F468558

General Info

Members Datasets Scaffolds Average Seq Length
606 273 606 148

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101879294|Ga0070708_1018792941
Length 149
Sequence MTKPVYILNGPNLDRLGTREPEIYGRTTLDEIHAMIRTRAGELGLEIVDCFQSNHEGELIDRLHRRDFDVSVVNAAGLTHTSVSLRDALTGIGRPFIEVHLSDPWERDAFRKVNFIHDVAFETIKGQGPKGYLFALEVIAERLTGATNG

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
188 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
193 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
194 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 7.76
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100068392 3300005330 Bacteria 2304
2 Ga0070670_100749214 3300005331 Bacteria 880
3 Ga0070670_101426507 3300005331 Bacteria 635
4 Ga0068869_100123624 3300005334 Bacteria 1982
5 Ga0068869_100136839 3300005334 Bacteria 1888
6 Ga0070666_10193615 3300005335 Bacteria 1429
7 Ga0070680_100000064 3300005336 Bacteria 55845
8 Ga0070680_100109073 3300005336 Bacteria 2303
9 Ga0070682_100072469 3300005337 Bacteria 2208
10 Ga0070682_100320174 3300005337 Bacteria 1145
11 Ga0070682_100887105 3300005337 Bacteria 732
12 Ga0068868_100093433 3300005338 Bacteria 2425
13 Ga0068868_100220440 3300005338 Bacteria 1588
14 Ga0068868_100230998 3300005338 Bacteria 1552
15 Ga0068868_101130455 3300005338 Bacteria 722
16 Ga0070660_100213094 3300005339 Bacteria 1569
17 Ga0070689_100037490 3300005340 Bacteria 3706
18 Ga0070689_101152026 3300005340 Bacteria 695
19 Ga0070691_10120011 3300005341 Bacteria 1323
20 Ga0070691_10123398 3300005341 Bacteria 1306
21 Ga0070687_100188326 3300005343 Unclassified 1241
22 Ga0070661_100197565 3300005344 Bacteria 1536
23 Ga0070692_10012592 3300005345 Bacteria 3920
24 Ga0070692_10270976 3300005345 Bacteria 1025
25 Ga0070668_100102089 3300005347 Unclassified 2274
26 Ga0070668_100224078 3300005347 Bacteria 1552
27 Ga0070668_100826879 3300005347 Bacteria 824
28 Ga0070668_101212462 3300005347 Bacteria 684
29 Ga0070669_100016773 3300005353 Bacteria 5227
30 Ga0070669_100319632 3300005353 Bacteria 1253
31 Ga0070675_100013259 3300005354 Bacteria 6477
32 Ga0070675_100855712 3300005354 Bacteria 832
33 Ga0070671_100582137 3300005355 Bacteria 967
34 Ga0070674_100038948 3300005356 Bacteria 3207
35 Ga0070674_100462924 3300005356 Bacteria 1049
36 Ga0070673_100231631 3300005364 Bacteria 1602
37 Ga0070659_100843351 3300005366 Bacteria 798
38 Ga0070714_101172012 3300005435 Unclassified 749
39 Ga0070701_10023624 3300005438 Unclassified 2964
40 Ga0070701_10436690 3300005438 Bacteria 837
41 Ga0070705_100034043 3300005440 Bacteria 2845
42 Ga0070705_100076960 3300005440 Bacteria 2036
43 Ga0070705_100178886 3300005440 Bacteria 1435
44 Ga0070705_100246413 3300005440 Bacteria 1252
45 Ga0070705_100495666 3300005440 Bacteria 926
46 Ga0070700_100061043 3300005441 Bacteria 2377
47 Ga0070700_100146502 3300005441 Bacteria 1610
48 Ga0070700_100212175 3300005441 Bacteria 1367
49 Ga0070700_100242695 3300005441 Bacteria 1288
50 Ga0070694_100109660 3300005444 Bacteria 1965
51 Ga0070694_100476323 3300005444 Bacteria 990
52 Ga0070694_100500502 3300005444 Bacteria 967
53 Ga0070708_100029319 3300005445 Bacteria 4744
54 Ga0070708_100030313 3300005445 Bacteria 4675
55 Ga0070708_100458916 3300005445 Bacteria 1202
56 Ga0070708_101879294 3300005445 Bacteria 555
57 Ga0070678_100155180 3300005456 Bacteria 1848
58 Ga0070678_101938210 3300005456 Bacteria 557
59 Ga0070662_100262510 3300005457 Bacteria 1392
60 Ga0070681_11075180 3300005458 Unclassified 725
61 Ga0068867_100236391 3300005459 Bacteria 1479
62 Ga0070706_100005018 3300005467 Bacteria 12654
63 Ga0070706_100047843 3300005467 Bacteria 3947
64 Ga0070706_100553818 3300005467 Bacteria 1070
65 Ga0070707_100006720 3300005468 Bacteria 10659
66 Ga0070707_100011522 3300005468 Bacteria 8244
67 Ga0070707_100064043 3300005468 Bacteria 3529
68 Ga0070707_100328616 3300005468 Bacteria 1486
69 Ga0070698_100003028 3300005471 Bacteria 18521
70 Ga0070698_100011233 3300005471 Bacteria 9511
71 Ga0070698_100071030 3300005471 Bacteria 3492
72 Ga0070698_100303809 3300005471 Bacteria 1526
73 Ga0070698_101710385 3300005471 Bacteria 581
74 Ga0070699_100009488 3300005518 Bacteria 8427
75 Ga0070699_100470666 3300005518 Bacteria 1140
76 Ga0070699_100940783 3300005518 Bacteria 792
77 Ga0070699_101196585 3300005518 Bacteria 697
78 Ga0070679_100483867 3300005530 Bacteria 1182
79 Ga0070684_101453023 3300005535 Bacteria 646
80 Ga0070697_100018732 3300005536 Bacteria 5462
81 Ga0070697_100021089 3300005536 Bacteria 5160
82 Ga0070697_100093146 3300005536 Bacteria 2494
83 Ga0070697_100105447 3300005536 Bacteria 2345
84 Ga0070697_100930605 3300005536 Bacteria 772
85 Ga0070697_101465874 3300005536 Bacteria 610
86 Ga0068853_100635447 3300005539 Bacteria 1015
87 Ga0070686_100051300 3300005544 Bacteria 2625
88 Ga0070686_100138261 3300005544 Bacteria 1693
89 Ga0070686_100245029 3300005544 Bacteria 1307
90 Ga0070686_101178098 3300005544 Bacteria 636
91 Ga0070695_100043376 3300005545 Bacteria 2860
92 Ga0070695_100370184 3300005545 Bacteria 1079
93 Ga0070695_100476566 3300005545 Bacteria 961
94 Ga0070696_100005146 3300005546 Bacteria 8742
95 Ga0070696_100101674 3300005546 Bacteria 2060
96 Ga0070696_100335096 3300005546 Bacteria 1168
97 Ga0070696_101022048 3300005546 Bacteria 691
98 Ga0070693_100059608 3300005547 Bacteria 2213
99 Ga0070693_100873944 3300005547 Bacteria 672
100 Ga0070693_100881419 3300005547 Bacteria 669
101 Ga0070704_100054595 3300005549 Bacteria 2828
102 Ga0068855_100585401 3300005563 Bacteria 1205
103 Ga0070664_101121284 3300005564 Bacteria 741
104 Ga0068857_100085746 3300005577 Bacteria 2815
105 Ga0068857_100195777 3300005577 Bacteria 1841
106 Ga0068857_100405852 3300005577 Unclassified 1268
107 Ga0068854_100079223 3300005578 Bacteria 2422
108 Ga0068854_100211304 3300005578 Bacteria 1530
109 Ga0068854_100307982 3300005578 Bacteria 1284
110 Ga0070702_100038924 3300005615 Bacteria 2651
111 Ga0070702_100084196 3300005615 Bacteria 1912
112 Ga0068852_100258049 3300005616 Bacteria 1672
113 Ga0068859_100267721 3300005617 Bacteria 1801
114 Ga0068859_100485362 3300005617 Bacteria 1331
115 Ga0068864_100034436 3300005618 Bacteria 4308
116 Ga0068866_10053756 3300005718 Bacteria 2060
117 Ga0068866_10491641 3300005718 Bacteria 810
118 Ga0068861_100316862 3300005719 Bacteria 1357
119 Ga0068861_101580160 3300005719 Bacteria 646
120 Ga0068870_10118048 3300005840 Bacteria 1524
121 Ga0068870_10167404 3300005840 Bacteria 1309
122 Ga0068870_10172368 3300005840 Bacteria 1292
123 Ga0068858_100526779 3300005842 Bacteria 1143
124 Ga0068860_100083011 3300005843 Bacteria 3047
125 Ga0068862_100130184 3300005844 Bacteria 2225
126 Ga0068862_100141175 3300005844 Bacteria 2138
127 Ga0068862_100228015 3300005844 Bacteria 1689
128 Ga0081455_10357646 3300005937 Bacteria 1028
129 Ga0070712_100511237 3300006175 Bacteria 1008
130 Ga0097621_100225314 3300006237 Bacteria 1635
131 Ga0068871_100832165 3300006358 Unclassified 852
132 Ga0075428_100867293 3300006844 Bacteria 958
133 Ga0075431_100217820 3300006847 Bacteria 1948
134 Ga0075433_11336032 3300006852 Bacteria 621
135 Ga0075434_100223052 3300006871 Bacteria 1905
136 Ga0075434_100287007 3300006871 Bacteria 1665
137 Ga0075434_100412327 3300006871 Bacteria 1372
138 Ga0068865_100064837 3300006881 Bacteria 2572
139 Ga0068865_100118074 3300006881 Bacteria 1967
140 Ga0075436_100314098 3300006914 Bacteria 1125
141 Ga0075436_100756326 3300006914 Bacteria 722
142 Ga0097620_100267728 3300006931 Bacteria 1801
143 Ga0097620_100485312 3300006931 Bacteria 1331
144 Ga0075435_100049453 3300007076 Bacteria 3382
145 Ga0111539_10040579 3300009094 Bacteria 5601
146 Ga0111539_10176858 3300009094 Bacteria 2493
147 Ga0111539_10215328 3300009094 Bacteria 2238
148 Ga0111539_10666138 3300009094 Bacteria 1212
149 Ga0111539_10950171 3300009094 Bacteria 999
150 Ga0105245_10016155 3300009098 Bacteria 6505
151 Ga0105245_10063385 3300009098 Bacteria 3337
152 Ga0105245_10189985 3300009098 Bacteria 1967
153 Ga0114129_10260085 3300009147 Bacteria 2327
154 Ga0114129_10376129 3300009147 Bacteria 1877
155 Ga0114129_10488095 3300009147 Bacteria 1611
156 Ga0114129_11124739 3300009147 Bacteria 982
157 Ga0114129_11983200 3300009147 Bacteria 704
158 Ga0105243_10021952 3300009148 Bacteria 4848
159 Ga0105243_10052898 3300009148 Bacteria 3218
160 Ga0105243_10463787 3300009148 Bacteria 1192
161 Ga0105243_11115908 3300009148 Bacteria 798
162 Ga0105243_11211641 3300009148 Bacteria 768
163 Ga0105241_10747713 3300009174 Bacteria 896
164 Ga0105242_10031514 3300009176 Bacteria 4236
165 Ga0105242_10141908 3300009176 Bacteria 2085
166 Ga0105242_11042471 3300009176 Bacteria 828
167 Ga0105242_11680178 3300009176 Bacteria 671
168 Ga0105242_11727077 3300009176 Bacteria 663
169 Ga0105248_10242749 3300009177 Bacteria 2028
170 Ga0105248_11176222 3300009177 Bacteria 867
171 Ga0105238_10093432 3300009551 Bacteria 2996
172 Ga0105249_10175104 3300009553 Bacteria 2083
173 Ga0105249_10320768 3300009553 Bacteria 1560
174 Ga0105249_10701692 3300009553 Bacteria 1072
175 Ga0105249_10866895 3300009553 Bacteria 969
176 Ga0105249_11833816 3300009553 Bacteria 679
177 Ga0105239_10381642 3300010375 Bacteria 1593
178 Ga0105239_10445367 3300010375 Bacteria 1469
179 Ga0105239_11349683 3300010375 Bacteria 823
180 Ga0105246_10175913 3300011119 Bacteria 1643
181 Ga0105246_10211192 3300011119 Bacteria 1515
182 Ga0157371_10915854 3300013102 Bacteria 665
183 Ga0157374_11878538 3300013296 Bacteria 625
184 Ga0157378_10003032 3300013297 Bacteria 14929
185 Ga0157378_10024428 3300013297 Bacteria 5318
186 Ga0157378_10307421 3300013297 Bacteria 1536
187 Ga0157378_10434883 3300013297 Unclassified 1299
188 Ga0157372_10883564 3300013307 Bacteria 1037
189 Ga0157375_10151635 3300013308 Bacteria 2454
190 Ga0157375_10313520 3300013308 Bacteria 1733
191 Ga0157375_12144122 3300013308 Bacteria 665
192 Ga0163163_10105205 3300014325 Bacteria 2848
193 Ga0157380_10148624 3300014326 Bacteria 2022
194 Ga0157380_10248278 3300014326 Bacteria 1609
195 Ga0157380_12551356 3300014326 Bacteria 577
196 Ga0182008_10521155 3300014497 Bacteria 656
197 Ga0157377_10042535 3300014745 Bacteria 2523
198 Ga0157379_10057781 3300014968 Bacteria 3467
199 Ga0157379_10477344 3300014968 Bacteria 1154
200 Ga0157379_11070740 3300014968 Bacteria 771
201 Ga0157376_10177650 3300014969 Bacteria 1943
202 Ga0207642_10032317 3300025899 Bacteria 2202
203 Ga0207688_10115639 3300025901 Bacteria 1561
204 Ga0207688_10259718 3300025901 Bacteria 1054
205 Ga0207647_10389793 3300025904 Unclassified 786
206 Ga0207645_10045596 3300025907 Bacteria 2801
207 Ga0207645_10077240 3300025907 Bacteria 2133
208 Ga0207643_10067417 3300025908 Bacteria 2054
209 Ga0207643_10491262 3300025908 Bacteria 784
210 Ga0207684_10017135 3300025910 Bacteria 6218
211 Ga0207684_10058459 3300025910 Bacteria 3272
212 Ga0207660_10000002 3300025917 Bacteria 883566
213 Ga0207660_10377251 3300025917 Bacteria 1139
214 Ga0207660_10737097 3300025917 Bacteria 804
215 Ga0207660_11057548 3300025917 Bacteria 662
216 Ga0207662_10008434 3300025918 Bacteria 5640
217 Ga0207662_10025525 3300025918 Bacteria 3403
218 Ga0207662_10381392 3300025918 Bacteria 952
219 Ga0207657_10300253 3300025919 Bacteria 1272
220 Ga0207649_10374254 3300025920 Unclassified 1060
221 Ga0207646_10141769 3300025922 Bacteria 2165
222 Ga0207646_10231031 3300025922 Unclassified 1671
223 Ga0207646_10237906 3300025922 Bacteria 1645
224 Ga0207646_10388851 3300025922 Bacteria 1260
225 Ga0207681_10023657 3300025923 Bacteria 3933
226 Ga0207650_10115980 3300025925 Bacteria 2079
227 Ga0207650_10348816 3300025925 Bacteria 1217
228 Ga0207659_10131662 3300025926 Bacteria 1931
229 Ga0207687_10053169 3300025927 Bacteria 2828
230 Ga0207687_10072848 3300025927 Bacteria 2458
231 Ga0207687_11348594 3300025927 Bacteria 613
232 Ga0207664_11351570 3300025929 Unclassified 633
233 Ga0207690_10077228 3300025932 Bacteria 2314
234 Ga0207706_10049698 3300025933 Bacteria 3705
235 Ga0207706_10117031 3300025933 Bacteria 2344
236 Ga0207706_10207558 3300025933 Bacteria 1717
237 Ga0207686_10615321 3300025934 Bacteria 856
238 Ga0207709_10029558 3300025935 Bacteria 3180
239 Ga0207709_10300355 3300025935 Bacteria 1193
240 Ga0207709_10433971 3300025935 Bacteria 1012
241 Ga0207709_10670865 3300025935 Bacteria 827
242 Ga0207670_10323127 3300025936 Bacteria 1215
243 Ga0207669_10007889 3300025937 Bacteria 4962
244 Ga0207669_10012039 3300025937 Bacteria 4237
245 Ga0207669_11561848 3300025937 Bacteria 563
246 Ga0207704_10026976 3300025938 Bacteria 3159
247 Ga0207704_10068329 3300025938 Bacteria 2239
248 Ga0207691_10053258 3300025940 Bacteria 3695
249 Ga0207691_10373837 3300025940 Bacteria 1217
250 Ga0207711_10816570 3300025941 Bacteria 868
251 Ga0207711_11615396 3300025941 Unclassified 592
252 Ga0207689_10036967 3300025942 Bacteria 4053
253 Ga0207689_10063130 3300025942 Bacteria 3047
254 Ga0207689_10265201 3300025942 Bacteria 1421
255 Ga0207661_10312778 3300025944 Bacteria 1410
256 Ga0207679_11421655 3300025945 Bacteria 636
257 Ga0207667_10501174 3300025949 Bacteria 1232
258 Ga0207651_10295496 3300025960 Bacteria 1345
259 Ga0207651_10353110 3300025960 Bacteria 1239
260 Ga0207712_10083803 3300025961 Bacteria 2328
261 Ga0207668_10035673 3300025972 Bacteria 3314
262 Ga0207668_10165812 3300025972 Bacteria 1727
263 Ga0207640_10157200 3300025981 Bacteria 1677
264 Ga0207640_10216180 3300025981 Bacteria 1464
265 Ga0207640_10834628 3300025981 Bacteria 801
266 Ga0207640_11408445 3300025981 Bacteria 625
267 Ga0207677_10241468 3300026023 Bacteria 1462
268 Ga0207677_10382496 3300026023 Bacteria 1188
269 Ga0207703_10283885 3300026035 Bacteria 1504
270 Ga0207703_10375552 3300026035 Bacteria 1314
271 Ga0207639_10985834 3300026041 Bacteria 789
272 Ga0207678_11483552 3300026067 Bacteria 599
273 Ga0207708_10091470 3300026075 Bacteria 2346
274 Ga0207708_10128466 3300026075 Bacteria 1980
275 Ga0207708_10292774 3300026075 Bacteria 1322
276 Ga0207708_10452371 3300026075 Bacteria 1070
277 Ga0207708_10533597 3300026075 Bacteria 987
278 Ga0207648_10011867 3300026089 Bacteria 8188
279 Ga0207674_10024303 3300026116 Bacteria 6478
280 Ga0207674_10192470 3300026116 Bacteria 1989
281 Ga0207674_10212681 3300026116 Bacteria 1882
282 Ga0207675_100044545 3300026118 Bacteria 4147
283 Ga0207675_100071553 3300026118 Bacteria 3243
284 Ga0207683_11756630 3300026121 Bacteria 569
285 Ga0207698_10308948 3300026142 Bacteria 1475
286 Ga0209983_1021016 3300027665 Bacteria 1363
287 Ga0209998_10023192 3300027717 Bacteria 1341
288 Ga0209998_10033015 3300027717 Bacteria 1152
289 Ga0209974_10215002 3300027876 Bacteria 714
290 Ga0207428_10051142 3300027907 Bacteria 3303
291 Ga0207428_10119707 3300027907 Bacteria 2020
292 Ga0268266_10230517 3300028379 Bacteria 1706
293 Ga0268265_10771492 3300028380 Bacteria 935
294 Ga0268264_10472653 3300028381 Bacteria 1218
295 Ga0265326_10025190 3300028558 Bacteria 1696
296 Ga0265319_1002616 3300028563 Bacteria 9700
297 Ga0265334_10101765 3300028573 Bacteria 1039
298 Ga0265334_10162197 3300028573 Bacteria 785
299 Ga0265318_10015272 3300028577 Bacteria 3199
300 Ga0265318_10020174 3300028577 Bacteria 2692
301 Ga0265318_10038176 3300028577 Bacteria 1837
302 Ga0265318_10149004 3300028577 Bacteria 858
303 Ga0265322_10011152 3300028654 Bacteria 2607
304 Ga0265322_10025135 3300028654 Bacteria 1703
305 Ga0265336_10010948 3300028666 Bacteria 3092
306 Ga0265336_10117665 3300028666 Bacteria 791
307 Ga0265338_10075958 3300028800 Bacteria 2848
308 Ga0265338_10699813 3300028800 Bacteria 699
309 Ga0265338_10967764 3300028800 Bacteria 577
310 Ga0265324_10008203 3300029957 Bacteria 4168
311 Ga0265324_10014166 3300029957 Bacteria 2957
312 Ga0265330_10024642 3300031235 Bacteria 2729
313 Ga0265330_10068322 3300031235 Bacteria 1539
314 Ga0265328_10045638 3300031239 Bacteria 1611
315 Ga0265320_10001226 3300031240 Bacteria 18848
316 Ga0265320_10009070 3300031240 Bacteria 6032
317 Ga0265320_10039466 3300031240 Bacteria 2361
318 Ga0265325_10017224 3300031241 Bacteria 4018
319 Ga0265325_10021027 3300031241 Bacteria 3591
320 Ga0265325_10064891 3300031241 Bacteria 1845
321 Ga0265325_10337454 3300031241 Bacteria 667
322 Ga0265329_10004843 3300031242 Bacteria 5527
323 Ga0265329_10007411 3300031242 Bacteria 4248
324 Ga0265329_10022566 3300031242 Bacteria 2104
325 Ga0265329_10299750 3300031242 Bacteria 543
326 Ga0265340_10004346 3300031247 Bacteria 7939
327 Ga0265339_10010068 3300031249 Bacteria 5892
328 Ga0265339_10190920 3300031249 Bacteria 1015
329 Ga0265327_10130370 3300031251 Bacteria 1184
330 Ga0265316_10052534 3300031344 Bacteria 3196
331 Ga0265316_10055834 3300031344 Bacteria 3087
332 Ga0265316_10144264 3300031344 Bacteria 1786
333 Ga0307408_100185473 3300031548 Bacteria 1672
334 Ga0265313_10032782 3300031595 Bacteria 2647
335 Ga0265313_10035007 3300031595 Bacteria 2533
336 Ga0265314_10002544 3300031711 Bacteria 18542
337 Ga0265314_10198205 3300031711 Bacteria 1189
338 Ga0265342_10004323 3300031712 Bacteria 11242
339 Ga0316576_10078218 3300031727 Bacteria 2451
340 Ga0316576_10615296 3300031727 Bacteria 792
341 Ga0307405_11056533 3300031731 Bacteria 696
342 Ga0316577_10036067 3300031733 Bacteria 2764
343 Ga0307410_10578661 3300031852 Bacteria 934
344 Ga0307407_10255084 3300031903 Bacteria 1204
345 Ga0307407_10409024 3300031903 Unclassified 975
346 Ga0307409_100061092 3300031995 Bacteria 2943
347 Ga0307416_100116570 3300032002 Bacteria 2368
348 Ga0307416_100345429 3300032002 Bacteria 1503
349 Ga0307411_11519720 3300032005 Bacteria 616
350 Ga0307415_100004806 3300032126 Bacteria 7085
351 Ga0316583_10171845 3300032133 Bacteria 754
352 Ga0373932_0030008 3300035112 Bacteria 1505
353 Ga0373962_0086642 3300035242 Bacteria 959
354 Ga0316574_0124590 3300035398 Bacteria 1655
355 Ga0373931_0062743 3300035691 Bacteria 2007
356 Ga0373931_0420444 3300035691 Bacteria 850
357 Ga0373937_1417881 3300036401 Bacteria 642
358 Ga0316582_0044485 3300036647 Bacteria 2791
359 Ga0316582_0257041 3300036647 Bacteria 1197
360 Ga0395905_0581528 3300037471 Bacteria 1021
361 Ga0316581_0072732 3300037588 Bacteria 1056
362 Ga0395901_0293125 3300038443 Bacteria 1688
363 Ga0436365_0347259 3300039437 Bacteria 3323
364 Ga0439438_088329 3300041405 Bacteria 757
365 Ga0439466_0054668 3300041411 Bacteria 1300
366 Ga0439466_0116324 3300041411 Bacteria 827
367 Ga0451793_0196950 3300041452 Bacteria 584
368 Ga0451807_1643506 3300041486 Bacteria 790
369 Ga0451841_1279542 3300041498 Bacteria 707
370 Ga0451851_0789716 3300041507 Bacteria 848
371 Ga0451853_0662573 3300041512 Unclassified 953
372 Ga0439441_001582 3300042001 Bacteria 3025
373 Ga0450923_156723 3300042125 Bacteria 553
374 Ga0450923_173881 3300042125 Bacteria 528
375 Ga0450910_004004 3300042147 Bacteria 1979
376 Ga0450910_019691 3300042147 Bacteria 1015
377 Ga0450908_035093 3300042184 Bacteria 870
378 Ga0450909_034182 3300042185 Bacteria 775
379 Ga0451577_1172157 3300042876 Bacteria 686
380 Ga0453683_0192239 3300044673 Bacteria 1295
381 Ga0451576_1006894 3300045051 Bacteria 873
382 Ga0495641_0117312 3300046461 Bacteria 1187
383 Ga0495651_0023352 3300046462 Bacteria 4808
384 Ga0495651_0433057 3300046462 Bacteria 853
385 Ga0495618_0782455 3300046514 Bacteria 557
386 Ga0495630_0132659 3300046517 Bacteria 1892
387 Ga0495640_0373403 3300046533 Bacteria 878
388 Ga0495634_0192317 3300046642 Bacteria 1272
389 Ga0495657_0646914 3300046675 Bacteria 610
390 Ga0495599_0424970 3300046678 Bacteria 789
391 Ga0495624_0643505 3300046690 Bacteria 631
392 Ga0495600_0439443 3300046809 Bacteria 808
393 Ga0495604_0308816 3300047317 Bacteria 1060
394 Ga0495674_0891033 3300047319 Bacteria 687
395 Ga0495675_0404711 3300047444 Bacteria 795
396 Ga0495677_0336143 3300047445 Bacteria 595
397 Ga0495602_0100628 3300048088 Bacteria 2373
398 Ga0495602_0190879 3300048088 Bacteria 1571
399 Ga0496100_1062761 3300048903 Bacteria 637
400 Ga0496100_1623782 3300048903 Unclassified 511
401 Ga0496101_0006551 3300048904 Bacteria 7500
402 Ga0496101_0514735 3300048904 Bacteria 946
403 Ga0496102_0136558 3300048905 Bacteria 2298
404 Ga0496102_0182680 3300048905 Bacteria 1976
405 Ga0496102_0894371 3300048905 Bacteria 810
406 Ga0496102_1742865 3300048905 Bacteria 540
407 Ga0496103_0179915 3300048906 Bacteria 1359
408 Ga0496104_0182135 3300048907 Bacteria 2011
409 Ga0496104_0313586 3300048907 Bacteria 1481
410 Ga0496104_1009341 3300048907 Bacteria 736
411 Ga0496105_0025812 3300048908 Bacteria 4786
412 Ga0496105_0064463 3300048908 Bacteria 3023
413 Ga0496105_0348511 3300048908 Bacteria 1183
414 Ga0496105_0824766 3300048908 Bacteria 704
415 Ga0496106_1454746 3300048909 Bacteria 528
416 Ga0496107_0100929 3300048910 Bacteria 2116
417 Ga0496107_0428827 3300048910 Unclassified 983
418 Ga0496108_0025060 3300048911 Bacteria 4915
419 Ga0496108_0060962 3300048911 Bacteria 3174
420 Ga0496108_0144050 3300048911 Bacteria 2053
421 Ga0496108_0166394 3300048911 Bacteria 1907
422 Ga0496109_0009839 3300048912 Bacteria 8161
423 Ga0496109_0069119 3300048912 Bacteria 3238
424 Ga0496109_0156520 3300048912 Bacteria 2134
425 Ga0496109_0157410 3300048912 Bacteria 2128
426 Ga0496109_0629679 3300048912 Bacteria 1009
427 Ga0496110_0091358 3300048913 Bacteria 2723
428 Ga0496110_0134063 3300048913 Bacteria 2238
429 Ga0496110_0175716 3300048913 Bacteria 1944
430 Ga0496111_0271503 3300048914 Bacteria 1258
431 Ga0496112_0000098 3300048915 Bacteria 56421
432 Ga0496112_0112510 3300048915 Bacteria 2693
433 Ga0496112_0261497 3300048915 Bacteria 1680
434 Ga0496112_0519953 3300048915 Bacteria 1125
435 Ga0496112_0567524 3300048915 Bacteria 1068
436 Ga0496113_0016363 3300048916 Bacteria 5122
437 Ga0496113_0049277 3300048916 Unclassified 3136
438 Ga0496113_0141285 3300048916 Bacteria 1895
439 Ga0496113_0541861 3300048916 Bacteria 934
440 Ga0496114_0005648 3300048917 Bacteria 9808
441 Ga0496114_0649343 3300048917 Bacteria 928
442 Ga0496114_1078640 3300048917 Bacteria 688
443 Ga0496114_1359364 3300048917 Bacteria 597
444 Ga0501031_0012895 3300049568 Bacteria 5460
445 Ga0501031_0112241 3300049568 Bacteria 1780
446 Ga0501031_0123908 3300049568 Bacteria 1688
447 Ga0501031_0793235 3300049568 Bacteria 607
448 Ga0501032_0651644 3300049569 Bacteria 669
449 Ga0501033_0070780 3300049570 Bacteria 2562
450 Ga0501036_0049920 3300049572 Bacteria 3544
451 Ga0501036_0133330 3300049572 Bacteria 2096
452 Ga0501036_0388146 3300049572 Bacteria 1165
453 Ga0501036_0841775 3300049572 Bacteria 754
454 Ga0501036_1231487 3300049572 Bacteria 609
455 Ga0501037_0044880 3300049573 Bacteria 3245
456 Ga0501037_0323223 3300049573 Bacteria 1068
457 Ga0501037_1124276 3300049573 Bacteria 508
458 Ga0501038_0033237 3300049574 Bacteria 4544
459 Ga0501038_0132177 3300049574 Bacteria 2048
460 Ga0501038_0212084 3300049574 Bacteria 1549
461 Ga0501038_0464997 3300049574 Bacteria 971
462 Ga0501038_0881486 3300049574 Bacteria 661
463 Ga0501039_0048851 3300049575 Bacteria 3271
464 Ga0501039_0052113 3300049575 Bacteria 3166
465 Ga0501039_0253543 3300049575 Bacteria 1383
466 Ga0501039_0371126 3300049575 Bacteria 1124
467 Ga0501040_0003818 3300049576 Bacteria 9774
468 Ga0501040_0021971 3300049576 Bacteria 4266
469 Ga0501040_0032384 3300049576 Bacteria 3537
470 Ga0501040_0058738 3300049576 Bacteria 2642
471 Ga0501040_0120915 3300049576 Bacteria 1837
472 Ga0501040_0178934 3300049576 Bacteria 1503
473 Ga0501041_0014508 3300049577 Bacteria 4680
474 Ga0501041_0020238 3300049577 Bacteria 3976
475 Ga0501041_0039211 3300049577 Bacteria 2875
476 Ga0501041_0042474 3300049577 Bacteria 2763
477 Ga0501041_0075737 3300049577 Bacteria 2070
478 Ga0501041_0079735 3300049577 Bacteria 2015
479 Ga0501042_0093254 3300049578 Bacteria 2162
480 Ga0501042_0107737 3300049578 Bacteria 2006
481 Ga0501042_0164726 3300049578 Bacteria 1599
482 Ga0501042_0339815 3300049578 Bacteria 1085
483 Ga0501042_0662065 3300049578 Bacteria 759
484 Ga0501042_0690799 3300049578 Bacteria 742
485 Ga0501043_0023595 3300049579 Bacteria 4825
486 Ga0501043_0270823 3300049579 Bacteria 1304
487 Ga0501046_0068309 3300049580 Bacteria 2767
488 Ga0501046_0076648 3300049580 Bacteria 2590
489 Ga0501046_0330019 3300049580 Bacteria 1110
490 Ga0501047_1104934 3300049581 Bacteria 606
491 Ga0501048_0062362 3300049582 Bacteria 2638
492 Ga0501048_0116204 3300049582 Bacteria 1890
493 Ga0501048_0261926 3300049582 Bacteria 1228
494 Ga0501048_0285276 3300049582 Bacteria 1174
495 Ga0501048_0718455 3300049582 Bacteria 717
496 Ga0501067_0212450 3300049583 Bacteria 1077
497 Ga0501068_0550259 3300049584 Bacteria 750
498 Ga0501068_0557647 3300049584 Bacteria 745
499 Ga0501069_0016906 3300049585 Bacteria 3920
500 Ga0501069_0022459 3300049585 Bacteria 3432
501 Ga0501070_0120823 3300049586 Bacteria 2165
502 Ga0501070_0178885 3300049586 Bacteria 1746
503 Ga0501071_0012113 3300049587 Bacteria 5833
504 Ga0501071_0029835 3300049587 Bacteria 3852
505 Ga0501071_0088916 3300049587 Bacteria 2266
506 Ga0501071_0123344 3300049587 Bacteria 1921
507 Ga0501071_0236032 3300049587 Bacteria 1378
508 Ga0501071_0315794 3300049587 Bacteria 1186
509 Ga0501071_0372121 3300049587 Bacteria 1089
510 Ga0501072_0011361 3300049588 Bacteria 6805
511 Ga0501072_0049781 3300049588 Bacteria 3298
512 Ga0501072_0104541 3300049588 Bacteria 2251
513 Ga0501072_0334369 3300049588 Bacteria 1203
514 Ga0501072_0733308 3300049588 Bacteria 776
515 Ga0501073_0044364 3300049589 Bacteria 3134
516 Ga0501073_0701719 3300049589 Bacteria 698
517 Ga0501074_0034551 3300049590 Bacteria 3664
518 Ga0501074_0161060 3300049590 Bacteria 1603
519 Ga0501074_0298494 3300049590 Bacteria 1144
520 Ga0501075_0007785 3300049591 Bacteria 7438
521 Ga0501075_0009521 3300049591 Bacteria 6799
522 Ga0501075_0037370 3300049591 Bacteria 3627
523 Ga0501075_0047359 3300049591 Bacteria 3231
524 Ga0501075_0187626 3300049591 Bacteria 1577
525 Ga0501075_0417107 3300049591 Bacteria 1024
526 Ga0501075_0649592 3300049591 Bacteria 804
527 Ga0501075_0955425 3300049591 Unclassified 651
528 Ga0501075_1239405 3300049591 Bacteria 566
529 Ga0501076_0071511 3300049592 Bacteria 2775
530 Ga0501076_0153849 3300049592 Bacteria 1871
531 Ga0501076_0185167 3300049592 Bacteria 1698
532 Ga0501076_0214259 3300049592 Bacteria 1574
533 Ga0501076_0288909 3300049592 Bacteria 1343
534 Ga0501076_1048380 3300049592 Bacteria 672
535 Ga0501077_0012888 3300049593 Bacteria 5237
536 Ga0501077_0025972 3300049593 Bacteria 3715
537 Ga0501077_0032309 3300049593 Bacteria 3332
538 Ga0501077_0034977 3300049593 Bacteria 3198
539 Ga0501079_0032539 3300049741 Bacteria 4010
540 Ga0501079_0037474 3300049741 Bacteria 3737
541 Ga0501079_0054487 3300049741 Bacteria 3084
542 Ga0501079_0103590 3300049741 Bacteria 2207
543 Ga0501079_0103887 3300049741 Bacteria 2204
544 Ga0501079_0131802 3300049741 Bacteria 1945
545 Ga0501080_0029655 3300049742 Bacteria 5092
546 Ga0501080_0034338 3300049742 Bacteria 4734
547 Ga0501080_0101670 3300049742 Bacteria 2667
548 Ga0501080_1013706 3300049742 Bacteria 720
549 Ga0501081_0024997 3300049743 Bacteria 4015
550 Ga0501081_0084743 3300049743 Bacteria 2223
551 Ga0501081_0096676 3300049743 Bacteria 2083
552 Ga0501081_0242711 3300049743 Bacteria 1314
553 Ga0501081_0625964 3300049743 Bacteria 806
554 Ga0501083_0112226 3300049744 Bacteria 1791
555 Ga0501035_0089541 3300049822 Bacteria 2710
556 Ga0501035_0217364 3300049822 Bacteria 1633
557 Ga0501044_0318432 3300049823 Bacteria 1480
558 Ga0501045_0005760 3300049824 Bacteria 8573
559 Ga0501045_0014739 3300049824 Bacteria 5542
560 Ga0501045_0051355 3300049824 Bacteria 3009
561 Ga0501045_0064976 3300049824 Bacteria 2679
562 Ga0501045_0118173 3300049824 Bacteria 1967
563 Ga0501045_0143371 3300049824 Bacteria 1777
564 Ga0501045_0206460 3300049824 Bacteria 1464
565 nmdc:mga0yw44_207652_c1 3300050492 Bacteria 1295
566 nmdc:mga05p37_291185_c1 3300050507 Bacteria 1943
567 nmdc:mga05p37_342691_c1 3300050507 Bacteria 1762
568 nmdc:mga05p37_824661_c1 3300050507 Bacteria 1011
569 nmdc:mga06r32_119337_c1 3300050510 Bacteria 2600
570 nmdc:mga08y16_1148637_c1 3300050511 Bacteria 749
571 nmdc:mga08y16_181149_c1 3300050511 Bacteria 2188
572 nmdc:mga08y16_94926_c1 3300050511 Bacteria 3107
573 nmdc:mga0n895_189236_c1 3300050512 Bacteria 2089
574 nmdc:mga0n895_317692_c1 3300050512 Bacteria 1578
575 nmdc:mga0rr50_110431_c1 3300050513 Bacteria 2175
576 nmdc:mga0rr50_59636_c1 3300050513 Bacteria 2866
577 nmdc:mga08x19_1021961_c1 3300050514 Bacteria 587
578 nmdc:mga08x19_328459_c1 3300050514 Bacteria 1065
579 nmdc:mga0a205_1182214_c1 3300050515 Bacteria 612
580 nmdc:mga0a205_156715_c1 3300050515 Bacteria 2175
581 nmdc:mga0a205_63714_c1 3300050515 Bacteria 3561
582 Ga0495601_0355096 3300053077 Bacteria 953
583 Ga0495612_0351531 3300053078 Bacteria 666
584 Ga0495595_0403847 3300053084 Bacteria 692
585 Ga0501084_0016480 3300054114 Bacteria 6136
586 Ga0501084_0079234 3300054114 Bacteria 2753
587 Ga0501084_0119763 3300054114 Bacteria 2213
588 Ga0501084_0128484 3300054114 Bacteria 2133
589 Ga0501084_0373527 3300054114 Bacteria 1205
590 Ga0501084_0695825 3300054114 Bacteria 857
591 Ga0501084_1079535 3300054114 Bacteria 674
592 Ga0501082_0046235 3300060353 Bacteria 3752
593 Ga0501082_0048928 3300060353 Bacteria 3645
594 Ga0501082_0053683 3300060353 Bacteria 3473
595 Ga0501082_0179399 3300060353 Bacteria 1842
596 Ga0501082_0224053 3300060353 Bacteria 1636
597 Ga0501082_0301863 3300060353 Bacteria 1394
598 Ga0501082_1612989 3300060353 Bacteria 566
599 Ga0530510_0002811 3300061734 Bacteria 11973
600 Ga0530510_0010156 3300061734 Bacteria 6599
601 Ga0530510_0026774 3300061734 Bacteria 4130
602 Ga0530510_0060038 3300061734 Bacteria 2751
603 Ga0530510_0177881 3300061734 Bacteria 1577
604 Ga0530510_0217593 3300061734 Bacteria 1419
605 Ga0530510_0399575 3300061734 Unclassified 1036
606 Ga0530510_0411435 3300061734 Bacteria 1020

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042125 Ga0450923_156723 Ga0450923_156723_121_540 135
2 3300035691 Ga0373931_0062743 Ga0373931_0062743_1580_1996 138
3 3300046462 Ga0495651_0023352 Ga0495651_0023352_2688_3128 138
4 3300046675 Ga0495657_0646914 Ga0495657_0646914_37_477 138
5 3300047444 Ga0495675_0404711 Ga0495675_0404711_212_652 138
6 3300048088 Ga0495602_0190879 Ga0495602_0190879_263_703 138
7 3300049572 Ga0501036_1231487 Ga0501036_1231487_21_446 139
8 3300049591 Ga0501075_1239405 Ga0501075_1239405_70_495 139
9 3300049592 Ga0501076_1048380 Ga0501076_1048380_188_613 139
10 3300025981 Ga0207640_10834628 Ga0207640_108346282 141
11 3300028577 Ga0265318_10149004 Ga0265318_101490042 141
12 3300029957 Ga0265324_10014166 Ga0265324_100141663 141
13 3300031240 Ga0265320_10001226 Ga0265320_1000122618 141
14 3300031241 Ga0265325_10021027 Ga0265325_100210274 141
15 3300031242 Ga0265329_10004843 Ga0265329_100048432 141
16 3300031595 Ga0265313_10032782 Ga0265313_100327821 141
17 3300031852 Ga0307410_10578661 Ga0307410_105786612 141
18 3300005331 Ga0070670_100749214 Ga0070670_1007492142 143
19 3300005334 Ga0068869_100123624 Ga0068869_1001236242 143
20 3300005337 Ga0070682_100320174 Ga0070682_1003201741 143
21 3300005337 Ga0070682_100887105 Ga0070682_1008871051 143
22 3300005338 Ga0068868_100230998 Ga0068868_1002309982 143
23 3300005338 Ga0068868_101130455 Ga0068868_1011304552 143
24 3300005347 Ga0070668_100224078 Ga0070668_1002240782 143
25 3300005355 Ga0070671_100582137 Ga0070671_1005821372 143
26 3300005440 Ga0070705_100034043 Ga0070705_1000340433 143
27 3300005444 Ga0070694_100500502 Ga0070694_1005005021 143
28 3300005457 Ga0070662_100262510 Ga0070662_1002625103 143
29 3300005468 Ga0070707_100011522 Ga0070707_1000115225 143
30 3300005471 Ga0070698_100003028 Ga0070698_10000302812 143
31 3300005471 Ga0070698_100071030 Ga0070698_1000710302 143
32 3300005471 Ga0070698_101710385 Ga0070698_1017103851 143
33 3300005518 Ga0070699_100009488 Ga0070699_1000094882 143
34 3300005536 Ga0070697_100021089 Ga0070697_1000210898 143
35 3300005536 Ga0070697_101465874 Ga0070697_1014658741 143
36 3300005539 Ga0068853_100635447 Ga0068853_1006354473 143
37 3300005544 Ga0070686_101178098 Ga0070686_1011780982 143
38 3300005545 Ga0070695_100476566 Ga0070695_1004765662 143
39 3300005546 Ga0070696_101022048 Ga0070696_1010220482 143
40 3300005547 Ga0070693_100873944 Ga0070693_1008739441 143
41 3300005547 Ga0070693_100881419 Ga0070693_1008814191 143
42 3300005549 Ga0070704_100054595 Ga0070704_1000545952 143
43 3300005563 Ga0068855_100585401 Ga0068855_1005854012 143
44 3300005578 Ga0068854_100211304 Ga0068854_1002113042 143
45 3300005615 Ga0070702_100084196 Ga0070702_1000841963 143
46 3300005844 Ga0068862_100228015 Ga0068862_1002280152 143
47 3300006847 Ga0075431_100217820 Ga0075431_1002178202 143
48 3300009098 Ga0105245_10063385 Ga0105245_100633853 143
49 3300009098 Ga0105245_10189985 Ga0105245_101899853 143
50 3300009147 Ga0114129_10488095 Ga0114129_104880952 143
51 3300009148 Ga0105243_10463787 Ga0105243_104637873 143
52 3300009148 Ga0105243_11115908 Ga0105243_111159081 143
53 3300009176 Ga0105242_11727077 Ga0105242_117270771 143
54 3300009177 Ga0105248_11176222 Ga0105248_111762221 143
55 3300009553 Ga0105249_10175104 Ga0105249_101751043 143
56 3300009553 Ga0105249_10701692 Ga0105249_107016921 143
57 3300010375 Ga0105239_10445367 Ga0105239_104453673 143
58 3300013102 Ga0157371_10915854 Ga0157371_109158542 143
59 3300013297 Ga0157378_10434883 Ga0157378_104348833 143
60 3300013308 Ga0157375_10151635 Ga0157375_101516353 143
61 3300013308 Ga0157375_12144122 Ga0157375_121441222 143
62 3300014325 Ga0163163_10105205 Ga0163163_101052053 143
63 3300014497 Ga0182008_10521155 Ga0182008_105211552 143
64 3300014968 Ga0157379_10477344 Ga0157379_104773442 143
65 3300014968 Ga0157379_11070740 Ga0157379_110707402 143
66 3300025922 Ga0207646_10231031 Ga0207646_102310313 143
67 3300025922 Ga0207646_10388851 Ga0207646_103888512 143
68 3300025927 Ga0207687_10072848 Ga0207687_100728483 143
69 3300025927 Ga0207687_11348594 Ga0207687_113485941 143
70 3300025933 Ga0207706_10049698 Ga0207706_100496982 143
71 3300025935 Ga0207709_10300355 Ga0207709_103003553 143
72 3300025935 Ga0207709_10670865 Ga0207709_106708652 143
73 3300025942 Ga0207689_10265201 Ga0207689_102652011 143
74 3300025949 Ga0207667_10501174 Ga0207667_105011742 143
75 3300025972 Ga0207668_10035673 Ga0207668_100356733 143
76 3300025981 Ga0207640_10216180 Ga0207640_102161802 143
77 3300025981 Ga0207640_11408445 Ga0207640_114084452 143
78 3300026023 Ga0207677_10382496 Ga0207677_103824962 143
79 3300026035 Ga0207703_10375552 Ga0207703_103755523 143
80 3300031548 Ga0307408_100185473 Ga0307408_1001854733 143
81 3300031727 Ga0316576_10615296 Ga0316576_106152962 143
82 3300031731 Ga0307405_11056533 Ga0307405_110565332 143
83 3300031995 Ga0307409_100061092 Ga0307409_1000610924 143
84 3300032002 Ga0307416_100116570 Ga0307416_1001165703 143
85 3300032126 Ga0307415_100004806 Ga0307415_1000048065 143
86 3300035398 Ga0316574_0124590 Ga0316574_0124590_1148_1585 143
87 3300035691 Ga0373931_0420444 Ga0373931_0420444_299_739 143
88 3300037471 Ga0395905_0581528 Ga0395905_0581528_137_580 143
89 3300038443 Ga0395901_0293125 Ga0395901_0293125_126_569 143
90 3300041405 Ga0439438_088329 Ga0439438_088329_234_674 143
91 3300041411 Ga0439466_0054668 Ga0439466_0054668_524_964 143
92 3300041452 Ga0451793_0196950 Ga0451793_0196950_17_457 143
93 3300041486 Ga0451807_1643506 Ga0451807_1643506_143_583 143
94 3300041498 Ga0451841_1279542 Ga0451841_1279542_208_648 143
95 3300041507 Ga0451851_0789716 Ga0451851_0789716_296_736 143
96 3300042147 Ga0450910_019691 Ga0450910_019691_298_738 143
97 3300042876 Ga0451577_1172157 Ga0451577_1172157_158_604 143
98 3300046690 Ga0495624_0643505 Ga0495624_0643505_178_618 143
99 3300048903 Ga0496100_1062761 Ga0496100_1062761_120_560 143
100 3300048904 Ga0496101_0514735 Ga0496101_0514735_457_897 143
101 3300048907 Ga0496104_0182135 Ga0496104_0182135_821_1261 143
102 3300048907 Ga0496104_1009341 Ga0496104_1009341_135_575 143
103 3300048908 Ga0496105_0064463 Ga0496105_0064463_28_468 143
104 3300048908 Ga0496105_0824766 Ga0496105_0824766_201_641 143
105 3300048909 Ga0496106_1454746 Ga0496106_1454746_49_489 143
106 3300048911 Ga0496108_0144050 Ga0496108_0144050_1086_1526 143
107 3300048911 Ga0496108_0166394 Ga0496108_0166394_921_1361 143
108 3300048912 Ga0496109_0069119 Ga0496109_0069119_2041_2481 143
109 3300048912 Ga0496109_0157410 Ga0496109_0157410_1345_1785 143
110 3300048912 Ga0496109_0629679 Ga0496109_0629679_252_692 143
111 3300048913 Ga0496110_0175716 Ga0496110_0175716_760_1200 143
112 3300048915 Ga0496112_0112510 Ga0496112_0112510_2221_2661 143
113 3300048916 Ga0496113_0016363 Ga0496113_0016363_1037_1477 143
114 3300048916 Ga0496113_0541861 Ga0496113_0541861_104_544 143
115 3300048917 Ga0496114_0649343 Ga0496114_0649343_460_900 143
116 3300048917 Ga0496114_1359364 Ga0496114_1359364_126_566 143
117 3300049568 Ga0501031_0112241 Ga0501031_0112241_992_1432 143
118 3300049568 Ga0501031_0123908 Ga0501031_0123908_507_947 143
119 3300049569 Ga0501032_0651644 Ga0501032_0651644_189_629 143
120 3300049572 Ga0501036_0049920 Ga0501036_0049920_2230_2670 143
121 3300049572 Ga0501036_0388146 Ga0501036_0388146_180_620 143
122 3300049572 Ga0501036_0841775 Ga0501036_0841775_203_643 143
123 3300049573 Ga0501037_0323223 Ga0501037_0323223_260_700 143
124 3300049573 Ga0501037_1124276 Ga0501037_1124276_13_453 143
125 3300049574 Ga0501038_0132177 Ga0501038_0132177_860_1300 143
126 3300049574 Ga0501038_0464997 Ga0501038_0464997_294_734 143
127 3300049574 Ga0501038_0881486 Ga0501038_0881486_59_499 143
128 3300049575 Ga0501039_0048851 Ga0501039_0048851_1973_2413 143
129 3300049575 Ga0501039_0052113 Ga0501039_0052113_1371_1811 143
130 3300049575 Ga0501039_0253543 Ga0501039_0253543_498_938 143
131 3300049575 Ga0501039_0371126 Ga0501039_0371126_103_543 143
132 3300049576 Ga0501040_0003818 Ga0501040_0003818_254_694 143
133 3300049576 Ga0501040_0021971 Ga0501040_0021971_1388_1828 143
134 3300049576 Ga0501040_0032384 Ga0501040_0032384_284_724 143
135 3300049576 Ga0501040_0058738 Ga0501040_0058738_1445_1885 143
136 3300049577 Ga0501041_0014508 Ga0501041_0014508_4187_4627 143
137 3300049577 Ga0501041_0039211 Ga0501041_0039211_1570_2010 143
138 3300049577 Ga0501041_0075737 Ga0501041_0075737_1397_1837 143
139 3300049577 Ga0501041_0079735 Ga0501041_0079735_347_787 143
140 3300049578 Ga0501042_0107737 Ga0501042_0107737_288_728 143
141 3300049578 Ga0501042_0339815 Ga0501042_0339815_381_821 143
142 3300049578 Ga0501042_0662065 Ga0501042_0662065_203_643 143
143 3300049578 Ga0501042_0690799 Ga0501042_0690799_121_567 143
144 3300049579 Ga0501043_0270823 Ga0501043_0270823_765_1205 143
145 3300049580 Ga0501046_0068309 Ga0501046_0068309_1702_2142 143
146 3300049580 Ga0501046_0076648 Ga0501046_0076648_189_629 143
147 3300049581 Ga0501047_1104934 Ga0501047_1104934_47_487 143
148 3300049582 Ga0501048_0116204 Ga0501048_0116204_1153_1593 143
149 3300049582 Ga0501048_0285276 Ga0501048_0285276_233_673 143
150 3300049582 Ga0501048_0718455 Ga0501048_0718455_239_679 143
151 3300049584 Ga0501068_0550259 Ga0501068_0550259_107_547 143
152 3300049586 Ga0501070_0178885 Ga0501070_0178885_466_906 143
153 3300049587 Ga0501071_0029835 Ga0501071_0029835_143_583 143
154 3300049587 Ga0501071_0088916 Ga0501071_0088916_491_931 143
155 3300049587 Ga0501071_0123344 Ga0501071_0123344_1424_1864 143
156 3300049587 Ga0501071_0236032 Ga0501071_0236032_337_777 143
157 3300049587 Ga0501071_0315794 Ga0501071_0315794_543_980 143
158 3300049588 Ga0501072_0011361 Ga0501072_0011361_5314_5754 143
159 3300049588 Ga0501072_0733308 Ga0501072_0733308_236_676 143
160 3300049589 Ga0501073_0701719 Ga0501073_0701719_202_642 143
161 3300049590 Ga0501074_0161060 Ga0501074_0161060_672_1112 143
162 3300049591 Ga0501075_0007785 Ga0501075_0007785_6054_6494 143
163 3300049591 Ga0501075_0047359 Ga0501075_0047359_784_1224 143
164 3300049591 Ga0501075_0187626 Ga0501075_0187626_1042_1482 143
165 3300049591 Ga0501075_0417107 Ga0501075_0417107_221_661 143
166 3300049592 Ga0501076_0071511 Ga0501076_0071511_2082_2522 143
167 3300049592 Ga0501076_0185167 Ga0501076_0185167_707_1147 143
168 3300049592 Ga0501076_0214259 Ga0501076_0214259_853_1293 143
169 3300049592 Ga0501076_0288909 Ga0501076_0288909_40_480 143
170 3300049593 Ga0501077_0032309 Ga0501077_0032309_1518_1958 143
171 3300049593 Ga0501077_0034977 Ga0501077_0034977_59_499 143
172 3300049741 Ga0501079_0037474 Ga0501079_0037474_1068_1508 143
173 3300049741 Ga0501079_0103590 Ga0501079_0103590_298_738 143
174 3300049741 Ga0501079_0103887 Ga0501079_0103887_1251_1691 143
175 3300049741 Ga0501079_0131802 Ga0501079_0131802_524_964 143
176 3300049742 Ga0501080_0034338 Ga0501080_0034338_3360_3800 143
177 3300049742 Ga0501080_0101670 Ga0501080_0101670_1887_2327 143
178 3300049742 Ga0501080_1013706 Ga0501080_1013706_199_639 143
179 3300049743 Ga0501081_0024997 Ga0501081_0024997_3069_3509 143
180 3300049743 Ga0501081_0242711 Ga0501081_0242711_167_607 143
181 3300049743 Ga0501081_0625964 Ga0501081_0625964_343_783 143
182 3300049824 Ga0501045_0005760 Ga0501045_0005760_6506_6946 143
183 3300049824 Ga0501045_0064976 Ga0501045_0064976_1134_1574 143
184 3300049824 Ga0501045_0118173 Ga0501045_0118173_455_895 143
185 3300049824 Ga0501045_0143371 Ga0501045_0143371_220_660 143
186 3300049824 Ga0501045_0206460 Ga0501045_0206460_585_1025 143
187 3300050507 nmdc:mga05p37_824661_c1 nmdc:mga05p37_824661_c1_384_824 143
188 3300050510 nmdc:mga06r32_119337_c1 nmdc:mga06r32_119337_c1_1934_2374 143
189 3300050512 nmdc:mga0n895_317692_c1 nmdc:mga0n895_317692_c1_393_833 143
190 3300050514 nmdc:mga08x19_328459_c1 nmdc:mga08x19_328459_c1_311_766 143
191 3300054114 Ga0501084_0079234 Ga0501084_0079234_849_1289 143
192 3300054114 Ga0501084_0128484 Ga0501084_0128484_874_1314 143
193 3300054114 Ga0501084_0695825 Ga0501084_0695825_403_843 143
194 3300054114 Ga0501084_1079535 Ga0501084_1079535_162_602 143
195 3300060353 Ga0501082_0048928 Ga0501082_0048928_2287_2727 143
196 3300060353 Ga0501082_0053683 Ga0501082_0053683_2707_3147 143
197 3300060353 Ga0501082_0224053 Ga0501082_0224053_554_994 143
198 3300060353 Ga0501082_0301863 Ga0501082_0301863_648_1088 143
199 3300060353 Ga0501082_1612989 Ga0501082_1612989_41_481 143
200 3300061734 Ga0530510_0002811 Ga0530510_0002811_7534_7974 143
201 3300061734 Ga0530510_0010156 Ga0530510_0010156_132_572 143
202 3300061734 Ga0530510_0026774 Ga0530510_0026774_3113_3553 143
203 3300061734 Ga0530510_0177881 Ga0530510_0177881_365_805 143
204 3300061734 Ga0530510_0217593 Ga0530510_0217593_119_559 143
205 3300006871 Ga0075434_100223052 Ga0075434_1002230523 144
206 3300006914 Ga0075436_100756326 Ga0075436_1007563262 144
207 3300009174 Ga0105241_10747713 Ga0105241_107477132 144
208 3300025907 Ga0207645_10077240 Ga0207645_100772403 144
209 3300025940 Ga0207691_10373837 Ga0207691_103738372 144
210 3300025960 Ga0207651_10353110 Ga0207651_103531102 144
211 3300027717 Ga0209998_10023192 Ga0209998_100231922 144
212 3300036401 Ga0373937_1417881 Ga0373937_1417881_55_492 144
213 3300042001 Ga0439441_001582 Ga0439441_001582_2291_2728 144
214 3300048904 Ga0496101_0006551 Ga0496101_0006551_4548_4988 144
215 3300048905 Ga0496102_0182680 Ga0496102_0182680_301_741 144
216 3300048907 Ga0496104_0313586 Ga0496104_0313586_718_1158 144
217 3300048908 Ga0496105_0025812 Ga0496105_0025812_874_1314 144
218 3300048910 Ga0496107_0100929 Ga0496107_0100929_1176_1616 144
219 3300048911 Ga0496108_0025060 Ga0496108_0025060_994_1434 144
220 3300048912 Ga0496109_0009839 Ga0496109_0009839_4761_5201 144
221 3300048913 Ga0496110_0091358 Ga0496110_0091358_1466_1906 144
222 3300048915 Ga0496112_0000098 Ga0496112_0000098_35514_35951 144
223 3300048915 Ga0496112_0567524 Ga0496112_0567524_186_626 144
224 3300048916 Ga0496113_0141285 Ga0496113_0141285_771_1211 144
225 3300048917 Ga0496114_0005648 Ga0496114_0005648_6696_7136 144
226 3300050512 nmdc:mga0n895_189236_c1 nmdc:mga0n895_189236_c1_820_1257 144
227 3300050513 nmdc:mga0rr50_110431_c1 nmdc:mga0rr50_110431_c1_704_1141 144
228 3300050514 nmdc:mga08x19_1021961_c1 nmdc:mga08x19_1021961_c1_55_492 144
229 3300005334 Ga0068869_100136839 Ga0068869_1001368393 145
230 3300005336 Ga0070680_100000064 Ga0070680_10000006426 145
231 3300005338 Ga0068868_100220440 Ga0068868_1002204402 145
232 3300005341 Ga0070691_10120011 Ga0070691_101200112 145
233 3300005353 Ga0070669_100319632 Ga0070669_1003196323 145
234 3300005435 Ga0070714_101172012 Ga0070714_1011720122 145
235 3300005440 Ga0070705_100178886 Ga0070705_1001788862 145
236 3300005440 Ga0070705_100246413 Ga0070705_1002464132 145
237 3300005441 Ga0070700_100212175 Ga0070700_1002121752 145
238 3300005444 Ga0070694_100109660 Ga0070694_1001096603 145
239 3300005444 Ga0070694_100476323 Ga0070694_1004763232 145
240 3300005445 Ga0070708_100029319 Ga0070708_1000293196 145
241 3300005445 Ga0070708_100030313 Ga0070708_1000303133 145
242 3300005458 Ga0070681_11075180 Ga0070681_110751802 145
243 3300005467 Ga0070706_100005018 Ga0070706_10000501813 145
244 3300005467 Ga0070706_100047843 Ga0070706_1000478433 145
245 3300005467 Ga0070706_100553818 Ga0070706_1005538182 145
246 3300005468 Ga0070707_100006720 Ga0070707_1000067205 145
247 3300005468 Ga0070707_100064043 Ga0070707_1000640433 145
248 3300005468 Ga0070707_100328616 Ga0070707_1003286162 145
249 3300005471 Ga0070698_100011233 Ga0070698_1000112335 145
250 3300005471 Ga0070698_100303809 Ga0070698_1003038092 145
251 3300005518 Ga0070699_100940783 Ga0070699_1009407832 145
252 3300005530 Ga0070679_100483867 Ga0070679_1004838672 145
253 3300005535 Ga0070684_101453023 Ga0070684_1014530231 145
254 3300005536 Ga0070697_100093146 Ga0070697_1000931463 145
255 3300005536 Ga0070697_100105447 Ga0070697_1001054472 145
256 3300005536 Ga0070697_100930605 Ga0070697_1009306052 145
257 3300005544 Ga0070686_100138261 Ga0070686_1001382611 145
258 3300005544 Ga0070686_100245029 Ga0070686_1002450292 145
259 3300005545 Ga0070695_100043376 Ga0070695_1000433762 145
260 3300005545 Ga0070695_100370184 Ga0070695_1003701842 145
261 3300005546 Ga0070696_100005146 Ga0070696_10000514610 145
262 3300005546 Ga0070696_100101674 Ga0070696_1001016741 145
263 3300005546 Ga0070696_100335096 Ga0070696_1003350961 145
264 3300005564 Ga0070664_101121284 Ga0070664_1011212842 145
265 3300005577 Ga0068857_100195777 Ga0068857_1001957773 145
266 3300005578 Ga0068854_100079223 Ga0068854_1000792232 145
267 3300005842 Ga0068858_100526779 Ga0068858_1005267792 145
268 3300006844 Ga0075428_100867293 Ga0075428_1008672931 145
269 3300006871 Ga0075434_100287007 Ga0075434_1002870072 145
270 3300006871 Ga0075434_100412327 Ga0075434_1004123272 145
271 3300006914 Ga0075436_100314098 Ga0075436_1003140983 145
272 3300007076 Ga0075435_100049453 Ga0075435_1000494535 145
273 3300009098 Ga0105245_10016155 Ga0105245_100161556 145
274 3300009147 Ga0114129_11983200 Ga0114129_119832002 145
275 3300009148 Ga0105243_11211641 Ga0105243_112116412 145
276 3300009176 Ga0105242_10141908 Ga0105242_101419082 145
277 3300009176 Ga0105242_11042471 Ga0105242_110424712 145
278 3300009176 Ga0105242_11680178 Ga0105242_116801782 145
279 3300009553 Ga0105249_10866895 Ga0105249_108668952 145
280 3300010375 Ga0105239_11349683 Ga0105239_113496832 145
281 3300011119 Ga0105246_10211192 Ga0105246_102111922 145
282 3300013297 Ga0157378_10024428 Ga0157378_100244283 145
283 3300025901 Ga0207688_10115639 Ga0207688_101156392 145
284 3300025907 Ga0207645_10045596 Ga0207645_100455963 145
285 3300025910 Ga0207684_10017135 Ga0207684_100171352 145
286 3300025910 Ga0207684_10058459 Ga0207684_100584593 145
287 3300025917 Ga0207660_10000002 Ga0207660_10000002420 145
288 3300025917 Ga0207660_10377251 Ga0207660_103772512 145
289 3300025917 Ga0207660_11057548 Ga0207660_110575482 145
290 3300025918 Ga0207662_10008434 Ga0207662_100084349 145
291 3300025918 Ga0207662_10381392 Ga0207662_103813921 145
292 3300025922 Ga0207646_10141769 Ga0207646_101417692 145
293 3300025922 Ga0207646_10237906 Ga0207646_102379062 145
294 3300025927 Ga0207687_10053169 Ga0207687_100531692 145
295 3300025929 Ga0207664_11351570 Ga0207664_113515702 145
296 3300025933 Ga0207706_10207558 Ga0207706_102075582 145
297 3300025934 Ga0207686_10615321 Ga0207686_106153211 145
298 3300025942 Ga0207689_10063130 Ga0207689_100631303 145
299 3300025945 Ga0207679_11421655 Ga0207679_114216551 145
300 3300026023 Ga0207677_10241468 Ga0207677_102414682 145
301 3300026041 Ga0207639_10985834 Ga0207639_109858342 145
302 3300026067 Ga0207678_11483552 Ga0207678_114835521 145
303 3300026075 Ga0207708_10533597 Ga0207708_105335972 145
304 3300026116 Ga0207674_10192470 Ga0207674_101924702 145
305 3300028380 Ga0268265_10771492 Ga0268265_107714922 145
306 3300028563 Ga0265319_1002616 Ga0265319_10026165 145
307 3300028573 Ga0265334_10101765 Ga0265334_101017652 145
308 3300028577 Ga0265318_10015272 Ga0265318_100152723 145
309 3300028577 Ga0265318_10020174 Ga0265318_100201742 145
310 3300028577 Ga0265318_10038176 Ga0265318_100381762 145
311 3300028654 Ga0265322_10011152 Ga0265322_100111522 145
312 3300028666 Ga0265336_10010948 Ga0265336_100109482 145
313 3300028666 Ga0265336_10117665 Ga0265336_101176652 145
314 3300028800 Ga0265338_10075958 Ga0265338_100759584 145
315 3300028800 Ga0265338_10699813 Ga0265338_106998132 145
316 3300029957 Ga0265324_10008203 Ga0265324_100082035 145
317 3300031239 Ga0265328_10045638 Ga0265328_100456382 145
318 3300031240 Ga0265320_10009070 Ga0265320_100090704 145
319 3300031240 Ga0265320_10039466 Ga0265320_100394663 145
320 3300031241 Ga0265325_10017224 Ga0265325_100172244 145
321 3300031241 Ga0265325_10064891 Ga0265325_100648913 145
322 3300031241 Ga0265325_10337454 Ga0265325_103374541 145
323 3300031242 Ga0265329_10022566 Ga0265329_100225663 145
324 3300031242 Ga0265329_10299750 Ga0265329_102997501 145
325 3300031247 Ga0265340_10004346 Ga0265340_100043464 145
326 3300031249 Ga0265339_10010068 Ga0265339_100100684 145
327 3300031249 Ga0265339_10190920 Ga0265339_101909202 145
328 3300031251 Ga0265327_10130370 Ga0265327_101303703 145
329 3300031344 Ga0265316_10055834 Ga0265316_100558342 145
330 3300031595 Ga0265313_10035007 Ga0265313_100350072 145
331 3300031711 Ga0265314_10002544 Ga0265314_1000254421 145
332 3300032002 Ga0307416_100345429 Ga0307416_1003454293 145
333 3300032133 Ga0316583_10171845 Ga0316583_101718452 145
334 3300042185 Ga0450909_034182 Ga0450909_034182_156_593 145
335 3300044673 Ga0453683_0192239 Ga0453683_0192239_484_936 145
336 3300048905 Ga0496102_1742865 Ga0496102_1742865_52_504 145
337 3300048906 Ga0496103_0179915 Ga0496103_0179915_400_852 145
338 3300048915 Ga0496112_0519953 Ga0496112_0519953_25_477 145
339 3300049568 Ga0501031_0793235 Ga0501031_0793235_103_540 145
340 3300049574 Ga0501038_0212084 Ga0501038_0212084_762_1199 145
341 3300049576 Ga0501040_0178934 Ga0501040_0178934_298_735 145
342 3300049577 Ga0501041_0042474 Ga0501041_0042474_351_788 145
343 3300049578 Ga0501042_0093254 Ga0501042_0093254_63_500 145
344 3300049580 Ga0501046_0330019 Ga0501046_0330019_441_878 145
345 3300049582 Ga0501048_0261926 Ga0501048_0261926_629_1066 145
346 3300049584 Ga0501068_0557647 Ga0501068_0557647_247_684 145
347 3300049587 Ga0501071_0372121 Ga0501071_0372121_639_1076 145
348 3300049588 Ga0501072_0104541 Ga0501072_0104541_915_1352 145
349 3300049588 Ga0501072_0334369 Ga0501072_0334369_607_1044 145
350 3300049590 Ga0501074_0298494 Ga0501074_0298494_540_977 145
351 3300049591 Ga0501075_0009521 Ga0501075_0009521_2620_3057 145
352 3300049591 Ga0501075_0649592 Ga0501075_0649592_180_617 145
353 3300049591 Ga0501075_0955425 Ga0501075_0955425_117_554 145
354 3300049593 Ga0501077_0012888 Ga0501077_0012888_3008_3445 145
355 3300049741 Ga0501079_0032539 Ga0501079_0032539_1456_1893 145
356 3300049743 Ga0501081_0084743 Ga0501081_0084743_483_920 145
357 3300049822 Ga0501035_0217364 Ga0501035_0217364_888_1325 145
358 3300049824 Ga0501045_0051355 Ga0501045_0051355_685_1122 145
359 3300050513 nmdc:mga0rr50_59636_c1 nmdc:mga0rr50_59636_c1_591_1043 145
360 3300050515 nmdc:mga0a205_156715_c1 nmdc:mga0a205_156715_c1_1360_1812 145
361 3300050515 nmdc:mga0a205_63714_c1 nmdc:mga0a205_63714_c1_2292_2744 145
362 3300054114 Ga0501084_0119763 Ga0501084_0119763_1231_1668 145
363 3300060353 Ga0501082_0179399 Ga0501082_0179399_1015_1452 145
364 3300061734 Ga0530510_0399575 Ga0530510_0399575_176_613 145
365 3300061734 Ga0530510_0411435 Ga0530510_0411435_287_724 145
366 3300005347 Ga0070668_100826879 Ga0070668_1008268792 146
367 3300005445 Ga0070708_100458916 Ga0070708_1004589161 146
368 3300005518 Ga0070699_100470666 Ga0070699_1004706662 146
369 3300005518 Ga0070699_101196585 Ga0070699_1011965852 146
370 3300005536 Ga0070697_100018732 Ga0070697_1000187322 146
371 3300005617 Ga0068859_100485362 Ga0068859_1004853622 146
372 3300005718 Ga0068866_10491641 Ga0068866_104916412 146
373 3300005840 Ga0068870_10172368 Ga0068870_101723683 146
374 3300006175 Ga0070712_100511237 Ga0070712_1005112372 146
375 3300006852 Ga0075433_11336032 Ga0075433_113360322 146
376 3300006881 Ga0068865_100064837 Ga0068865_1000648372 146
377 3300006931 Ga0097620_100485312 Ga0097620_1004853122 146
378 3300009147 Ga0114129_10260085 Ga0114129_102600853 146
379 3300009148 Ga0105243_10052898 Ga0105243_100528984 146
380 3300009553 Ga0105249_11833816 Ga0105249_118338161 146
381 3300013297 Ga0157378_10307421 Ga0157378_103074213 146
382 3300014326 Ga0157380_10248278 Ga0157380_102482782 146
383 3300014326 Ga0157380_12551356 Ga0157380_125513561 146
384 3300025908 Ga0207643_10491262 Ga0207643_104912622 146
385 3300025935 Ga0207709_10029558 Ga0207709_100295584 146
386 3300025937 Ga0207669_10012039 Ga0207669_100120395 146
387 3300025938 Ga0207704_10026976 Ga0207704_100269765 146
388 3300025941 Ga0207711_11615396 Ga0207711_116153962 146
389 3300041512 Ga0451853_0662573 Ga0451853_0662573_341_790 146
390 3300042125 Ga0450923_173881 Ga0450923_173881_20_460 146
391 3300045051 Ga0451576_1006894 Ga0451576_1006894_147_587 146
392 3300046461 Ga0495641_0117312 Ga0495641_0117312_27_467 146
393 3300046462 Ga0495651_0433057 Ga0495651_0433057_171_611 146
394 3300046514 Ga0495618_0782455 Ga0495618_0782455_13_453 146
395 3300046517 Ga0495630_0132659 Ga0495630_0132659_1405_1845 146
396 3300046533 Ga0495640_0373403 Ga0495640_0373403_305_745 146
397 3300046642 Ga0495634_0192317 Ga0495634_0192317_340_780 146
398 3300046678 Ga0495599_0424970 Ga0495599_0424970_214_654 146
399 3300046809 Ga0495600_0439443 Ga0495600_0439443_260_700 146
400 3300047317 Ga0495604_0308816 Ga0495604_0308816_355_795 146
401 3300047319 Ga0495674_0891033 Ga0495674_0891033_77_517 146
402 3300048088 Ga0495602_0100628 Ga0495602_0100628_1190_1630 146
403 3300048915 Ga0496112_0261497 Ga0496112_0261497_420_878 146
404 3300049583 Ga0501067_0212450 Ga0501067_0212450_136_576 146
405 3300049585 Ga0501069_0016906 Ga0501069_0016906_2537_2977 146
406 3300050507 nmdc:mga05p37_342691_c1 nmdc:mga05p37_342691_c1_251_691 146
407 3300050515 nmdc:mga0a205_1182214_c1 nmdc:mga0a205_1182214_c1_141_581 146
408 3300053077 Ga0495601_0355096 Ga0495601_0355096_292_732 146
409 3300053078 Ga0495612_0351531 Ga0495612_0351531_197_637 146
410 3300053084 Ga0495595_0403847 Ga0495595_0403847_20_469 146
411 3300005445 Ga0070708_101879294 Ga0070708_1018792941 147
412 3300009094 Ga0111539_10950171 Ga0111539_109501712 148
413 3300027665 Ga0209983_1021016 Ga0209983_10210162 148
414 3300035112 Ga0373932_0030008 Ga0373932_0030008_28_474 148
415 3300035242 Ga0373962_0086642 Ga0373962_0086642_19_465 148
416 3300039437 Ga0436365_0347259 Ga0436365_0347259_730_1188 148
417 3300041411 Ga0439466_0116324 Ga0439466_0116324_267_719 148
418 3300042147 Ga0450910_004004 Ga0450910_004004_1342_1800 148
419 3300042184 Ga0450908_035093 Ga0450908_035093_81_539 148
420 3300048903 Ga0496100_1623782 Ga0496100_1623782_52_498 148
421 3300048905 Ga0496102_0136558 Ga0496102_0136558_1830_2276 148
422 3300048908 Ga0496105_0348511 Ga0496105_0348511_707_1153 148
423 3300048910 Ga0496107_0428827 Ga0496107_0428827_222_668 148
424 3300048911 Ga0496108_0060962 Ga0496108_0060962_986_1432 148
425 3300048912 Ga0496109_0156520 Ga0496109_0156520_1137_1583 148
426 3300048913 Ga0496110_0134063 Ga0496110_0134063_462_908 148
427 3300048914 Ga0496111_0271503 Ga0496111_0271503_532_978 148
428 3300048916 Ga0496113_0049277 Ga0496113_0049277_317_763 148
429 3300048917 Ga0496114_1078640 Ga0496114_1078640_164_610 148
430 3300050511 nmdc:mga08y16_1148637_c1 nmdc:mga08y16_1148637_c1_191_637 148
431 3300050511 nmdc:mga08y16_94926_c1 nmdc:mga08y16_94926_c1_1306_1752 148
432 3300054114 Ga0501084_0373527 Ga0501084_0373527_311_769 148
433 3300005331 Ga0070670_101426507 Ga0070670_1014265072 149
434 3300005340 Ga0070689_101152026 Ga0070689_1011520262 149
435 3300005345 Ga0070692_10270976 Ga0070692_102709762 149
436 3300005347 Ga0070668_101212462 Ga0070668_1012124622 149
437 3300005354 Ga0070675_100855712 Ga0070675_1008557122 149
438 3300005356 Ga0070674_100462924 Ga0070674_1004629242 149
439 3300005438 Ga0070701_10436690 Ga0070701_104366901 149
440 3300005440 Ga0070705_100495666 Ga0070705_1004956662 149
441 3300005441 Ga0070700_100146502 Ga0070700_1001465022 149
442 3300005441 Ga0070700_100242695 Ga0070700_1002426952 149
443 3300005456 Ga0070678_101938210 Ga0070678_1019382101 149
444 3300005577 Ga0068857_100085746 Ga0068857_1000857463 149
445 3300005719 Ga0068861_101580160 Ga0068861_1015801602 149
446 3300005840 Ga0068870_10118048 Ga0068870_101180482 149
447 3300005844 Ga0068862_100130184 Ga0068862_1001301843 149
448 3300009094 Ga0111539_10215328 Ga0111539_102153282 149
449 3300009094 Ga0111539_10666138 Ga0111539_106661382 149
450 3300009147 Ga0114129_11124739 Ga0114129_111247392 149
451 3300013296 Ga0157374_11878538 Ga0157374_118785382 149
452 3300025925 Ga0207650_10348816 Ga0207650_103488161 149
453 3300025936 Ga0207670_10323127 Ga0207670_103231273 149
454 3300025937 Ga0207669_11561848 Ga0207669_115618481 149
455 3300026075 Ga0207708_10292774 Ga0207708_102927742 149
456 3300026075 Ga0207708_10452371 Ga0207708_104523712 149
457 3300026116 Ga0207674_10212681 Ga0207674_102126812 149
458 3300026118 Ga0207675_100044545 Ga0207675_1000445451 149
459 3300026121 Ga0207683_11756630 Ga0207683_117566302 149
460 3300027907 Ga0207428_10119707 Ga0207428_101197073 149
461 3300031903 Ga0307407_10255084 Ga0307407_102550843 149
462 3300031903 Ga0307407_10409024 Ga0307407_104090242 149
463 3300032005 Ga0307411_11519720 Ga0307411_115197202 149
464 3300049568 Ga0501031_0012895 Ga0501031_0012895_4271_4726 149
465 3300049570 Ga0501033_0070780 Ga0501033_0070780_364_819 149
466 3300049572 Ga0501036_0133330 Ga0501036_0133330_1079_1534 149
467 3300049573 Ga0501037_0044880 Ga0501037_0044880_127_582 149
468 3300049574 Ga0501038_0033237 Ga0501038_0033237_673_1128 149
469 3300049576 Ga0501040_0120915 Ga0501040_0120915_1306_1761 149
470 3300049577 Ga0501041_0020238 Ga0501041_0020238_874_1329 149
471 3300049578 Ga0501042_0164726 Ga0501042_0164726_874_1329 149
472 3300049579 Ga0501043_0023595 Ga0501043_0023595_830_1285 149
473 3300049582 Ga0501048_0062362 Ga0501048_0062362_395_850 149
474 3300049585 Ga0501069_0022459 Ga0501069_0022459_1151_1606 149
475 3300049586 Ga0501070_0120823 Ga0501070_0120823_763_1218 149
476 3300049587 Ga0501071_0012113 Ga0501071_0012113_5313_5768 149
477 3300049588 Ga0501072_0049781 Ga0501072_0049781_1372_1827 149
478 3300049589 Ga0501073_0044364 Ga0501073_0044364_690_1145 149
479 3300049590 Ga0501074_0034551 Ga0501074_0034551_1217_1672 149
480 3300049591 Ga0501075_0037370 Ga0501075_0037370_312_767 149
481 3300049592 Ga0501076_0153849 Ga0501076_0153849_681_1136 149
482 3300049593 Ga0501077_0025972 Ga0501077_0025972_2400_2855 149
483 3300049741 Ga0501079_0054487 Ga0501079_0054487_1363_1818 149
484 3300049742 Ga0501080_0029655 Ga0501080_0029655_1195_1650 149
485 3300049743 Ga0501081_0096676 Ga0501081_0096676_873_1328 149
486 3300049744 Ga0501083_0112226 Ga0501083_0112226_1283_1738 149
487 3300049822 Ga0501035_0089541 Ga0501035_0089541_1440_1895 149
488 3300049823 Ga0501044_0318432 Ga0501044_0318432_343_798 149
489 3300049824 Ga0501045_0014739 Ga0501045_0014739_4713_5168 149
490 3300050511 nmdc:mga08y16_181149_c1 nmdc:mga08y16_181149_c1_1174_1629 149
491 3300054114 Ga0501084_0016480 Ga0501084_0016480_1366_1821 149
492 3300060353 Ga0501082_0046235 Ga0501082_0046235_2444_2899 149
493 3300061734 Ga0530510_0060038 Ga0530510_0060038_442_897 149
494 3300005937 Ga0081455_10357646 Ga0081455_103576462 150
495 3300031727 Ga0316576_10078218 Ga0316576_100782182 150
496 3300031733 Ga0316577_10036067 Ga0316577_100360672 150
497 3300036647 Ga0316582_0044485 Ga0316582_0044485_1805_2266 150
498 3300036647 Ga0316582_0257041 Ga0316582_0257041_602_1063 150
499 3300037588 Ga0316581_0072732 Ga0316581_0072732_392_853 150
500 3300005330 Ga0070690_100068392 Ga0070690_1000683923 151
501 3300005335 Ga0070666_10193615 Ga0070666_101936152 151
502 3300005336 Ga0070680_100109073 Ga0070680_1001090733 151
503 3300005337 Ga0070682_100072469 Ga0070682_1000724692 151
504 3300005338 Ga0068868_100093433 Ga0068868_1000934333 151
505 3300005339 Ga0070660_100213094 Ga0070660_1002130942 151
506 3300005340 Ga0070689_100037490 Ga0070689_1000374902 151
507 3300005341 Ga0070691_10123398 Ga0070691_101233982 151
508 3300005343 Ga0070687_100188326 Ga0070687_1001883262 151
509 3300005344 Ga0070661_100197565 Ga0070661_1001975652 151
510 3300005345 Ga0070692_10012592 Ga0070692_100125921 151
511 3300005347 Ga0070668_100102089 Ga0070668_1001020893 151
512 3300005353 Ga0070669_100016773 Ga0070669_1000167734 151
513 3300005354 Ga0070675_100013259 Ga0070675_1000132592 151
514 3300005356 Ga0070674_100038948 Ga0070674_1000389483 151
515 3300005364 Ga0070673_100231631 Ga0070673_1002316312 151
516 3300005366 Ga0070659_100843351 Ga0070659_1008433512 151
517 3300005438 Ga0070701_10023624 Ga0070701_100236245 151
518 3300005440 Ga0070705_100076960 Ga0070705_1000769601 151
519 3300005441 Ga0070700_100061043 Ga0070700_1000610432 151
520 3300005456 Ga0070678_100155180 Ga0070678_1001551801 151
521 3300005459 Ga0068867_100236391 Ga0068867_1002363911 151
522 3300005544 Ga0070686_100051300 Ga0070686_1000513003 151
523 3300005547 Ga0070693_100059608 Ga0070693_1000596082 151
524 3300005577 Ga0068857_100405852 Ga0068857_1004058522 151
525 3300005578 Ga0068854_100307982 Ga0068854_1003079822 151
526 3300005615 Ga0070702_100038924 Ga0070702_1000389242 151
527 3300005616 Ga0068852_100258049 Ga0068852_1002580492 151
528 3300005617 Ga0068859_100267721 Ga0068859_1002677212 151
529 3300005618 Ga0068864_100034436 Ga0068864_1000344363 151
530 3300005718 Ga0068866_10053756 Ga0068866_100537562 151
531 3300005719 Ga0068861_100316862 Ga0068861_1003168622 151
532 3300005840 Ga0068870_10167404 Ga0068870_101674042 151
533 3300005843 Ga0068860_100083011 Ga0068860_1000830115 151
534 3300005844 Ga0068862_100141175 Ga0068862_1001411753 151
535 3300006237 Ga0097621_100225314 Ga0097621_1002253142 151
536 3300006358 Ga0068871_100832165 Ga0068871_1008321651 151
537 3300006881 Ga0068865_100118074 Ga0068865_1001180742 151
538 3300006931 Ga0097620_100267728 Ga0097620_1002677282 151
539 3300009094 Ga0111539_10040579 Ga0111539_100405794 151
540 3300009094 Ga0111539_10176858 Ga0111539_101768583 151
541 3300009147 Ga0114129_10376129 Ga0114129_103761292 151
542 3300009148 Ga0105243_10021952 Ga0105243_100219524 151
543 3300009176 Ga0105242_10031514 Ga0105242_100315145 151
544 3300009177 Ga0105248_10242749 Ga0105248_102427492 151
545 3300009551 Ga0105238_10093432 Ga0105238_100934323 151
546 3300009553 Ga0105249_10320768 Ga0105249_103207682 151
547 3300010375 Ga0105239_10381642 Ga0105239_103816423 151
548 3300011119 Ga0105246_10175913 Ga0105246_101759133 151
549 3300013297 Ga0157378_10003032 Ga0157378_1000303212 151
550 3300013307 Ga0157372_10883564 Ga0157372_108835642 151
551 3300013308 Ga0157375_10313520 Ga0157375_103135202 151
552 3300014326 Ga0157380_10148624 Ga0157380_101486242 151
553 3300014745 Ga0157377_10042535 Ga0157377_100425353 151
554 3300014968 Ga0157379_10057781 Ga0157379_100577812 151
555 3300014969 Ga0157376_10177650 Ga0157376_101776503 151
556 3300025899 Ga0207642_10032317 Ga0207642_100323172 151
557 3300025901 Ga0207688_10259718 Ga0207688_102597181 151
558 3300025904 Ga0207647_10389793 Ga0207647_103897932 151
559 3300025908 Ga0207643_10067417 Ga0207643_100674173 151
560 3300025917 Ga0207660_10737097 Ga0207660_107370972 151
561 3300025918 Ga0207662_10025525 Ga0207662_100255255 151
562 3300025919 Ga0207657_10300253 Ga0207657_103002532 151
563 3300025920 Ga0207649_10374254 Ga0207649_103742542 151
564 3300025923 Ga0207681_10023657 Ga0207681_100236573 151
565 3300025925 Ga0207650_10115980 Ga0207650_101159803 151
566 3300025926 Ga0207659_10131662 Ga0207659_101316622 151
567 3300025932 Ga0207690_10077228 Ga0207690_100772282 151
568 3300025933 Ga0207706_10117031 Ga0207706_101170311 151
569 3300025935 Ga0207709_10433971 Ga0207709_104339712 151
570 3300025937 Ga0207669_10007889 Ga0207669_100078895 151
571 3300025938 Ga0207704_10068329 Ga0207704_100683292 151
572 3300025940 Ga0207691_10053258 Ga0207691_100532582 151
573 3300025941 Ga0207711_10816570 Ga0207711_108165702 151
574 3300025942 Ga0207689_10036967 Ga0207689_100369672 151
575 3300025944 Ga0207661_10312778 Ga0207661_103127782 151
576 3300025960 Ga0207651_10295496 Ga0207651_102954962 151
577 3300025961 Ga0207712_10083803 Ga0207712_100838032 151
578 3300025972 Ga0207668_10165812 Ga0207668_101658122 151
579 3300025981 Ga0207640_10157200 Ga0207640_101572002 151
580 3300026035 Ga0207703_10283885 Ga0207703_102838852 151
581 3300026075 Ga0207708_10091470 Ga0207708_100914703 151
582 3300026075 Ga0207708_10128466 Ga0207708_101284663 151
583 3300026089 Ga0207648_10011867 Ga0207648_1001186711 151
584 3300026116 Ga0207674_10024303 Ga0207674_100243033 151
585 3300026118 Ga0207675_100071553 Ga0207675_1000715533 151
586 3300026142 Ga0207698_10308948 Ga0207698_103089483 151
587 3300027717 Ga0209998_10033015 Ga0209998_100330152 151
588 3300027876 Ga0209974_10215002 Ga0209974_102150021 151
589 3300027907 Ga0207428_10051142 Ga0207428_100511423 151
590 3300028379 Ga0268266_10230517 Ga0268266_102305173 151
591 3300028381 Ga0268264_10472653 Ga0268264_104726532 151
592 3300028558 Ga0265326_10025190 Ga0265326_100251902 151
593 3300028573 Ga0265334_10162197 Ga0265334_101621972 151
594 3300028654 Ga0265322_10025135 Ga0265322_100251354 151
595 3300028800 Ga0265338_10967764 Ga0265338_109677641 151
596 3300031235 Ga0265330_10024642 Ga0265330_100246422 151
597 3300031235 Ga0265330_10068322 Ga0265330_100683222 151
598 3300031242 Ga0265329_10007411 Ga0265329_100074112 151
599 3300031344 Ga0265316_10052534 Ga0265316_100525343 151
600 3300031344 Ga0265316_10144264 Ga0265316_101442642 151
601 3300031711 Ga0265314_10198205 Ga0265314_101982054 151
602 3300031712 Ga0265342_10004323 Ga0265342_1000432311 151
603 3300047445 Ga0495677_0336143 Ga0495677_0336143_12_473 151
604 3300048905 Ga0496102_0894371 Ga0496102_0894371_282_737 151
605 3300050492 nmdc:mga0yw44_207652_c1 nmdc:mga0yw44_207652_c1_699_1160 151
606 3300050507 nmdc:mga05p37_291185_c1 nmdc:mga05p37_291185_c1_106_567 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

4

140

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hs9-assembly1.cif.gz_A the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876 0.9759 2 137
8idu-assembly1.cif.gz_A crystal structure of substrate bound-form dehydroquinate dehydratase from corynebacterium glutamicum 0.9752 1 142
3n8k-assembly2.cif.gz_M type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid 0.9646 3 140
3kip-assembly3.cif.gz_I crystal structure of type-ii 3-dehydroquinase from c. albicans 0.963 1 135
2uyg-assembly1.cif.gz_F crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus 0.9625 4 139
ID Description Score Start End Superfamily
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9557 3 139 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9363 3 139 3.40.50.9100
3kipN00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9242 1 139 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9231 3 139 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9227 2 150 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A6A0QX71-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9858 2 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A0H3GWB7-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9856 1 144 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-B8E0Z3-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9852 1 143 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A0E4GBK7-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9851 1 143 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A1E3B026-F1-model_v4 Catabolic 3-dehydroquinase (cDHQase) (EC 4.2.1.10) (3-dehydroquinate dehydratase) 0.9843 2 139 GO:0003855
GO:0004764
GO:0019631
GO:0046279

Feature Viewer

pLDDT pTM Quality
89.42 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map