_0224053 | 3300060353 | Bacteria | 1636 |
| 597 | Ga0501082_0301863 | 3300060353 | Bacteria | 1394 |
| 598 | Ga0501082_1612989 | 3300060353 | Bacteria | 566 |
| 599 | Ga0530510_0002811 | 3300061734 | Bacteria | 11973 |
| 600 | Ga0530510_0010156 | 3300061734 | Bacteria | 6599 |
| 601 | Ga0530510_0026774 | 3300061734 | Bacteria | 4130 |
| 602 | Ga0530510_0060038 | 3300061734 | Bacteria | 2751 |
| 603 | Ga0530510_0177881 | 3300061734 | Bacteria | 1577 |
| 604 | Ga0530510_0217593 | 3300061734 | Bacteria | 1419 |
| 605 | Ga0530510_0399575 | 3300061734 | Unclassified | 1036 |
| 606 | Ga0530510_0411435 | 3300061734 | Bacteria | 1020 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042125 | Ga0450923_156723 | Ga0450923_156723_121_540 | 135 |
| 2 | 3300035691 | Ga0373931_0062743 | Ga0373931_0062743_1580_1996 | 138 |
| 3 | 3300046462 | Ga0495651_0023352 | Ga0495651_0023352_2688_3128 | 138 |
| 4 | 3300046675 | Ga0495657_0646914 | Ga0495657_0646914_37_477 | 138 |
| 5 | 3300047444 | Ga0495675_0404711 | Ga0495675_0404711_212_652 | 138 |
| 6 | 3300048088 | Ga0495602_0190879 | Ga0495602_0190879_263_703 | 138 |
| 7 | 3300049572 | Ga0501036_1231487 | Ga0501036_1231487_21_446 | 139 |
| 8 | 3300049591 | Ga0501075_1239405 | Ga0501075_1239405_70_495 | 139 |
| 9 | 3300049592 | Ga0501076_1048380 | Ga0501076_1048380_188_613 | 139 |
| 10 | 3300025981 | Ga0207640_10834628 | Ga0207640_108346282 | 141 |
| 11 | 3300028577 | Ga0265318_10149004 | Ga0265318_101490042 | 141 |
| 12 | 3300029957 | Ga0265324_10014166 | Ga0265324_100141663 | 141 |
| 13 | 3300031240 | Ga0265320_10001226 | Ga0265320_1000122618 | 141 |
| 14 | 3300031241 | Ga0265325_10021027 | Ga0265325_100210274 | 141 |
| 15 | 3300031242 | Ga0265329_10004843 | Ga0265329_100048432 | 141 |
| 16 | 3300031595 | Ga0265313_10032782 | Ga0265313_100327821 | 141 |
| 17 | 3300031852 | Ga0307410_10578661 | Ga0307410_105786612 | 141 |
| 18 | 3300005331 | Ga0070670_100749214 | Ga0070670_1007492142 | 143 |
| 19 | 3300005334 | Ga0068869_100123624 | Ga0068869_1001236242 | 143 |
| 20 | 3300005337 | Ga0070682_100320174 | Ga0070682_1003201741 | 143 |
| 21 | 3300005337 | Ga0070682_100887105 | Ga0070682_1008871051 | 143 |
| 22 | 3300005338 | Ga0068868_100230998 | Ga0068868_1002309982 | 143 |
| 23 | 3300005338 | Ga0068868_101130455 | Ga0068868_1011304552 | 143 |
| 24 | 3300005347 | Ga0070668_100224078 | Ga0070668_1002240782 | 143 |
| 25 | 3300005355 | Ga0070671_100582137 | Ga0070671_1005821372 | 143 |
| 26 | 3300005440 | Ga0070705_100034043 | Ga0070705_1000340433 | 143 |
| 27 | 3300005444 | Ga0070694_100500502 | Ga0070694_1005005021 | 143 |
| 28 | 3300005457 | Ga0070662_100262510 | Ga0070662_1002625103 | 143 |
| 29 | 3300005468 | Ga0070707_100011522 | Ga0070707_1000115225 | 143 |
| 30 | 3300005471 | Ga0070698_100003028 | Ga0070698_10000302812 | 143 |
| 31 | 3300005471 | Ga0070698_100071030 | Ga0070698_1000710302 | 143 |
| 32 | 3300005471 | Ga0070698_101710385 | Ga0070698_1017103851 | 143 |
| 33 | 3300005518 | Ga0070699_100009488 | Ga0070699_1000094882 | 143 |
| 34 | 3300005536 | Ga0070697_100021089 | Ga0070697_1000210898 | 143 |
| 35 | 3300005536 | Ga0070697_101465874 | Ga0070697_1014658741 | 143 |
| 36 | 3300005539 | Ga0068853_100635447 | Ga0068853_1006354473 | 143 |
| 37 | 3300005544 | Ga0070686_101178098 | Ga0070686_1011780982 | 143 |
| 38 | 3300005545 | Ga0070695_100476566 | Ga0070695_1004765662 | 143 |
| 39 | 3300005546 | Ga0070696_101022048 | Ga0070696_1010220482 | 143 |
| 40 | 3300005547 | Ga0070693_100873944 | Ga0070693_1008739441 | 143 |
| 41 | 3300005547 | Ga0070693_100881419 | Ga0070693_1008814191 | 143 |
| 42 | 3300005549 | Ga0070704_100054595 | Ga0070704_1000545952 | 143 |
| 43 | 3300005563 | Ga0068855_100585401 | Ga0068855_1005854012 | 143 |
| 44 | 3300005578 | Ga0068854_100211304 | Ga0068854_1002113042 | 143 |
| 45 | 3300005615 | Ga0070702_100084196 | Ga0070702_1000841963 | 143 |
| 46 | 3300005844 | Ga0068862_100228015 | Ga0068862_1002280152 | 143 |
| 47 | 3300006847 | Ga0075431_100217820 | Ga0075431_1002178202 | 143 |
| 48 | 3300009098 | Ga0105245_10063385 | Ga0105245_100633853 | 143 |
| 49 | 3300009098 | Ga0105245_10189985 | Ga0105245_101899853 | 143 |
| 50 | 3300009147 | Ga0114129_10488095 | Ga0114129_104880952 | 143 |
| 51 | 3300009148 | Ga0105243_10463787 | Ga0105243_104637873 | 143 |
| 52 | 3300009148 | Ga0105243_11115908 | Ga0105243_111159081 | 143 |
| 53 | 3300009176 | Ga0105242_11727077 | Ga0105242_117270771 | 143 |
| 54 | 3300009177 | Ga0105248_11176222 | Ga0105248_111762221 | 143 |
| 55 | 3300009553 | Ga0105249_10175104 | Ga0105249_101751043 | 143 |
| 56 | 3300009553 | Ga0105249_10701692 | Ga0105249_107016921 | 143 |
| 57 | 3300010375 | Ga0105239_10445367 | Ga0105239_104453673 | 143 |
| 58 | 3300013102 | Ga0157371_10915854 | Ga0157371_109158542 | 143 |
| 59 | 3300013297 | Ga0157378_10434883 | Ga0157378_104348833 | 143 |
| 60 | 3300013308 | Ga0157375_10151635 | Ga0157375_101516353 | 143 |
| 61 | 3300013308 | Ga0157375_12144122 | Ga0157375_121441222 | 143 |
| 62 | 3300014325 | Ga0163163_10105205 | Ga0163163_101052053 | 143 |
| 63 | 3300014497 | Ga0182008_10521155 | Ga0182008_105211552 | 143 |
| 64 | 3300014968 | Ga0157379_10477344 | Ga0157379_104773442 | 143 |
| 65 | 3300014968 | Ga0157379_11070740 | Ga0157379_110707402 | 143 |
| 66 | 3300025922 | Ga0207646_10231031 | Ga0207646_102310313 | 143 |
| 67 | 3300025922 | Ga0207646_10388851 | Ga0207646_103888512 | 143 |
| 68 | 3300025927 | Ga0207687_10072848 | Ga0207687_100728483 | 143 |
| 69 | 3300025927 | Ga0207687_11348594 | Ga0207687_113485941 | 143 |
| 70 | 3300025933 | Ga0207706_10049698 | Ga0207706_100496982 | 143 |
| 71 | 3300025935 | Ga0207709_10300355 | Ga0207709_103003553 | 143 |
| 72 | 3300025935 | Ga0207709_10670865 | Ga0207709_106708652 | 143 |
| 73 | 3300025942 | Ga0207689_10265201 | Ga0207689_102652011 | 143 |
| 74 | 3300025949 | Ga0207667_10501174 | Ga0207667_105011742 | 143 |
| 75 | 3300025972 | Ga0207668_10035673 | Ga0207668_100356733 | 143 |
| 76 | 3300025981 | Ga0207640_10216180 | Ga0207640_102161802 | 143 |
| 77 | 3300025981 | Ga0207640_11408445 | Ga0207640_114084452 | 143 |
| 78 | 3300026023 | Ga0207677_10382496 | Ga0207677_103824962 | 143 |
| 79 | 3300026035 | Ga0207703_10375552 | Ga0207703_103755523 | 143 |
| 80 | 3300031548 | Ga0307408_100185473 | Ga0307408_1001854733 | 143 |
| 81 | 3300031727 | Ga0316576_10615296 | Ga0316576_106152962 | 143 |
| 82 | 3300031731 | Ga0307405_11056533 | Ga0307405_110565332 | 143 |
| 83 | 3300031995 | Ga0307409_100061092 | Ga0307409_1000610924 | 143 |
| 84 | 3300032002 | Ga0307416_100116570 | Ga0307416_1001165703 | 143 |
| 85 | 3300032126 | Ga0307415_100004806 | Ga0307415_1000048065 | 143 |
| 86 | 3300035398 | Ga0316574_0124590 | Ga0316574_0124590_1148_1585 | 143 |
| 87 | 3300035691 | Ga0373931_0420444 | Ga0373931_0420444_299_739 | 143 |
| 88 | 3300037471 | Ga0395905_0581528 | Ga0395905_0581528_137_580 | 143 |
| 89 | 3300038443 | Ga0395901_0293125 | Ga0395901_0293125_126_569 | 143 |
| 90 | 3300041405 | Ga0439438_088329 | Ga0439438_088329_234_674 | 143 |
| 91 | 3300041411 | Ga0439466_0054668 | Ga0439466_0054668_524_964 | 143 |
| 92 | 3300041452 | Ga0451793_0196950 | Ga0451793_0196950_17_457 | 143 |
| 93 | 3300041486 | Ga0451807_1643506 | Ga0451807_1643506_143_583 | 143 |
| 94 | 3300041498 | Ga0451841_1279542 | Ga0451841_1279542_208_648 | 143 |
| 95 | 3300041507 | Ga0451851_0789716 | Ga0451851_0789716_296_736 | 143 |
| 96 | 3300042147 | Ga0450910_019691 | Ga0450910_019691_298_738 | 143 |
| 97 | 3300042876 | Ga0451577_1172157 | Ga0451577_1172157_158_604 | 143 |
| 98 | 3300046690 | Ga0495624_0643505 | Ga0495624_0643505_178_618 | 143 |
| 99 | 3300048903 | Ga0496100_1062761 | Ga0496100_1062761_120_560 | 143 |
| 100 | 3300048904 | Ga0496101_0514735 | Ga0496101_0514735_457_897 | 143 |
| 101 | 3300048907 | Ga0496104_0182135 | Ga0496104_0182135_821_1261 | 143 |
| 102 | 3300048907 | Ga0496104_1009341 | Ga0496104_1009341_135_575 | 143 |
| 103 | 3300048908 | Ga0496105_0064463 | Ga0496105_0064463_28_468 | 143 |
| 104 | 3300048908 | Ga0496105_0824766 | Ga0496105_0824766_201_641 | 143 |
| 105 | 3300048909 | Ga0496106_1454746 | Ga0496106_1454746_49_489 | 143 |
| 106 | 3300048911 | Ga0496108_0144050 | Ga0496108_0144050_1086_1526 | 143 |
| 107 | 3300048911 | Ga0496108_0166394 | Ga0496108_0166394_921_1361 | 143 |
| 108 | 3300048912 | Ga0496109_0069119 | Ga0496109_0069119_2041_2481 | 143 |
| 109 | 3300048912 | Ga0496109_0157410 | Ga0496109_0157410_1345_1785 | 143 |
| 110 | 3300048912 | Ga0496109_0629679 | Ga0496109_0629679_252_692 | 143 |
| 111 | 3300048913 | Ga0496110_0175716 | Ga0496110_0175716_760_1200 | 143 |
| 112 | 3300048915 | Ga0496112_0112510 | Ga0496112_0112510_2221_2661 | 143 |
| 113 | 3300048916 | Ga0496113_0016363 | Ga0496113_0016363_1037_1477 | 143 |
| 114 | 3300048916 | Ga0496113_0541861 | Ga0496113_0541861_104_544 | 143 |
| 115 | 3300048917 | Ga0496114_0649343 | Ga0496114_0649343_460_900 | 143 |
| 116 | 3300048917 | Ga0496114_1359364 | Ga0496114_1359364_126_566 | 143 |
| 117 | 3300049568 | Ga0501031_0112241 | Ga0501031_0112241_992_1432 | 143 |
| 118 | 3300049568 | Ga0501031_0123908 | Ga0501031_0123908_507_947 | 143 |
| 119 | 3300049569 | Ga0501032_0651644 | Ga0501032_0651644_189_629 | 143 |
| 120 | 3300049572 | Ga0501036_0049920 | Ga0501036_0049920_2230_2670 | 143 |
| 121 | 3300049572 | Ga0501036_0388146 | Ga0501036_0388146_180_620 | 143 |
| 122 | 3300049572 | Ga0501036_0841775 | Ga0501036_0841775_203_643 | 143 |
| 123 | 3300049573 | Ga0501037_0323223 | Ga0501037_0323223_260_700 | 143 |
| 124 | 3300049573 | Ga0501037_1124276 | Ga0501037_1124276_13_453 | 143 |
| 125 | 3300049574 | Ga0501038_0132177 | Ga0501038_0132177_860_1300 | 143 |
| 126 | 3300049574 | Ga0501038_0464997 | Ga0501038_0464997_294_734 | 143 |
| 127 | 3300049574 | Ga0501038_0881486 | Ga0501038_0881486_59_499 | 143 |
| 128 | 3300049575 | Ga0501039_0048851 | Ga0501039_0048851_1973_2413 | 143 |
| 129 | 3300049575 | Ga0501039_0052113 | Ga0501039_0052113_1371_1811 | 143 |
| 130 | 3300049575 | Ga0501039_0253543 | Ga0501039_0253543_498_938 | 143 |
| 131 | 3300049575 | Ga0501039_0371126 | Ga0501039_0371126_103_543 | 143 |
| 132 | 3300049576 | Ga0501040_0003818 | Ga0501040_0003818_254_694 | 143 |
| 133 | 3300049576 | Ga0501040_0021971 | Ga0501040_0021971_1388_1828 | 143 |
| 134 | 3300049576 | Ga0501040_0032384 | Ga0501040_0032384_284_724 | 143 |
| 135 | 3300049576 | Ga0501040_0058738 | Ga0501040_0058738_1445_1885 | 143 |
| 136 | 3300049577 | Ga0501041_0014508 | Ga0501041_0014508_4187_4627 | 143 |
| 137 | 3300049577 | Ga0501041_0039211 | Ga0501041_0039211_1570_2010 | 143 |
| 138 | 3300049577 | Ga0501041_0075737 | Ga0501041_0075737_1397_1837 | 143 |
| 139 | 3300049577 | Ga0501041_0079735 | Ga0501041_0079735_347_787 | 143 |
| 140 | 3300049578 | Ga0501042_0107737 | Ga0501042_0107737_288_728 | 143 |
| 141 | 3300049578 | Ga0501042_0339815 | Ga0501042_0339815_381_821 | 143 |
| 142 | 3300049578 | Ga0501042_0662065 | Ga0501042_0662065_203_643 | 143 |
| 143 | 3300049578 | Ga0501042_0690799 | Ga0501042_0690799_121_567 | 143 |
| 144 | 3300049579 | Ga0501043_0270823 | Ga0501043_0270823_765_1205 | 143 |
| 145 | 3300049580 | Ga0501046_0068309 | Ga0501046_0068309_1702_2142 | 143 |
| 146 | 3300049580 | Ga0501046_0076648 | Ga0501046_0076648_189_629 | 143 |
| 147 | 3300049581 | Ga0501047_1104934 | Ga0501047_1104934_47_487 | 143 |
| 148 | 3300049582 | Ga0501048_0116204 | Ga0501048_0116204_1153_1593 | 143 |
| 149 | 3300049582 | Ga0501048_0285276 | Ga0501048_0285276_233_673 | 143 |
| 150 | 3300049582 | Ga0501048_0718455 | Ga0501048_0718455_239_679 | 143 |
| 151 | 3300049584 | Ga0501068_0550259 | Ga0501068_0550259_107_547 | 143 |
| 152 | 3300049586 | Ga0501070_0178885 | Ga0501070_0178885_466_906 | 143 |
| 153 | 3300049587 | Ga0501071_0029835 | Ga0501071_0029835_143_583 | 143 |
| 154 | 3300049587 | Ga0501071_0088916 | Ga0501071_0088916_491_931 | 143 |
| 155 | 3300049587 | Ga0501071_0123344 | Ga0501071_0123344_1424_1864 | 143 |
| 156 | 3300049587 | Ga0501071_0236032 | Ga0501071_0236032_337_777 | 143 |
| 157 | 3300049587 | Ga0501071_0315794 | Ga0501071_0315794_543_980 | 143 |
| 158 | 3300049588 | Ga0501072_0011361 | Ga0501072_0011361_5314_5754 | 143 |
| 159 | 3300049588 | Ga0501072_0733308 | Ga0501072_0733308_236_676 | 143 |
| 160 | 3300049589 | Ga0501073_0701719 | Ga0501073_0701719_202_642 | 143 |
| 161 | 3300049590 | Ga0501074_0161060 | Ga0501074_0161060_672_1112 | 143 |
| 162 | 3300049591 | Ga0501075_0007785 | Ga0501075_0007785_6054_6494 | 143 |
| 163 | 3300049591 | Ga0501075_0047359 | Ga0501075_0047359_784_1224 | 143 |
| 164 | 3300049591 | Ga0501075_0187626 | Ga0501075_0187626_1042_1482 | 143 |
| 165 | 3300049591 | Ga0501075_0417107 | Ga0501075_0417107_221_661 | 143 |
| 166 | 3300049592 | Ga0501076_0071511 | Ga0501076_0071511_2082_2522 | 143 |
| 167 | 3300049592 | Ga0501076_0185167 | Ga0501076_0185167_707_1147 | 143 |
| 168 | 3300049592 | Ga0501076_0214259 | Ga0501076_0214259_853_1293 | 143 |
| 169 | 3300049592 | Ga0501076_0288909 | Ga0501076_0288909_40_480 | 143 |
| 170 | 3300049593 | Ga0501077_0032309 | Ga0501077_0032309_1518_1958 | 143 |
| 171 | 3300049593 | Ga0501077_0034977 | Ga0501077_0034977_59_499 | 143 |
| 172 | 3300049741 | Ga0501079_0037474 | Ga0501079_0037474_1068_1508 | 143 |
| 173 | 3300049741 | Ga0501079_0103590 | Ga0501079_0103590_298_738 | 143 |
| 174 | 3300049741 | Ga0501079_0103887 | Ga0501079_0103887_1251_1691 | 143 |
| 175 | 3300049741 | Ga0501079_0131802 | Ga0501079_0131802_524_964 | 143 |
| 176 | 3300049742 | Ga0501080_0034338 | Ga0501080_0034338_3360_3800 | 143 |
| 177 | 3300049742 | Ga0501080_0101670 | Ga0501080_0101670_1887_2327 | 143 |
| 178 | 3300049742 | Ga0501080_1013706 | Ga0501080_1013706_199_639 | 143 |
| 179 | 3300049743 | Ga0501081_0024997 | Ga0501081_0024997_3069_3509 | 143 |
| 180 | 3300049743 | Ga0501081_0242711 | Ga0501081_0242711_167_607 | 143 |
| 181 | 3300049743 | Ga0501081_0625964 | Ga0501081_0625964_343_783 | 143 |
| 182 | 3300049824 | Ga0501045_0005760 | Ga0501045_0005760_6506_6946 | 143 |
| 183 | 3300049824 | Ga0501045_0064976 | Ga0501045_0064976_1134_1574 | 143 |
| 184 | 3300049824 | Ga0501045_0118173 | Ga0501045_0118173_455_895 | 143 |
| 185 | 3300049824 | Ga0501045_0143371 | Ga0501045_0143371_220_660 | 143 |
| 186 | 3300049824 | Ga0501045_0206460 | Ga0501045_0206460_585_1025 | 143 |
| 187 | 3300050507 | nmdc:mga05p37_824661_c1 | nmdc:mga05p37_824661_c1_384_824 | 143 |
| 188 | 3300050510 | nmdc:mga06r32_119337_c1 | nmdc:mga06r32_119337_c1_1934_2374 | 143 |
| 189 | 3300050512 | nmdc:mga0n895_317692_c1 | nmdc:mga0n895_317692_c1_393_833 | 143 |
| 190 | 3300050514 | nmdc:mga08x19_328459_c1 | nmdc:mga08x19_328459_c1_311_766 | 143 |
| 191 | 3300054114 | Ga0501084_0079234 | Ga0501084_0079234_849_1289 | 143 |
| 192 | 3300054114 | Ga0501084_0128484 | Ga0501084_0128484_874_1314 | 143 |
| 193 | 3300054114 | Ga0501084_0695825 | Ga0501084_0695825_403_843 | 143 |
| 194 | 3300054114 | Ga0501084_1079535 | Ga0501084_1079535_162_602 | 143 |
| 195 | 3300060353 | Ga0501082_0048928 | Ga0501082_0048928_2287_2727 | 143 |
| 196 | 3300060353 | Ga0501082_0053683 | Ga0501082_0053683_2707_3147 | 143 |
| 197 | 3300060353 | Ga0501082_0224053 | Ga0501082_0224053_554_994 | 143 |
| 198 | 3300060353 | Ga0501082_0301863 | Ga0501082_0301863_648_1088 | 143 |
| 199 | 3300060353 | Ga0501082_1612989 | Ga0501082_1612989_41_481 | 143 |
| 200 | 3300061734 | Ga0530510_0002811 | Ga0530510_0002811_7534_7974 | 143 |
| 201 | 3300061734 | Ga0530510_0010156 | Ga0530510_0010156_132_572 | 143 |
| 202 | 3300061734 | Ga0530510_0026774 | Ga0530510_0026774_3113_3553 | 143 |
| 203 | 3300061734 | Ga0530510_0177881 | Ga0530510_0177881_365_805 | 143 |
| 204 | 3300061734 | Ga0530510_0217593 | Ga0530510_0217593_119_559 | 143 |
| 205 | 3300006871 | Ga0075434_100223052 | Ga0075434_1002230523 | 144 |
| 206 | 3300006914 | Ga0075436_100756326 | Ga0075436_1007563262 | 144 |
| 207 | 3300009174 | Ga0105241_10747713 | Ga0105241_107477132 | 144 |
| 208 | 3300025907 | Ga0207645_10077240 | Ga0207645_100772403 | 144 |
| 209 | 3300025940 | Ga0207691_10373837 | Ga0207691_103738372 | 144 |
| 210 | 3300025960 | Ga0207651_10353110 | Ga0207651_103531102 | 144 |
| 211 | 3300027717 | Ga0209998_10023192 | Ga0209998_100231922 | 144 |
| 212 | 3300036401 | Ga0373937_1417881 | Ga0373937_1417881_55_492 | 144 |
| 213 | 3300042001 | Ga0439441_001582 | Ga0439441_001582_2291_2728 | 144 |
| 214 | 3300048904 | Ga0496101_0006551 | Ga0496101_0006551_4548_4988 | 144 |
| 215 | 3300048905 | Ga0496102_0182680 | Ga0496102_0182680_301_741 | 144 |
| 216 | 3300048907 | Ga0496104_0313586 | Ga0496104_0313586_718_1158 | 144 |
| 217 | 3300048908 | Ga0496105_0025812 | Ga0496105_0025812_874_1314 | 144 |
| 218 | 3300048910 | Ga0496107_0100929 | Ga0496107_0100929_1176_1616 | 144 |
| 219 | 3300048911 | Ga0496108_0025060 | Ga0496108_0025060_994_1434 | 144 |
| 220 | 3300048912 | Ga0496109_0009839 | Ga0496109_0009839_4761_5201 | 144 |
| 221 | 3300048913 | Ga0496110_0091358 | Ga0496110_0091358_1466_1906 | 144 |
| 222 | 3300048915 | Ga0496112_0000098 | Ga0496112_0000098_35514_35951 | 144 |
| 223 | 3300048915 | Ga0496112_0567524 | Ga0496112_0567524_186_626 | 144 |
| 224 | 3300048916 | Ga0496113_0141285 | Ga0496113_0141285_771_1211 | 144 |
| 225 | 3300048917 | Ga0496114_0005648 | Ga0496114_0005648_6696_7136 | 144 |
| 226 | 3300050512 | nmdc:mga0n895_189236_c1 | nmdc:mga0n895_189236_c1_820_1257 | 144 |
| 227 | 3300050513 | nmdc:mga0rr50_110431_c1 | nmdc:mga0rr50_110431_c1_704_1141 | 144 |
| 228 | 3300050514 | nmdc:mga08x19_1021961_c1 | nmdc:mga08x19_1021961_c1_55_492 | 144 |
| 229 | 3300005334 | Ga0068869_100136839 | Ga0068869_1001368393 | 145 |
| 230 | 3300005336 | Ga0070680_100000064 | Ga0070680_10000006426 | 145 |
| 231 | 3300005338 | Ga0068868_100220440 | Ga0068868_1002204402 | 145 |
| 232 | 3300005341 | Ga0070691_10120011 | Ga0070691_101200112 | 145 |
| 233 | 3300005353 | Ga0070669_100319632 | Ga0070669_1003196323 | 145 |
| 234 | 3300005435 | Ga0070714_101172012 | Ga0070714_1011720122 | 145 |
| 235 | 3300005440 | Ga0070705_100178886 | Ga0070705_1001788862 | 145 |
| 236 | 3300005440 | Ga0070705_100246413 | Ga0070705_1002464132 | 145 |
| 237 | 3300005441 | Ga0070700_100212175 | Ga0070700_1002121752 | 145 |
| 238 | 3300005444 | Ga0070694_100109660 | Ga0070694_1001096603 | 145 |
| 239 | 3300005444 | Ga0070694_100476323 | Ga0070694_1004763232 | 145 |
| 240 | 3300005445 | Ga0070708_100029319 | Ga0070708_1000293196 | 145 |
| 241 | 3300005445 | Ga0070708_100030313 | Ga0070708_1000303133 | 145 |
| 242 | 3300005458 | Ga0070681_11075180 | Ga0070681_110751802 | 145 |
| 243 | 3300005467 | Ga0070706_100005018 | Ga0070706_10000501813 | 145 |
| 244 | 3300005467 | Ga0070706_100047843 | Ga0070706_1000478433 | 145 |
| 245 | 3300005467 | Ga0070706_100553818 | Ga0070706_1005538182 | 145 |
| 246 | 3300005468 | Ga0070707_100006720 | Ga0070707_1000067205 | 145 |
| 247 | 3300005468 | Ga0070707_100064043 | Ga0070707_1000640433 | 145 |
| 248 | 3300005468 | Ga0070707_100328616 | Ga0070707_1003286162 | 145 |
| 249 | 3300005471 | Ga0070698_100011233 | Ga0070698_1000112335 | 145 |
| 250 | 3300005471 | Ga0070698_100303809 | Ga0070698_1003038092 | 145 |
| 251 | 3300005518 | Ga0070699_100940783 | Ga0070699_1009407832 | 145 |
| 252 | 3300005530 | Ga0070679_100483867 | Ga0070679_1004838672 | 145 |
| 253 | 3300005535 | Ga0070684_101453023 | Ga0070684_1014530231 | 145 |
| 254 | 3300005536 | Ga0070697_100093146 | Ga0070697_1000931463 | 145 |
| 255 | 3300005536 | Ga0070697_100105447 | Ga0070697_1001054472 | 145 |
| 256 | 3300005536 | Ga0070697_100930605 | Ga0070697_1009306052 | 145 |
| 257 | 3300005544 | Ga0070686_100138261 | Ga0070686_1001382611 | 145 |
| 258 | 3300005544 | Ga0070686_100245029 | Ga0070686_1002450292 | 145 |
| 259 | 3300005545 | Ga0070695_100043376 | Ga0070695_1000433762 | 145 |
| 260 | 3300005545 | Ga0070695_100370184 | Ga0070695_1003701842 | 145 |
| 261 | 3300005546 | Ga0070696_100005146 | Ga0070696_10000514610 | 145 |
| 262 | 3300005546 | Ga0070696_100101674 | Ga0070696_1001016741 | 145 |
| 263 | 3300005546 | Ga0070696_100335096 | Ga0070696_1003350961 | 145 |
| 264 | 3300005564 | Ga0070664_101121284 | Ga0070664_1011212842 | 145 |
| 265 | 3300005577 | Ga0068857_100195777 | Ga0068857_1001957773 | 145 |
| 266 | 3300005578 | Ga0068854_100079223 | Ga0068854_1000792232 | 145 |
| 267 | 3300005842 | Ga0068858_100526779 | Ga0068858_1005267792 | 145 |
| 268 | 3300006844 | Ga0075428_100867293 | Ga0075428_1008672931 | 145 |
| 269 | 3300006871 | Ga0075434_100287007 | Ga0075434_1002870072 | 145 |
| 270 | 3300006871 | Ga0075434_100412327 | Ga0075434_1004123272 | 145 |
| 271 | 3300006914 | Ga0075436_100314098 | Ga0075436_1003140983 | 145 |
| 272 | 3300007076 | Ga0075435_100049453 | Ga0075435_1000494535 | 145 |
| 273 | 3300009098 | Ga0105245_10016155 | Ga0105245_100161556 | 145 |
| 274 | 3300009147 | Ga0114129_11983200 | Ga0114129_119832002 | 145 |
| 275 | 3300009148 | Ga0105243_11211641 | Ga0105243_112116412 | 145 |
| 276 | 3300009176 | Ga0105242_10141908 | Ga0105242_101419082 | 145 |
| 277 | 3300009176 | Ga0105242_11042471 | Ga0105242_110424712 | 145 |
| 278 | 3300009176 | Ga0105242_11680178 | Ga0105242_116801782 | 145 |
| 279 | 3300009553 | Ga0105249_10866895 | Ga0105249_108668952 | 145 |
| 280 | 3300010375 | Ga0105239_11349683 | Ga0105239_113496832 | 145 |
| 281 | 3300011119 | Ga0105246_10211192 | Ga0105246_102111922 | 145 |
| 282 | 3300013297 | Ga0157378_10024428 | Ga0157378_100244283 | 145 |
| 283 | 3300025901 | Ga0207688_10115639 | Ga0207688_101156392 | 145 |
| 284 | 3300025907 | Ga0207645_10045596 | Ga0207645_100455963 | 145 |
| 285 | 3300025910 | Ga0207684_10017135 | Ga0207684_100171352 | 145 |
| 286 | 3300025910 | Ga0207684_10058459 | Ga0207684_100584593 | 145 |
| 287 | 3300025917 | Ga0207660_10000002 | Ga0207660_10000002420 | 145 |
| 288 | 3300025917 | Ga0207660_10377251 | Ga0207660_103772512 | 145 |
| 289 | 3300025917 | Ga0207660_11057548 | Ga0207660_110575482 | 145 |
| 290 | 3300025918 | Ga0207662_10008434 | Ga0207662_100084349 | 145 |
| 291 | 3300025918 | Ga0207662_10381392 | Ga0207662_103813921 | 145 |
| 292 | 3300025922 | Ga0207646_10141769 | Ga0207646_101417692 | 145 |
| 293 | 3300025922 | Ga0207646_10237906 | Ga0207646_102379062 | 145 |
| 294 | 3300025927 | Ga0207687_10053169 | Ga0207687_100531692 | 145 |
| 295 | 3300025929 | Ga0207664_11351570 | Ga0207664_113515702 | 145 |
| 296 | 3300025933 | Ga0207706_10207558 | Ga0207706_102075582 | 145 |
| 297 | 3300025934 | Ga0207686_10615321 | Ga0207686_106153211 | 145 |
| 298 | 3300025942 | Ga0207689_10063130 | Ga0207689_100631303 | 145 |
| 299 | 3300025945 | Ga0207679_11421655 | Ga0207679_114216551 | 145 |
| 300 | 3300026023 | Ga0207677_10241468 | Ga0207677_102414682 | 145 |
| 301 | 3300026041 | Ga0207639_10985834 | Ga0207639_109858342 | 145 |
| 302 | 3300026067 | Ga0207678_11483552 | Ga0207678_114835521 | 145 |
| 303 | 3300026075 | Ga0207708_10533597 | Ga0207708_105335972 | 145 |
| 304 | 3300026116 | Ga0207674_10192470 | Ga0207674_101924702 | 145 |
| 305 | 3300028380 | Ga0268265_10771492 | Ga0268265_107714922 | 145 |
| 306 | 3300028563 | Ga0265319_1002616 | Ga0265319_10026165 | 145 |
| 307 | 3300028573 | Ga0265334_10101765 | Ga0265334_101017652 | 145 |
| 308 | 3300028577 | Ga0265318_10015272 | Ga0265318_100152723 | 145 |
| 309 | 3300028577 | Ga0265318_10020174 | Ga0265318_100201742 | 145 |
| 310 | 3300028577 | Ga0265318_10038176 | Ga0265318_100381762 | 145 |
| 311 | 3300028654 | Ga0265322_10011152 | Ga0265322_100111522 | 145 |
| 312 | 3300028666 | Ga0265336_10010948 | Ga0265336_100109482 | 145 |
| 313 | 3300028666 | Ga0265336_10117665 | Ga0265336_101176652 | 145 |
| 314 | 3300028800 | Ga0265338_10075958 | Ga0265338_100759584 | 145 |
| 315 | 3300028800 | Ga0265338_10699813 | Ga0265338_106998132 | 145 |
| 316 | 3300029957 | Ga0265324_10008203 | Ga0265324_100082035 | 145 |
| 317 | 3300031239 | Ga0265328_10045638 | Ga0265328_100456382 | 145 |
| 318 | 3300031240 | Ga0265320_10009070 | Ga0265320_100090704 | 145 |
| 319 | 3300031240 | Ga0265320_10039466 | Ga0265320_100394663 | 145 |
| 320 | 3300031241 | Ga0265325_10017224 | Ga0265325_100172244 | 145 |
| 321 | 3300031241 | Ga0265325_10064891 | Ga0265325_100648913 | 145 |
| 322 | 3300031241 | Ga0265325_10337454 | Ga0265325_103374541 | 145 |
| 323 | 3300031242 | Ga0265329_10022566 | Ga0265329_100225663 | 145 |
| 324 | 3300031242 | Ga0265329_10299750 | Ga0265329_102997501 | 145 |
| 325 | 3300031247 | Ga0265340_10004346 | Ga0265340_100043464 | 145 |
| 326 | 3300031249 | Ga0265339_10010068 | Ga0265339_100100684 | 145 |
| 327 | 3300031249 | Ga0265339_10190920 | Ga0265339_101909202 | 145 |
| 328 | 3300031251 | Ga0265327_10130370 | Ga0265327_101303703 | 145 |
| 329 | 3300031344 | Ga0265316_10055834 | Ga0265316_100558342 | 145 |
| 330 | 3300031595 | Ga0265313_10035007 | Ga0265313_100350072 | 145 |
| 331 | 3300031711 | Ga0265314_10002544 | Ga0265314_1000254421 | 145 |
| 332 | 3300032002 | Ga0307416_100345429 | Ga0307416_1003454293 | 145 |
| 333 | 3300032133 | Ga0316583_10171845 | Ga0316583_101718452 | 145 |
| 334 | 3300042185 | Ga0450909_034182 | Ga0450909_034182_156_593 | 145 |
| 335 | 3300044673 | Ga0453683_0192239 | Ga0453683_0192239_484_936 | 145 |
| 336 | 3300048905 | Ga0496102_1742865 | Ga0496102_1742865_52_504 | 145 |
| 337 | 3300048906 | Ga0496103_0179915 | Ga0496103_0179915_400_852 | 145 |
| 338 | 3300048915 | Ga0496112_0519953 | Ga0496112_0519953_25_477 | 145 |
| 339 | 3300049568 | Ga0501031_0793235 | Ga0501031_0793235_103_540 | 145 |
| 340 | 3300049574 | Ga0501038_0212084 | Ga0501038_0212084_762_1199 | 145 |
| 341 | 3300049576 | Ga0501040_0178934 | Ga0501040_0178934_298_735 | 145 |
| 342 | 3300049577 | Ga0501041_0042474 | Ga0501041_0042474_351_788 | 145 |
| 343 | 3300049578 | Ga0501042_0093254 | Ga0501042_0093254_63_500 | 145 |
| 344 | 3300049580 | Ga0501046_0330019 | Ga0501046_0330019_441_878 | 145 |
| 345 | 3300049582 | Ga0501048_0261926 | Ga0501048_0261926_629_1066 | 145 |
| 346 | 3300049584 | Ga0501068_0557647 | Ga0501068_0557647_247_684 | 145 |
| 347 | 3300049587 | Ga0501071_0372121 | Ga0501071_0372121_639_1076 | 145 |
| 348 | 3300049588 | Ga0501072_0104541 | Ga0501072_0104541_915_1352 | 145 |
| 349 | 3300049588 | Ga0501072_0334369 | Ga0501072_0334369_607_1044 | 145 |
| 350 | 3300049590 | Ga0501074_0298494 | Ga0501074_0298494_540_977 | 145 |
| 351 | 3300049591 | Ga0501075_0009521 | Ga0501075_0009521_2620_3057 | 145 |
| 352 | 3300049591 | Ga0501075_0649592 | Ga0501075_0649592_180_617 | 145 |
| 353 | 3300049591 | Ga0501075_0955425 | Ga0501075_0955425_117_554 | 145 |
| 354 | 3300049593 | Ga0501077_0012888 | Ga0501077_0012888_3008_3445 | 145 |
| 355 | 3300049741 | Ga0501079_0032539 | Ga0501079_0032539_1456_1893 | 145 |
| 356 | 3300049743 | Ga0501081_0084743 | Ga0501081_0084743_483_920 | 145 |
| 357 | 3300049822 | Ga0501035_0217364 | Ga0501035_0217364_888_1325 | 145 |
| 358 | 3300049824 | Ga0501045_0051355 | Ga0501045_0051355_685_1122 | 145 |
| 359 | 3300050513 | nmdc:mga0rr50_59636_c1 | nmdc:mga0rr50_59636_c1_591_1043 | 145 |
| 360 | 3300050515 | nmdc:mga0a205_156715_c1 | nmdc:mga0a205_156715_c1_1360_1812 | 145 |
| 361 | 3300050515 | nmdc:mga0a205_63714_c1 | nmdc:mga0a205_63714_c1_2292_2744 | 145 |
| 362 | 3300054114 | Ga0501084_0119763 | Ga0501084_0119763_1231_1668 | 145 |
| 363 | 3300060353 | Ga0501082_0179399 | Ga0501082_0179399_1015_1452 | 145 |
| 364 | 3300061734 | Ga0530510_0399575 | Ga0530510_0399575_176_613 | 145 |
| 365 | 3300061734 | Ga0530510_0411435 | Ga0530510_0411435_287_724 | 145 |
| 366 | 3300005347 | Ga0070668_100826879 | Ga0070668_1008268792 | 146 |
| 367 | 3300005445 | Ga0070708_100458916 | Ga0070708_1004589161 | 146 |
| 368 | 3300005518 | Ga0070699_100470666 | Ga0070699_1004706662 | 146 |
| 369 | 3300005518 | Ga0070699_101196585 | Ga0070699_1011965852 | 146 |
| 370 | 3300005536 | Ga0070697_100018732 | Ga0070697_1000187322 | 146 |
| 371 | 3300005617 | Ga0068859_100485362 | Ga0068859_1004853622 | 146 |
| 372 | 3300005718 | Ga0068866_10491641 | Ga0068866_104916412 | 146 |
| 373 | 3300005840 | Ga0068870_10172368 | Ga0068870_101723683 | 146 |
| 374 | 3300006175 | Ga0070712_100511237 | Ga0070712_1005112372 | 146 |
| 375 | 3300006852 | Ga0075433_11336032 | Ga0075433_113360322 | 146 |
| 376 | 3300006881 | Ga0068865_100064837 | Ga0068865_1000648372 | 146 |
| 377 | 3300006931 | Ga0097620_100485312 | Ga0097620_1004853122 | 146 |
| 378 | 3300009147 | Ga0114129_10260085 | Ga0114129_102600853 | 146 |
| 379 | 3300009148 | Ga0105243_10052898 | Ga0105243_100528984 | 146 |
| 380 | 3300009553 | Ga0105249_11833816 | Ga0105249_118338161 | 146 |
| 381 | 3300013297 | Ga0157378_10307421 | Ga0157378_103074213 | 146 |
| 382 | 3300014326 | Ga0157380_10248278 | Ga0157380_102482782 | 146 |
| 383 | 3300014326 | Ga0157380_12551356 | Ga0157380_125513561 | 146 |
| 384 | 3300025908 | Ga0207643_10491262 | Ga0207643_104912622 | 146 |
| 385 | 3300025935 | Ga0207709_10029558 | Ga0207709_100295584 | 146 |
| 386 | 3300025937 | Ga0207669_10012039 | Ga0207669_100120395 | 146 |
| 387 | 3300025938 | Ga0207704_10026976 | Ga0207704_100269765 | 146 |
| 388 | 3300025941 | Ga0207711_11615396 | Ga0207711_116153962 | 146 |
| 389 | 3300041512 | Ga0451853_0662573 | Ga0451853_0662573_341_790 | 146 |
| 390 | 3300042125 | Ga0450923_173881 | Ga0450923_173881_20_460 | 146 |
| 391 | 3300045051 | Ga0451576_1006894 | Ga0451576_1006894_147_587 | 146 |
| 392 | 3300046461 | Ga0495641_0117312 | Ga0495641_0117312_27_467 | 146 |
| 393 | 3300046462 | Ga0495651_0433057 | Ga0495651_0433057_171_611 | 146 |
| 394 | 3300046514 | Ga0495618_0782455 | Ga0495618_0782455_13_453 | 146 |
| 395 | 3300046517 | Ga0495630_0132659 | Ga0495630_0132659_1405_1845 | 146 |
| 396 | 3300046533 | Ga0495640_0373403 | Ga0495640_0373403_305_745 | 146 |
| 397 | 3300046642 | Ga0495634_0192317 | Ga0495634_0192317_340_780 | 146 |
| 398 | 3300046678 | Ga0495599_0424970 | Ga0495599_0424970_214_654 | 146 |
| 399 | 3300046809 | Ga0495600_0439443 | Ga0495600_0439443_260_700 | 146 |
| 400 | 3300047317 | Ga0495604_0308816 | Ga0495604_0308816_355_795 | 146 |
| 401 | 3300047319 | Ga0495674_0891033 | Ga0495674_0891033_77_517 | 146 |
| 402 | 3300048088 | Ga0495602_0100628 | Ga0495602_0100628_1190_1630 | 146 |
| 403 | 3300048915 | Ga0496112_0261497 | Ga0496112_0261497_420_878 | 146 |
| 404 | 3300049583 | Ga0501067_0212450 | Ga0501067_0212450_136_576 | 146 |
| 405 | 3300049585 | Ga0501069_0016906 | Ga0501069_0016906_2537_2977 | 146 |
| 406 | 3300050507 | nmdc:mga05p37_342691_c1 | nmdc:mga05p37_342691_c1_251_691 | 146 |
| 407 | 3300050515 | nmdc:mga0a205_1182214_c1 | nmdc:mga0a205_1182214_c1_141_581 | 146 |
| 408 | 3300053077 | Ga0495601_0355096 | Ga0495601_0355096_292_732 | 146 |
| 409 | 3300053078 | Ga0495612_0351531 | Ga0495612_0351531_197_637 | 146 |
| 410 | 3300053084 | Ga0495595_0403847 | Ga0495595_0403847_20_469 | 146 |
| 411 | 3300005445 | Ga0070708_101879294 | Ga0070708_1018792941 | 147 |
| 412 | 3300009094 | Ga0111539_10950171 | Ga0111539_109501712 | 148 |
| 413 | 3300027665 | Ga0209983_1021016 | Ga0209983_10210162 | 148 |
| 414 | 3300035112 | Ga0373932_0030008 | Ga0373932_0030008_28_474 | 148 |
| 415 | 3300035242 | Ga0373962_0086642 | Ga0373962_0086642_19_465 | 148 |
| 416 | 3300039437 | Ga0436365_0347259 | Ga0436365_0347259_730_1188 | 148 |
| 417 | 3300041411 | Ga0439466_0116324 | Ga0439466_0116324_267_719 | 148 |
| 418 | 3300042147 | Ga0450910_004004 | Ga0450910_004004_1342_1800 | 148 |
| 419 | 3300042184 | Ga0450908_035093 | Ga0450908_035093_81_539 | 148 |
| 420 | 3300048903 | Ga0496100_1623782 | Ga0496100_1623782_52_498 | 148 |
| 421 | 3300048905 | Ga0496102_0136558 | Ga0496102_0136558_1830_2276 | 148 |
| 422 | 3300048908 | Ga0496105_0348511 | Ga0496105_0348511_707_1153 | 148 |
| 423 | 3300048910 | Ga0496107_0428827 | Ga0496107_0428827_222_668 | 148 |
| 424 | 3300048911 | Ga0496108_0060962 | Ga0496108_0060962_986_1432 | 148 |
| 425 | 3300048912 | Ga0496109_0156520 | Ga0496109_0156520_1137_1583 | 148 |
| 426 | 3300048913 | Ga0496110_0134063 | Ga0496110_0134063_462_908 | 148 |
| 427 | 3300048914 | Ga0496111_0271503 | Ga0496111_0271503_532_978 | 148 |
| 428 | 3300048916 | Ga0496113_0049277 | Ga0496113_0049277_317_763 | 148 |
| 429 | 3300048917 | Ga0496114_1078640 | Ga0496114_1078640_164_610 | 148 |
| 430 | 3300050511 | nmdc:mga08y16_1148637_c1 | nmdc:mga08y16_1148637_c1_191_637 | 148 |
| 431 | 3300050511 | nmdc:mga08y16_94926_c1 | nmdc:mga08y16_94926_c1_1306_1752 | 148 |
| 432 | 3300054114 | Ga0501084_0373527 | Ga0501084_0373527_311_769 | 148 |
| 433 | 3300005331 | Ga0070670_101426507 | Ga0070670_1014265072 | 149 |
| 434 | 3300005340 | Ga0070689_101152026 | Ga0070689_1011520262 | 149 |
| 435 | 3300005345 | Ga0070692_10270976 | Ga0070692_102709762 | 149 |
| 436 | 3300005347 | Ga0070668_101212462 | Ga0070668_1012124622 | 149 |
| 437 | 3300005354 | Ga0070675_100855712 | Ga0070675_1008557122 | 149 |
| 438 | 3300005356 | Ga0070674_100462924 | Ga0070674_1004629242 | 149 |
| 439 | 3300005438 | Ga0070701_10436690 | Ga0070701_104366901 | 149 |
| 440 | 3300005440 | Ga0070705_100495666 | Ga0070705_1004956662 | 149 |
| 441 | 3300005441 | Ga0070700_100146502 | Ga0070700_1001465022 | 149 |
| 442 | 3300005441 | Ga0070700_100242695 | Ga0070700_1002426952 | 149 |
| 443 | 3300005456 | Ga0070678_101938210 | Ga0070678_1019382101 | 149 |
| 444 | 3300005577 | Ga0068857_100085746 | Ga0068857_1000857463 | 149 |
| 445 | 3300005719 | Ga0068861_101580160 | Ga0068861_1015801602 | 149 |
| 446 | 3300005840 | Ga0068870_10118048 | Ga0068870_101180482 | 149 |
| 447 | 3300005844 | Ga0068862_100130184 | Ga0068862_1001301843 | 149 |
| 448 | 3300009094 | Ga0111539_10215328 | Ga0111539_102153282 | 149 |
| 449 | 3300009094 | Ga0111539_10666138 | Ga0111539_106661382 | 149 |
| 450 | 3300009147 | Ga0114129_11124739 | Ga0114129_111247392 | 149 |
| 451 | 3300013296 | Ga0157374_11878538 | Ga0157374_118785382 | 149 |
| 452 | 3300025925 | Ga0207650_10348816 | Ga0207650_103488161 | 149 |
| 453 | 3300025936 | Ga0207670_10323127 | Ga0207670_103231273 | 149 |
| 454 | 3300025937 | Ga0207669_11561848 | Ga0207669_115618481 | 149 |
| 455 | 3300026075 | Ga0207708_10292774 | Ga0207708_102927742 | 149 |
| 456 | 3300026075 | Ga0207708_10452371 | Ga0207708_104523712 | 149 |
| 457 | 3300026116 | Ga0207674_10212681 | Ga0207674_102126812 | 149 |
| 458 | 3300026118 | Ga0207675_100044545 | Ga0207675_1000445451 | 149 |
| 459 | 3300026121 | Ga0207683_11756630 | Ga0207683_117566302 | 149 |
| 460 | 3300027907 | Ga0207428_10119707 | Ga0207428_101197073 | 149 |
| 461 | 3300031903 | Ga0307407_10255084 | Ga0307407_102550843 | 149 |
| 462 | 3300031903 | Ga0307407_10409024 | Ga0307407_104090242 | 149 |
| 463 | 3300032005 | Ga0307411_11519720 | Ga0307411_115197202 | 149 |
| 464 | 3300049568 | Ga0501031_0012895 | Ga0501031_0012895_4271_4726 | 149 |
| 465 | 3300049570 | Ga0501033_0070780 | Ga0501033_0070780_364_819 | 149 |
| 466 | 3300049572 | Ga0501036_0133330 | Ga0501036_0133330_1079_1534 | 149 |
| 467 | 3300049573 | Ga0501037_0044880 | Ga0501037_0044880_127_582 | 149 |
| 468 | 3300049574 | Ga0501038_0033237 | Ga0501038_0033237_673_1128 | 149 |
| 469 | 3300049576 | Ga0501040_0120915 | Ga0501040_0120915_1306_1761 | 149 |
| 470 | 3300049577 | Ga0501041_0020238 | Ga0501041_0020238_874_1329 | 149 |
| 471 | 3300049578 | Ga0501042_0164726 | Ga0501042_0164726_874_1329 | 149 |
| 472 | 3300049579 | Ga0501043_0023595 | Ga0501043_0023595_830_1285 | 149 |
| 473 | 3300049582 | Ga0501048_0062362 | Ga0501048_0062362_395_850 | 149 |
| 474 | 3300049585 | Ga0501069_0022459 | Ga0501069_0022459_1151_1606 | 149 |
| 475 | 3300049586 | Ga0501070_0120823 | Ga0501070_0120823_763_1218 | 149 |
| 476 | 3300049587 | Ga0501071_0012113 | Ga0501071_0012113_5313_5768 | 149 |
| 477 | 3300049588 | Ga0501072_0049781 | Ga0501072_0049781_1372_1827 | 149 |
| 478 | 3300049589 | Ga0501073_0044364 | Ga0501073_0044364_690_1145 | 149 |
| 479 | 3300049590 | Ga0501074_0034551 | Ga0501074_0034551_1217_1672 | 149 |
| 480 | 3300049591 | Ga0501075_0037370 | Ga0501075_0037370_312_767 | 149 |
| 481 | 3300049592 | Ga0501076_0153849 | Ga0501076_0153849_681_1136 | 149 |
| 482 | 3300049593 | Ga0501077_0025972 | Ga0501077_0025972_2400_2855 | 149 |
| 483 | 3300049741 | Ga0501079_0054487 | Ga0501079_0054487_1363_1818 | 149 |
| 484 | 3300049742 | Ga0501080_0029655 | Ga0501080_0029655_1195_1650 | 149 |
| 485 | 3300049743 | Ga0501081_0096676 | Ga0501081_0096676_873_1328 | 149 |
| 486 | 3300049744 | Ga0501083_0112226 | Ga0501083_0112226_1283_1738 | 149 |
| 487 | 3300049822 | Ga0501035_0089541 | Ga0501035_0089541_1440_1895 | 149 |
| 488 | 3300049823 | Ga0501044_0318432 | Ga0501044_0318432_343_798 | 149 |
| 489 | 3300049824 | Ga0501045_0014739 | Ga0501045_0014739_4713_5168 | 149 |
| 490 | 3300050511 | nmdc:mga08y16_181149_c1 | nmdc:mga08y16_181149_c1_1174_1629 | 149 |
| 491 | 3300054114 | Ga0501084_0016480 | Ga0501084_0016480_1366_1821 | 149 |
| 492 | 3300060353 | Ga0501082_0046235 | Ga0501082_0046235_2444_2899 | 149 |
| 493 | 3300061734 | Ga0530510_0060038 | Ga0530510_0060038_442_897 | 149 |
| 494 | 3300005937 | Ga0081455_10357646 | Ga0081455_103576462 | 150 |
| 495 | 3300031727 | Ga0316576_10078218 | Ga0316576_100782182 | 150 |
| 496 | 3300031733 | Ga0316577_10036067 | Ga0316577_100360672 | 150 |
| 497 | 3300036647 | Ga0316582_0044485 | Ga0316582_0044485_1805_2266 | 150 |
| 498 | 3300036647 | Ga0316582_0257041 | Ga0316582_0257041_602_1063 | 150 |
| 499 | 3300037588 | Ga0316581_0072732 | Ga0316581_0072732_392_853 | 150 |
| 500 | 3300005330 | Ga0070690_100068392 | Ga0070690_1000683923 | 151 |
| 501 | 3300005335 | Ga0070666_10193615 | Ga0070666_101936152 | 151 |
| 502 | 3300005336 | Ga0070680_100109073 | Ga0070680_1001090733 | 151 |
| 503 | 3300005337 | Ga0070682_100072469 | Ga0070682_1000724692 | 151 |
| 504 | 3300005338 | Ga0068868_100093433 | Ga0068868_1000934333 | 151 |
| 505 | 3300005339 | Ga0070660_100213094 | Ga0070660_1002130942 | 151 |
| 506 | 3300005340 | Ga0070689_100037490 | Ga0070689_1000374902 | 151 |
| 507 | 3300005341 | Ga0070691_10123398 | Ga0070691_101233982 | 151 |
| 508 | 3300005343 | Ga0070687_100188326 | Ga0070687_1001883262 | 151 |
| 509 | 3300005344 | Ga0070661_100197565 | Ga0070661_1001975652 | 151 |
| 510 | 3300005345 | Ga0070692_10012592 | Ga0070692_100125921 | 151 |
| 511 | 3300005347 | Ga0070668_100102089 | Ga0070668_1001020893 | 151 |
| 512 | 3300005353 | Ga0070669_100016773 | Ga0070669_1000167734 | 151 |
| 513 | 3300005354 | Ga0070675_100013259 | Ga0070675_1000132592 | 151 |
| 514 | 3300005356 | Ga0070674_100038948 | Ga0070674_1000389483 | 151 |
| 515 | 3300005364 | Ga0070673_100231631 | Ga0070673_1002316312 | 151 |
| 516 | 3300005366 | Ga0070659_100843351 | Ga0070659_1008433512 | 151 |
| 517 | 3300005438 | Ga0070701_10023624 | Ga0070701_100236245 | 151 |
| 518 | 3300005440 | Ga0070705_100076960 | Ga0070705_1000769601 | 151 |
| 519 | 3300005441 | Ga0070700_100061043 | Ga0070700_1000610432 | 151 |
| 520 | 3300005456 | Ga0070678_100155180 | Ga0070678_1001551801 | 151 |
| 521 | 3300005459 | Ga0068867_100236391 | Ga0068867_1002363911 | 151 |
| 522 | 3300005544 | Ga0070686_100051300 | Ga0070686_1000513003 | 151 |
| 523 | 3300005547 | Ga0070693_100059608 | Ga0070693_1000596082 | 151 |
| 524 | 3300005577 | Ga0068857_100405852 | Ga0068857_1004058522 | 151 |
| 525 | 3300005578 | Ga0068854_100307982 | Ga0068854_1003079822 | 151 |
| 526 | 3300005615 | Ga0070702_100038924 | Ga0070702_1000389242 | 151 |
| 527 | 3300005616 | Ga0068852_100258049 | Ga0068852_1002580492 | 151 |
| 528 | 3300005617 | Ga0068859_100267721 | Ga0068859_1002677212 | 151 |
| 529 | 3300005618 | Ga0068864_100034436 | Ga0068864_1000344363 | 151 |
| 530 | 3300005718 | Ga0068866_10053756 | Ga0068866_100537562 | 151 |
| 531 | 3300005719 | Ga0068861_100316862 | Ga0068861_1003168622 | 151 |
| 532 | 3300005840 | Ga0068870_10167404 | Ga0068870_101674042 | 151 |
| 533 | 3300005843 | Ga0068860_100083011 | Ga0068860_1000830115 | 151 |
| 534 | 3300005844 | Ga0068862_100141175 | Ga0068862_1001411753 | 151 |
| 535 | 3300006237 | Ga0097621_100225314 | Ga0097621_1002253142 | 151 |
| 536 | 3300006358 | Ga0068871_100832165 | Ga0068871_1008321651 | 151 |
| 537 | 3300006881 | Ga0068865_100118074 | Ga0068865_1001180742 | 151 |
| 538 | 3300006931 | Ga0097620_100267728 | Ga0097620_1002677282 | 151 |
| 539 | 3300009094 | Ga0111539_10040579 | Ga0111539_100405794 | 151 |
| 540 | 3300009094 | Ga0111539_10176858 | Ga0111539_101768583 | 151 |
| 541 | 3300009147 | Ga0114129_10376129 | Ga0114129_103761292 | 151 |
| 542 | 3300009148 | Ga0105243_10021952 | Ga0105243_100219524 | 151 |
| 543 | 3300009176 | Ga0105242_10031514 | Ga0105242_100315145 | 151 |
| 544 | 3300009177 | Ga0105248_10242749 | Ga0105248_102427492 | 151 |
| 545 | 3300009551 | Ga0105238_10093432 | Ga0105238_100934323 | 151 |
| 546 | 3300009553 | Ga0105249_10320768 | Ga0105249_103207682 | 151 |
| 547 | 3300010375 | Ga0105239_10381642 | Ga0105239_103816423 | 151 |
| 548 | 3300011119 | Ga0105246_10175913 | Ga0105246_101759133 | 151 |
| 549 | 3300013297 | Ga0157378_10003032 | Ga0157378_1000303212 | 151 |
| 550 | 3300013307 | Ga0157372_10883564 | Ga0157372_108835642 | 151 |
| 551 | 3300013308 | Ga0157375_10313520 | Ga0157375_103135202 | 151 |
| 552 | 3300014326 | Ga0157380_10148624 | Ga0157380_101486242 | 151 |
| 553 | 3300014745 | Ga0157377_10042535 | Ga0157377_100425353 | 151 |
| 554 | 3300014968 | Ga0157379_10057781 | Ga0157379_100577812 | 151 |
| 555 | 3300014969 | Ga0157376_10177650 | Ga0157376_101776503 | 151 |
| 556 | 3300025899 | Ga0207642_10032317 | Ga0207642_100323172 | 151 |
| 557 | 3300025901 | Ga0207688_10259718 | Ga0207688_102597181 | 151 |
| 558 | 3300025904 | Ga0207647_10389793 | Ga0207647_103897932 | 151 |
| 559 | 3300025908 | Ga0207643_10067417 | Ga0207643_100674173 | 151 |
| 560 | 3300025917 | Ga0207660_10737097 | Ga0207660_107370972 | 151 |
| 561 | 3300025918 | Ga0207662_10025525 | Ga0207662_100255255 | 151 |
| 562 | 3300025919 | Ga0207657_10300253 | Ga0207657_103002532 | 151 |
| 563 | 3300025920 | Ga0207649_10374254 | Ga0207649_103742542 | 151 |
| 564 | 3300025923 | Ga0207681_10023657 | Ga0207681_100236573 | 151 |
| 565 | 3300025925 | Ga0207650_10115980 | Ga0207650_101159803 | 151 |
| 566 | 3300025926 | Ga0207659_10131662 | Ga0207659_101316622 | 151 |
| 567 | 3300025932 | Ga0207690_10077228 | Ga0207690_100772282 | 151 |
| 568 | 3300025933 | Ga0207706_10117031 | Ga0207706_101170311 | 151 |
| 569 | 3300025935 | Ga0207709_10433971 | Ga0207709_104339712 | 151 |
| 570 | 3300025937 | Ga0207669_10007889 | Ga0207669_100078895 | 151 |
| 571 | 3300025938 | Ga0207704_10068329 | Ga0207704_100683292 | 151 |
| 572 | 3300025940 | Ga0207691_10053258 | Ga0207691_100532582 | 151 |
| 573 | 3300025941 | Ga0207711_10816570 | Ga0207711_108165702 | 151 |
| 574 | 3300025942 | Ga0207689_10036967 | Ga0207689_100369672 | 151 |
| 575 | 3300025944 | Ga0207661_10312778 | Ga0207661_103127782 | 151 |
| 576 | 3300025960 | Ga0207651_10295496 | Ga0207651_102954962 | 151 |
| 577 | 3300025961 | Ga0207712_10083803 | Ga0207712_100838032 | 151 |
| 578 | 3300025972 | Ga0207668_10165812 | Ga0207668_101658122 | 151 |
| 579 | 3300025981 | Ga0207640_10157200 | Ga0207640_101572002 | 151 |
| 580 | 3300026035 | Ga0207703_10283885 | Ga0207703_102838852 | 151 |
| 581 | 3300026075 | Ga0207708_10091470 | Ga0207708_100914703 | 151 |
| 582 | 3300026075 | Ga0207708_10128466 | Ga0207708_101284663 | 151 |
| 583 | 3300026089 | Ga0207648_10011867 | Ga0207648_1001186711 | 151 |
| 584 | 3300026116 | Ga0207674_10024303 | Ga0207674_100243033 | 151 |
| 585 | 3300026118 | Ga0207675_100071553 | Ga0207675_1000715533 | 151 |
| 586 | 3300026142 | Ga0207698_10308948 | Ga0207698_103089483 | 151 |
| 587 | 3300027717 | Ga0209998_10033015 | Ga0209998_100330152 | 151 |
| 588 | 3300027876 | Ga0209974_10215002 | Ga0209974_102150021 | 151 |
| 589 | 3300027907 | Ga0207428_10051142 | Ga0207428_100511423 | 151 |
| 590 | 3300028379 | Ga0268266_10230517 | Ga0268266_102305173 | 151 |
| 591 | 3300028381 | Ga0268264_10472653 | Ga0268264_104726532 | 151 |
| 592 | 3300028558 | Ga0265326_10025190 | Ga0265326_100251902 | 151 |
| 593 | 3300028573 | Ga0265334_10162197 | Ga0265334_101621972 | 151 |
| 594 | 3300028654 | Ga0265322_10025135 | Ga0265322_100251354 | 151 |
| 595 | 3300028800 | Ga0265338_10967764 | Ga0265338_109677641 | 151 |
| 596 | 3300031235 | Ga0265330_10024642 | Ga0265330_100246422 | 151 |
| 597 | 3300031235 | Ga0265330_10068322 | Ga0265330_100683222 | 151 |
| 598 | 3300031242 | Ga0265329_10007411 | Ga0265329_100074112 | 151 |
| 599 | 3300031344 | Ga0265316_10052534 | Ga0265316_100525343 | 151 |
| 600 | 3300031344 | Ga0265316_10144264 | Ga0265316_101442642 | 151 |
| 601 | 3300031711 | Ga0265314_10198205 | Ga0265314_101982054 | 151 |
| 602 | 3300031712 | Ga0265342_10004323 | Ga0265342_1000432311 | 151 |
| 603 | 3300047445 | Ga0495677_0336143 | Ga0495677_0336143_12_473 | 151 |
| 604 | 3300048905 | Ga0496102_0894371 | Ga0496102_0894371_282_737 | 151 |
| 605 | 3300050492 | nmdc:mga0yw44_207652_c1 | nmdc:mga0yw44_207652_c1_699_1160 | 151 |
| 606 | 3300050507 | nmdc:mga05p37_291185_c1 | nmdc:mga05p37_291185_c1_106_567 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hs9-assembly1.cif.gz_A | the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876 | 0.9759 | 2 | 137 |
| 8idu-assembly1.cif.gz_A | crystal structure of substrate bound-form dehydroquinate dehydratase from corynebacterium glutamicum | 0.9752 | 1 | 142 |
| 3n8k-assembly2.cif.gz_M | type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid | 0.9646 | 3 | 140 |
| 3kip-assembly3.cif.gz_I | crystal structure of type-ii 3-dehydroquinase from c. albicans | 0.963 | 1 | 135 |
| 2uyg-assembly1.cif.gz_F | crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus | 0.9625 | 4 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1gqoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9557 | 3 | 139 | 3.40.50.9100 |
| 4kiuM00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9363 | 3 | 139 | 3.40.50.9100 |
| 3kipN00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9242 | 1 | 139 | 3.40.50.9100 |
| 1gqoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9231 | 3 | 139 | 3.40.50.9100 |
| 1d0iH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9227 | 2 | 150 | 3.40.50.9100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A0QX71-F1-model_v4 | 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) | 0.9858 | 2 | 141 |
GO:0003855
GO:0008652 GO:0009073 GO:0009423 GO:0019631 |
| AF-A0A0H3GWB7-F1-model_v4 | 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) | 0.9856 | 1 | 144 |
GO:0003855
GO:0008652 GO:0009073 GO:0009423 GO:0019631 |
| AF-B8E0Z3-F1-model_v4 | 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) | 0.9852 | 1 | 143 |
GO:0003855
GO:0008652 GO:0009073 GO:0009423 GO:0019631 |
| AF-A0A0E4GBK7-F1-model_v4 | 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) | 0.9851 | 1 | 143 |
GO:0003855
GO:0008652 GO:0009073 GO:0009423 GO:0019631 |
| AF-A0A1E3B026-F1-model_v4 | Catabolic 3-dehydroquinase (cDHQase) (EC 4.2.1.10) (3-dehydroquinate dehydratase) | 0.9843 | 2 | 139 |
GO:0003855
GO:0004764 GO:0019631 GO:0046279 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar