F468554

General Info

Members Datasets Scaffolds Average Seq Length
606 278 1212 144

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100067887|Ga0070674_1000678874
Length 150
Sequence VTATGLDWTAVAVPSTLPDVVDDPISYERVIMNPGSTWDYFPGHYDPEYAREHGQPTIFVNTMHVAGFVDRVATQWAGPYGRVVRRKLILAASIYAGDTITARRSITAKRRDGDRWLIEMHVDVVNQNGEVCCPADVTLDVSKAVRTTRR

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
196 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
197 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
277 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.86
Nodule 0
Rhizoplane 8.25
Rhizosphere 74.59
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100067887 3300005356 Bacteria 2510
2 JGI24739J22299_10064285 3300001989 Bacteria 1153
3 JGI24743J22301_10017106 3300001991 Bacteria 1359
4 JGI24750J21931_1042965 3300002070 Bacteria 690
5 JGI24745J21846_1001481 3300002073 Bacteria 2283
6 JGI24748J21848_1034589 3300002074 Bacteria 632
7 JGI24749J21850_1000704 3300002076 Bacteria 4809
8 JGI24744J21845_10000579 3300002077 Bacteria 6563
9 JGI24744J21845_10001887 3300002077 Bacteria 4217
10 JGI24742J22300_10012385 3300002244 Bacteria 1421
11 Ga0070676_10002983 3300005328 Bacteria 8750
12 Ga0070683_100047745 3300005329 Bacteria 3957
13 Ga0070683_100558460 3300005329 Bacteria 1095
14 Ga0070690_100027745 3300005330 Bacteria 3502
15 Ga0070670_100536443 3300005331 Bacteria 1043
16 Ga0068869_100002460 3300005334 Bacteria 11170
17 Ga0068869_100022024 3300005334 Bacteria 4387
18 Ga0070666_10026179 3300005335 Bacteria 3808
19 Ga0070666_10044621 3300005335 Bacteria 2970
20 Ga0070682_100035219 3300005337 Bacteria 3055
21 Ga0070682_100222256 3300005337 Bacteria 1345
22 Ga0070682_100329134 3300005337 Bacteria 1131
23 Ga0068868_100000389 3300005338 Bacteria 29905
24 Ga0068868_100487703 3300005338 Bacteria 1077
25 Ga0070660_100194698 3300005339 Bacteria 1643
26 Ga0070689_100017445 3300005340 Bacteria 5273
27 Ga0070689_100063768 3300005340 Bacteria 2867
28 Ga0070687_100349363 3300005343 Bacteria 954
29 Ga0070661_101462805 3300005344 Bacteria 576
30 Ga0070668_100003585 3300005347 Bacteria 11455
31 Ga0070668_100007157 3300005347 Bacteria 8272
32 Ga0070668_100073886 3300005347 Bacteria 2659
33 Ga0070668_101138666 3300005347 Bacteria 705
34 Ga0070669_100023456 3300005353 Bacteria 4418
35 Ga0070669_100037489 3300005353 Bacteria 3517
36 Ga0070675_100525255 3300005354 Bacteria 1068
37 Ga0070675_100890878 3300005354 Bacteria 815
38 Ga0070671_100004266 3300005355 Bacteria 11309
39 Ga0070671_100382023 3300005355 Bacteria 1204
40 Ga0070674_100000125 3300005356 Bacteria 35199
41 Ga0070674_100067918 3300005356 Bacteria 2509
42 Ga0070674_100785463 3300005356 Bacteria 821
43 Ga0070673_100049241 3300005364 Bacteria 3290
44 Ga0070688_100005716 3300005365 Bacteria 6574
45 Ga0070688_100064202 3300005365 Bacteria 2329
46 Ga0070688_101595039 3300005365 Bacteria 533
47 Ga0070659_100025969 3300005366 Bacteria 4505
48 Ga0070659_100539016 3300005366 Bacteria 998
49 Ga0070667_100035604 3300005367 Bacteria 4171
50 Ga0070667_100040279 3300005367 Bacteria 3917
51 Ga0070667_100114032 3300005367 Bacteria 2346
52 Ga0070667_100501216 3300005367 Bacteria 1113
53 Ga0070709_10014619 3300005434 Bacteria 4444
54 Ga0070714_100090463 3300005435 Bacteria 2680
55 Ga0070714_100093807 3300005435 Bacteria 2633
56 Ga0070714_100133809 3300005435 Bacteria 2218
57 Ga0070714_100236098 3300005435 Bacteria 1686
58 Ga0070713_100331117 3300005436 Bacteria 1408
59 Ga0070710_10000998 3300005437 Bacteria 13476
60 Ga0070710_10022299 3300005437 Bacteria 3309
61 Ga0070701_10118273 3300005438 Bacteria 1490
62 Ga0070711_100000244 3300005439 Bacteria 27954
63 Ga0070705_100009171 3300005440 Bacteria 4912
64 Ga0070705_100238025 3300005440 Bacteria 1271
65 Ga0070700_100000508 3300005441 Bacteria 19367
66 Ga0070700_100239971 3300005441 Bacteria 1295
67 Ga0070694_100044937 3300005444 Bacteria 2958
68 Ga0070694_100306839 3300005444 Bacteria 1218
69 Ga0070663_100019323 3300005455 Bacteria 4487
70 Ga0070663_100061540 3300005455 Bacteria 2704
71 Ga0070663_100678557 3300005455 Unclassified 874
72 Ga0070678_100001179 3300005456 Bacteria 13874
73 Ga0070678_100046404 3300005456 Bacteria 3115
74 Ga0070678_100139752 3300005456 Bacteria 1936
75 Ga0070678_100388292 3300005456 Bacteria 1209
76 Ga0070662_100057950 3300005457 Bacteria 2816
77 Ga0070662_101107369 3300005457 Bacteria 679
78 Ga0068867_100000535 3300005459 Bacteria 25035
79 Ga0070685_10239073 3300005466 Bacteria 1198
80 Ga0070685_11074757 3300005466 Bacteria 607
81 Ga0070707_101070708 3300005468 Bacteria 772
82 Ga0070684_100511814 3300005535 Bacteria 1112
83 Ga0070684_100548642 3300005535 Bacteria 1072
84 Ga0068853_100001519 3300005539 Bacteria 16875
85 Ga0070672_100104060 3300005543 Bacteria 2306
86 Ga0070686_100820831 3300005544 Bacteria 751
87 Ga0070695_100036272 3300005545 Bacteria 3102
88 Ga0070695_100926306 3300005545 Bacteria 705
89 Ga0070696_100001935 3300005546 Bacteria 13647
90 Ga0070696_100048911 3300005546 Bacteria 2936
91 Ga0070665_100001305 3300005548 Bacteria 29768
92 Ga0070665_100348948 3300005548 Bacteria 1485
93 Ga0070665_100890926 3300005548 Bacteria 902
94 Ga0070665_101072085 3300005548 Bacteria 817
95 Ga0070704_100000174 3300005549 Bacteria 25726
96 Ga0068855_100081725 3300005563 Bacteria 3745
97 Ga0068855_100652973 3300005563 Bacteria 1129
98 Ga0070664_100161684 3300005564 Bacteria 1981
99 Ga0068854_100021666 3300005578 Bacteria 4363
100 Ga0068854_100049301 3300005578 Bacteria 3007
101 Ga0068854_100069471 3300005578 Bacteria 2572
102 Ga0068856_100314609 3300005614 Bacteria 1583
103 Ga0070702_100001917 3300005615 Bacteria 8740
104 Ga0070702_100119132 3300005615 Bacteria 1650
105 Ga0068852_100006688 3300005616 Bacteria 8356
106 Ga0068852_100293088 3300005616 Bacteria 1572
107 Ga0068859_100000801 3300005617 Bacteria 31888
108 Ga0068859_100362669 3300005617 Bacteria 1544
109 Ga0068864_100225266 3300005618 Bacteria 1731
110 Ga0068866_10007585 3300005718 Bacteria 4548
111 Ga0068861_100001120 3300005719 Bacteria 16617
112 Ga0068861_100183293 3300005719 Bacteria 1744
113 Ga0068863_100108540 3300005841 Bacteria 2641
114 Ga0068863_100173974 3300005841 Bacteria 2066
115 Ga0068863_100371838 3300005841 Bacteria 1395
116 Ga0068858_100001869 3300005842 Bacteria 21484
117 Ga0068858_100017025 3300005842 Bacteria 6824
118 Ga0068860_100000743 3300005843 Bacteria 37175
119 Ga0068860_100213742 3300005843 Bacteria 1871
120 Ga0068860_100245647 3300005843 Bacteria 1742
121 Ga0068862_100001026 3300005844 Bacteria 26891
122 Ga0068862_100501859 3300005844 Bacteria 1152
123 Ga0081455_10044627 3300005937 Bacteria 3865
124 Ga0081455_10083296 3300005937 Bacteria 2614
125 Ga0081455_10306014 3300005937 Bacteria 1138
126 Ga0081538_10072604 3300005981 Bacteria 1885
127 Ga0070717_10302650 3300006028 Bacteria 1422
128 Ga0075365_10004619 3300006038 Bacteria 7327
129 Ga0075365_10007664 3300006038 Bacteria 6069
130 Ga0075365_10066185 3300006038 Bacteria 2424
131 Ga0075365_10070307 3300006038 Bacteria 2354
132 Ga0075368_10045600 3300006042 Bacteria 1732
133 Ga0075363_100001048 3300006048 Bacteria 9975
134 Ga0075363_100002626 3300006048 Bacteria 7403
135 Ga0075363_100006337 3300006048 Bacteria 5361
136 Ga0075363_100009225 3300006048 Bacteria 4634
137 Ga0075363_100016825 3300006048 Bacteria 3616
138 Ga0075363_100034249 3300006048 Bacteria 2650
139 Ga0075363_100036604 3300006048 Bacteria 2575
140 Ga0075363_100043685 3300006048 Bacteria 2371
141 Ga0075363_100097538 3300006048 Bacteria 1624
142 Ga0075363_100108212 3300006048 Bacteria 1543
143 Ga0075363_100209763 3300006048 Bacteria 1115
144 Ga0075363_100337218 3300006048 Bacteria 879
145 Ga0075363_100459225 3300006048 Bacteria 753
146 Ga0075364_10003298 3300006051 Bacteria 9151
147 Ga0075364_10010821 3300006051 Bacteria 5523
148 Ga0075364_10011804 3300006051 Bacteria 5318
149 Ga0075364_10034163 3300006051 Bacteria 3279
150 Ga0075364_10053074 3300006051 Bacteria 2650
151 Ga0075364_10103129 3300006051 Bacteria 1900
152 Ga0070715_10018541 3300006163 Bacteria 2653
153 Ga0070715_10103781 3300006163 Bacteria 1330
154 Ga0070716_100004418 3300006173 Bacteria 6723
155 Ga0070716_100013940 3300006173 Bacteria 4109
156 Ga0070712_100001412 3300006175 Bacteria 14596
157 Ga0070712_100034871 3300006175 Bacteria 3412
158 Ga0070712_100124739 3300006175 Bacteria 1943
159 Ga0075362_10035466 3300006177 Bacteria 2178
160 Ga0075362_10164641 3300006177 Bacteria 1069
161 Ga0075367_10008822 3300006178 Bacteria 5245
162 Ga0075367_10029647 3300006178 Bacteria 3132
163 Ga0075367_10029720 3300006178 Bacteria 3129
164 Ga0075367_10048752 3300006178 Bacteria 2496
165 Ga0075367_10296727 3300006178 Bacteria 1017
166 Ga0075367_10441017 3300006178 Bacteria 825
167 Ga0075369_10005518 3300006186 Bacteria 4731
168 Ga0075369_10006877 3300006186 Bacteria 4319
169 Ga0075369_10045102 3300006186 Bacteria 1895
170 Ga0075369_10108346 3300006186 Bacteria 1251
171 Ga0075369_10115331 3300006186 Bacteria 1213
172 Ga0075369_10122548 3300006186 Bacteria 1178
173 Ga0075370_10000221 3300006353 Bacteria 20271
174 Ga0075370_10002682 3300006353 Bacteria 8327
175 Ga0075370_10037972 3300006353 Bacteria 2710
176 Ga0075370_10210438 3300006353 Bacteria 1148
177 Ga0075370_10402215 3300006353 Bacteria 821
178 Ga0068871_100619349 3300006358 Bacteria 986
179 Ga0075428_100021051 3300006844 Bacteria 7222
180 Ga0075430_100010789 3300006846 Bacteria 7741
181 Ga0075431_100071733 3300006847 Bacteria 3574
182 Ga0068865_100000524 3300006881 Bacteria 21450
183 Ga0068865_100309244 3300006881 Bacteria 1267
184 Ga0097620_100000801 3300006931 Bacteria 31888
185 Ga0097620_100362679 3300006931 Bacteria 1544
186 Ga0099795_10008103 3300007788 Bacteria 2977
187 Ga0099795_10043487 3300007788 Bacteria 1608
188 Ga0105250_10040197 3300009092 Bacteria 1876
189 Ga0105240_11359981 3300009093 Bacteria 747
190 Ga0105240_11368144 3300009093 Bacteria 745
191 Ga0111539_10593742 3300009094 Bacteria 1289
192 Ga0111539_12086205 3300009094 Bacteria 658
193 Ga0105245_10000805 3300009098 Bacteria 28521
194 Ga0105245_10045086 3300009098 Bacteria 3937
195 Ga0105245_11134749 3300009098 Bacteria 828
196 Ga0105247_10000806 3300009101 Bacteria 23917
197 Ga0105247_10098042 3300009101 Bacteria 1870
198 Ga0105247_10177945 3300009101 Bacteria 1418
199 Ga0114129_10024084 3300009147 Bacteria 8626
200 Ga0105243_10000892 3300009148 Bacteria 28107
201 Ga0105241_10035178 3300009174 Bacteria 3768
202 Ga0105241_11085106 3300009174 Bacteria 753
203 Ga0105242_10000906 3300009176 Bacteria 23034
204 Ga0105242_10168310 3300009176 Bacteria 1924
205 Ga0105242_10178073 3300009176 Bacteria 1874
206 Ga0105248_10000634 3300009177 Bacteria 39924
207 Ga0105248_10174435 3300009177 Bacteria 2423
208 Ga0105237_10033645 3300009545 Bacteria 5194
209 Ga0105237_10356785 3300009545 Bacteria 1466
210 Ga0105238_10346317 3300009551 Bacteria 1475
211 Ga0105249_10002484 3300009553 Bacteria 15975
212 Ga0105249_10016052 3300009553 Bacteria 6637
213 Ga0105249_10189334 3300009553 Bacteria 2007
214 Ga0105249_10300081 3300009553 Bacteria 1611
215 Ga0105239_10148422 3300010375 Bacteria 2616
216 Ga0105239_10157411 3300010375 Bacteria 2538
217 Ga0105239_10521733 3300010375 Bacteria 1351
218 Ga0105239_10665596 3300010375 Bacteria 1189
219 Ga0105239_11603126 3300010375 Bacteria 753
220 Ga0105246_10177312 3300011119 Bacteria 1638
221 Ga0157369_10170757 3300013105 Bacteria 2291
222 Ga0157369_10639886 3300013105 Bacteria 1097
223 Ga0157369_10785826 3300013105 Bacteria 978
224 Ga0157374_10029376 3300013296 Bacteria 4977
225 Ga0157374_10149026 3300013296 Bacteria 2274
226 Ga0157374_11148287 3300013296 Bacteria 798
227 Ga0157378_10002708 3300013297 Bacteria 15786
228 Ga0157378_10262888 3300013297 Bacteria 1656
229 Ga0157378_10567256 3300013297 Bacteria 1142
230 Ga0163162_10001291 3300013306 Bacteria 23417
231 Ga0163162_10088265 3300013306 Bacteria 3181
232 Ga0163162_10191522 3300013306 Bacteria 2173
233 Ga0163162_10354421 3300013306 Bacteria 1600
234 Ga0163162_10844671 3300013306 Bacteria 1031
235 Ga0163162_10915537 3300013306 Bacteria 989
236 Ga0157372_10038530 3300013307 Bacteria 5275
237 Ga0157372_10743153 3300013307 Bacteria 1141
238 Ga0157372_10820681 3300013307 Bacteria 1080
239 Ga0157372_11047809 3300013307 Unclassified 944
240 Ga0157375_10000618 3300013308 Bacteria 31552
241 Ga0157375_10164842 3300013308 Bacteria 2360
242 Ga0163163_10005850 3300014325 Bacteria 10698
243 Ga0163163_11069309 3300014325 Bacteria 870
244 Ga0157380_10001643 3300014326 Bacteria 14727
245 Ga0157380_11418713 3300014326 Bacteria 745
246 Ga0157377_10136720 3300014745 Bacteria 1502
247 Ga0157377_10368428 3300014745 Bacteria 969
248 Ga0157377_10512880 3300014745 Bacteria 840
249 Ga0157379_10004513 3300014968 Bacteria 11942
250 Ga0157379_10167932 3300014968 Bacteria 1981
251 Ga0157376_11301234 3300014969 Unclassified 757
252 Ga0163161_10000599 3300017792 Bacteria 28842
253 Ga0163161_10392263 3300017792 Bacteria 1112
254 Ga0213876_10001584 3300021384 Bacteria 13984
255 Ga0213876_10004064 3300021384 Bacteria 8231
256 Ga0213876_10007047 3300021384 Bacteria 6128
257 Ga0213876_10435075 3300021384 Bacteria 698
258 Ga0213875_10073245 3300021388 Bacteria 1598
259 Ga0207692_10017950 3300025898 Bacteria 3166
260 Ga0207692_10115508 3300025898 Bacteria 1495
261 Ga0207642_10003369 3300025899 Bacteria 5036
262 Ga0207710_10002182 3300025900 Bacteria 9199
263 Ga0207688_10000270 3300025901 Bacteria 23699
264 Ga0207688_10000382 3300025901 Bacteria 20691
265 Ga0207680_10247662 3300025903 Bacteria 1230
266 Ga0207680_10284378 3300025903 Bacteria 1150
267 Ga0207647_10052122 3300025904 Bacteria 2526
268 Ga0207685_10020626 3300025905 Bacteria 2194
269 Ga0207699_10219901 3300025906 Bacteria 1296
270 Ga0207645_10006454 3300025907 Bacteria 8415
271 Ga0207654_10225041 3300025911 Bacteria 1246
272 Ga0207654_10244027 3300025911 Bacteria 1201
273 Ga0207671_10118504 3300025914 Bacteria 2022
274 Ga0207671_10529207 3300025914 Bacteria 940
275 Ga0207693_10001225 3300025915 Bacteria 22880
276 Ga0207693_10001655 3300025915 Bacteria 19649
277 Ga0207693_10871538 3300025915 Bacteria 692
278 Ga0207663_10002421 3300025916 Bacteria 8959
279 Ga0207663_11357422 3300025916 Bacteria 572
280 Ga0207660_10390975 3300025917 Bacteria 1119
281 Ga0207662_10288619 3300025918 Bacteria 1088
282 Ga0207657_10065807 3300025919 Bacteria 3088
283 Ga0207646_10880800 3300025922 Bacteria 795
284 Ga0207681_10501013 3300025923 Bacteria 994
285 Ga0207694_10240492 3300025924 Bacteria 1480
286 Ga0207659_10498603 3300025926 Bacteria 1030
287 Ga0207659_10734131 3300025926 Bacteria 846
288 Ga0207687_10001234 3300025927 Bacteria 17530
289 Ga0207687_10100267 3300025927 Bacteria 2130
290 Ga0207700_10118359 3300025928 Bacteria 2143
291 Ga0207664_10037472 3300025929 Bacteria 3753
292 Ga0207664_10074650 3300025929 Bacteria 2740
293 Ga0207664_10083213 3300025929 Bacteria 2608
294 Ga0207644_10001978 3300025931 Bacteria 13252
295 Ga0207644_10310917 3300025931 Bacteria 1272
296 Ga0207690_10214143 3300025932 Bacteria 1470
297 Ga0207690_10331503 3300025932 Bacteria 1199
298 Ga0207706_10007698 3300025933 Bacteria 9945
299 Ga0207706_10045648 3300025933 Bacteria 3881
300 Ga0207686_10008090 3300025934 Bacteria 5672
301 Ga0207686_10289443 3300025934 Bacteria 1212
302 Ga0207709_10003516 3300025935 Bacteria 9272
303 Ga0207670_10559539 3300025936 Bacteria 935
304 Ga0207670_11879242 3300025936 Bacteria 509
305 Ga0207669_10002869 3300025937 Bacteria 7392
306 Ga0207669_10087374 3300025937 Bacteria 2019
307 Ga0207669_10488940 3300025937 Bacteria 982
308 Ga0207704_10001123 3300025938 Bacteria 11913
309 Ga0207704_10254824 3300025938 Bacteria 1320
310 Ga0207665_10001338 3300025939 Bacteria 16617
311 Ga0207665_10017396 3300025939 Bacteria 4724
312 Ga0207691_10160279 3300025940 Bacteria 1974
313 Ga0207711_10115319 3300025941 Bacteria 2394
314 Ga0207711_10430655 3300025941 Bacteria 1227
315 Ga0207711_11106676 3300025941 Bacteria 733
316 Ga0207689_10006263 3300025942 Bacteria 10546
317 Ga0207661_10147973 3300025944 Bacteria 2028
318 Ga0207661_10507409 3300025944 Bacteria 1102
319 Ga0207679_11638988 3300025945 Bacteria 589
320 Ga0207667_10331089 3300025949 Bacteria 1555
321 Ga0207651_10202985 3300025960 Bacteria 1590
322 Ga0207712_10008147 3300025961 Bacteria 6630
323 Ga0207712_10017694 3300025961 Bacteria 4633
324 Ga0207668_10000479 3300025972 Bacteria 25024
325 Ga0207668_10006207 3300025972 Bacteria 7056
326 Ga0207668_10065194 3300025972 Bacteria 2577
327 Ga0207668_10196764 3300025972 Bacteria 1602
328 Ga0207668_10534515 3300025972 Bacteria 1013
329 Ga0207640_10026132 3300025981 Bacteria 3542
330 Ga0207640_10045786 3300025981 Bacteria 2811
331 Ga0207658_10005225 3300025986 Bacteria 8930
332 Ga0207658_10021670 3300025986 Bacteria 4464
333 Ga0207658_10074079 3300025986 Bacteria 2586
334 Ga0207658_10091775 3300025986 Bacteria 2357
335 Ga0207658_10519180 3300025986 Bacteria 1063
336 Ga0207658_11174523 3300025986 Bacteria 701
337 Ga0207677_10003876 3300026023 Bacteria 7965
338 Ga0207677_10647450 3300026023 Bacteria 932
339 Ga0207677_11534102 3300026023 Bacteria 616
340 Ga0207703_10046821 3300026035 Bacteria 3485
341 Ga0207703_10266878 3300026035 Bacteria 1549
342 Ga0207639_10020634 3300026041 Bacteria 4719
343 Ga0207639_10157364 3300026041 Bacteria 1910
344 Ga0207678_10047504 3300026067 Bacteria 3712
345 Ga0207678_10105960 3300026067 Bacteria 2398
346 Ga0207678_11243318 3300026067 Bacteria 659
347 Ga0207708_10001666 3300026075 Bacteria 16496
348 Ga0207708_10159426 3300026075 Bacteria 1781
349 Ga0207702_10439079 3300026078 Bacteria 1265
350 Ga0207641_10347305 3300026088 Bacteria 1413
351 Ga0207648_10000503 3300026089 Bacteria 43631
352 Ga0207676_10186035 3300026095 Bacteria 1823
353 Ga0207675_100000419 3300026118 Bacteria 41020
354 Ga0207675_100015207 3300026118 Bacteria 7179
355 Ga0207675_100244914 3300026118 Bacteria 1733
356 Ga0207675_101036826 3300026118 Bacteria 839
357 Ga0207675_101053387 3300026118 Bacteria 832
358 Ga0207683_10000386 3300026121 Bacteria 40766
359 Ga0207683_10008028 3300026121 Bacteria 9024
360 Ga0207683_10080820 3300026121 Bacteria 2884
361 Ga0207698_10024355 3300026142 Bacteria 4247
362 Ga0207698_10307403 3300026142 Bacteria 1479
363 Ga0207698_10739986 3300026142 Bacteria 981
364 Ga0207428_10734750 3300027907 Bacteria 704
365 Ga0268266_10001251 3300028379 Bacteria 31039
366 Ga0268266_10406888 3300028379 Bacteria 1287
367 Ga0268266_10949173 3300028379 Bacteria 832
368 Ga0268265_10002139 3300028380 Bacteria 15330
369 Ga0268265_11003874 3300028380 Bacteria 824
370 Ga0268264_10002766 3300028381 Bacteria 15302
371 Ga0268264_10128031 3300028381 Bacteria 2247
372 Ga0268264_10618445 3300028381 Bacteria 1069
373 Ga0307408_101312159 3300031548 Bacteria 679
374 Ga0307408_101708470 3300031548 Bacteria 600
375 Ga0307405_10143273 3300031731 Bacteria 1670
376 Ga0307413_10028476 3300031824 Bacteria 3112
377 Ga0307410_10330441 3300031852 Bacteria 1212
378 Ga0307409_100007080 3300031995 Bacteria 6675
379 Ga0307409_100084507 3300031995 Bacteria 2577
380 Ga0307409_100306125 3300031995 Bacteria 1481
381 Ga0307409_100807870 3300031995 Bacteria 946
382 Ga0307414_10570681 3300032004 Bacteria 1011
383 Ga0307411_10765188 3300032005 Bacteria 847
384 Ga0307415_100493129 3300032126 Bacteria 1069
385 Ga0373938_0021490 3300034957 Bacteria 1309
386 Ga0373931_0105078 3300035691 Bacteria 1594
387 Ga0395905_1744030 3300037471 Bacteria 528
388 Ga0436364_0030999 3300037853 Bacteria 2392
389 Ga0436364_0242294 3300037853 Bacteria 6377
390 Ga0436364_0665239 3300037853 Bacteria 42065
391 Ga0436364_0802881 3300037853 Bacteria 1824
392 Ga0436365_0721081 3300039437 Bacteria 39279
393 Ga0436365_0794149 3300039437 Bacteria 2686
394 Ga0436365_0960868 3300039437 Bacteria 27381
395 Ga0436365_1223684 3300039437 Bacteria 600
396 Ga0436365_1377785 3300039437 Bacteria 3381
397 Ga0436365_1889369 3300039437 Bacteria 169293
398 Ga0436360_1120387 3300039438 Bacteria 917
399 Ga0436361_0681598 3300039447 Bacteria 2053
400 Ga0436363_1258598 3300039450 Bacteria 819
401 Ga0439461_0008990 3300041410 Bacteria 1804
402 Ga0439466_0017846 3300041411 Bacteria 2552
403 Ga0439466_0070176 3300041411 Bacteria 1117
404 Ga0439466_0086454 3300041411 Bacteria 985
405 Ga0439465_0027323 3300041413 Bacteria 1807
406 Ga0439465_0029587 3300041413 Bacteria 1740
407 Ga0439465_0071135 3300041413 Bacteria 1166
408 Ga0451839_0295342 3300041496 Bacteria 662
409 Ga0439442_008156 3300042002 Bacteria 2115
410 Ga0439434_0046251 3300042435 Bacteria 1343
411 Ga0439435_0022302 3300042436 Bacteria 1652
412 Ga0466969_0164046 3300044656 Bacteria 1020
413 Ga0466972_0002516 3300044658 Bacteria 9068
414 Ga0466965_0011032 3300044683 Bacteria 4226
415 Ga0466966_0001679 3300044684 Bacteria 14284
416 Ga0466966_0022144 3300044684 Bacteria 4172
417 Ga0466966_0519389 3300044684 Bacteria 716
418 Ga0466966_0530695 3300044684 Bacteria 708
419 Ga0466961_0096110 3300044693 Bacteria 1868
420 Ga0466961_0118602 3300044693 Bacteria 1662
421 Ga0466963_0066094 3300044694 Bacteria 2425
422 Ga0466963_0137175 3300044694 Bacteria 1693
423 Ga0466963_0217551 3300044694 Bacteria 1337
424 Ga0466964_0268110 3300044706 Bacteria 849
425 Ga0466964_0455860 3300044706 Bacteria 679
426 Ga0466964_0817567 3300044706 Bacteria 528
427 Ga0466971_0004569 3300044719 Bacteria 5982
428 Ga0466971_0333423 3300044719 Bacteria 732
429 Ga0466971_0469560 3300044719 Bacteria 618
430 Ga0466968_0034198 3300044735 Bacteria 2120
431 Ga0466968_0127744 3300044735 Bacteria 1155
432 Ga0466968_0177488 3300044735 Bacteria 989
433 Ga0466970_0025149 3300044765 Bacteria 3116
434 Ga0466970_0032195 3300044765 Bacteria 2770
435 Ga0466957_0017541 3300044842 Bacteria 4195
436 Ga0466957_0059953 3300044842 Bacteria 2333
437 Ga0466960_0074193 3300044901 Bacteria 1699
438 Ga0466960_0125083 3300044901 Bacteria 1351
439 Ga0466960_0489614 3300044901 Bacteria 719
440 Ga0466960_0530902 3300044901 Bacteria 692
441 Ga0466960_0693878 3300044901 Bacteria 610
442 Ga0466959_0004496 3300045049 Bacteria 9345
443 Ga0466959_0033627 3300045049 Bacteria 3792
444 Ga0466959_0037394 3300045049 Bacteria 3586
445 Ga0466959_0269289 3300045049 Bacteria 1171
446 Ga0466958_0004643 3300045836 Bacteria 7285
447 Ga0466958_0004830 3300045836 Bacteria 7172
448 Ga0466958_0012441 3300045836 Bacteria 4823
449 Ga0466958_0053295 3300045836 Bacteria 2452
450 Ga0466958_0144513 3300045836 Bacteria 1499
451 Ga0466958_0275596 3300045836 Unclassified 1078
452 Ga0466967_0008819 3300045976 Bacteria 7432
453 Ga0466967_0030088 3300045976 Bacteria 4553
454 Ga0466967_0030948 3300045976 Bacteria 4498
455 Ga0466967_0106591 3300045976 Bacteria 2569
456 Ga0466967_0367282 3300045976 Bacteria 1395
457 Ga0466967_0540036 3300045976 Bacteria 1147
458 Ga0466967_1164391 3300045976 Bacteria 768
459 Ga0466967_1365433 3300045976 Bacteria 706
460 Ga0495638_0002268 3300046460 Bacteria 15912
461 Ga0495638_0342812 3300046460 Bacteria 791
462 Ga0495641_0104866 3300046461 Bacteria 1261
463 Ga0495582_0014315 3300046473 Bacteria 4362
464 Ga0495620_0175831 3300046515 Bacteria 829
465 Ga0495665_0201679 3300046531 Bacteria 1031
466 Ga0495640_0018975 3300046533 Bacteria 5086
467 Ga0495667_0220744 3300046559 Bacteria 1210
468 Ga0495624_0176157 3300046690 Bacteria 1304
469 Ga0495581_0222451 3300047315 Bacteria 1104
470 Ga0495674_0193718 3300047319 Bacteria 1688
471 Ga0495672_0405907 3300047320 Bacteria 622
472 Ga0495676_0093224 3300047321 Bacteria 2246
473 Ga0495686_0365164 3300047472 Bacteria 782
474 Ga0495593_0015017 3300047673 Bacteria 4398
475 Ga0495626_0325355 3300048091 Unclassified 603
476 Ga0496100_0187772 3300048903 Bacteria 1498
477 Ga0496100_0191174 3300048903 Bacteria 1486
478 Ga0496101_0000975 3300048904 Bacteria 16910
479 Ga0496101_0009128 3300048904 Bacteria 6508
480 Ga0496101_0589547 3300048904 Bacteria 879
481 Ga0496102_0003144 3300048905 Bacteria 14009
482 Ga0496102_0008220 3300048905 Bacteria 8931
483 Ga0496102_0138570 3300048905 Bacteria 2280
484 Ga0496102_0658859 3300048905 Bacteria 970
485 Ga0496103_0001134 3300048906 Bacteria 18514
486 Ga0496103_0037533 3300048906 Bacteria 2969
487 Ga0496103_0341929 3300048906 Bacteria 962
488 Ga0496104_0166863 3300048907 Bacteria 2111
489 Ga0496104_0660451 3300048907 Bacteria 954
490 Ga0496104_0663000 3300048907 Bacteria 952
491 Ga0496105_0035091 3300048908 Bacteria 4127
492 Ga0496105_0366192 3300048908 Bacteria 1149
493 Ga0496105_0572925 3300048908 Bacteria 879
494 Ga0496106_0000769 3300048909 Bacteria 23204
495 Ga0496106_0010379 3300048909 Bacteria 6880
496 Ga0496107_0000672 3300048910 Bacteria 19397
497 Ga0496107_0016601 3300048910 Bacteria 5173
498 Ga0496107_0188925 3300048910 Bacteria 1530
499 Ga0496108_0017265 3300048911 Bacteria 5903
500 Ga0496108_0017612 3300048911 Bacteria 5845
501 Ga0496108_0058779 3300048911 Bacteria 3232
502 Ga0496108_0169503 3300048911 Bacteria 1889
503 Ga0496108_0738505 3300048911 Bacteria 852
504 Ga0496109_0010719 3300048912 Bacteria 7843
505 Ga0496109_0110430 3300048912 Bacteria 2556
506 Ga0496109_1963235 3300048912 Bacteria 517
507 Ga0496110_0439274 3300048913 Bacteria 1189
508 Ga0496110_0659217 3300048913 Bacteria 947
509 Ga0496110_1115535 3300048913 Bacteria 697
510 Ga0496111_0108143 3300048914 Bacteria 2048
511 Ga0496111_0199894 3300048914 Bacteria 1486
512 Ga0496112_0005828 3300048915 Bacteria 10724
513 Ga0496112_0006731 3300048915 Bacteria 10122
514 Ga0496112_0431381 3300048915 Bacteria 1256
515 Ga0496112_0632785 3300048915 Bacteria 1000
516 Ga0496112_0912298 3300048915 Bacteria 800
517 Ga0496113_0080841 3300048916 Bacteria 2490
518 Ga0496113_0161762 3300048916 Bacteria 1770
519 Ga0496114_0000486 3300048917 Bacteria 29134
520 Ga0496114_0004712 3300048917 Bacteria 10612
521 Ga0496114_0052904 3300048917 Bacteria 3384
522 Ga0496115_0003434 3300048918 Bacteria 11382
523 Ga0496115_0026040 3300048918 Bacteria 4561
524 Ga0496115_0096325 3300048918 Bacteria 2423
525 Ga0496115_0921436 3300048918 Bacteria 673
526 Ga0496117_0241953 3300048920 Bacteria 990
527 Ga0496118_0000237 3300048921 Bacteria 97002
528 Ga0496126_0015493 3300048929 Bacteria 7668
529 Ga0501031_0398825 3300049568 Bacteria 890
530 Ga0501033_0015347 3300049570 Bacteria 5812
531 Ga0501033_0115667 3300049570 Bacteria 1949
532 Ga0501034_0001933 3300049571 Bacteria 26226
533 Ga0501034_0071795 3300049571 Bacteria 3471
534 Ga0501034_0236485 3300049571 Bacteria 1774
535 Ga0501037_0008336 3300049573 Bacteria 7597
536 Ga0501046_0000668 3300049580 Bacteria 33287
537 Ga0501046_0490863 3300049580 Bacteria 880
538 Ga0501047_0133298 3300049581 Bacteria 2364
539 Ga0501047_0253380 3300049581 Bacteria 1608
540 Ga0501047_0288812 3300049581 Bacteria 1484
541 Ga0501048_0013996 3300049582 Bacteria 5947
542 Ga0501048_0161680 3300049582 Bacteria 1585
543 Ga0501069_1006894 3300049585 Unclassified 509
544 Ga0501070_0003985 3300049586 Bacteria 12700
545 Ga0501070_0164859 3300049586 Bacteria 1826
546 Ga0501070_0755794 3300049586 Bacteria 766
547 Ga0501072_0874875 3300049588 Bacteria 702
548 Ga0501080_0072691 3300049742 Bacteria 3200
549 Ga0501080_0734159 3300049742 Bacteria 869
550 Ga0501083_0622299 3300049744 Bacteria 702
551 Ga0501035_0000435 3300049822 Bacteria 46844
552 Ga0501035_0007079 3300049822 Bacteria 10484
553 Ga0501035_0241891 3300049822 Bacteria 1535
554 Ga0501044_0004535 3300049823 Bacteria 15533
555 Ga0501044_0036668 3300049823 Bacteria 5128
556 Ga0501044_0157229 3300049823 Bacteria 2252
557 nmdc:mga03683_114293_c1 3300050489 Bacteria 1196
558 nmdc:mga03683_37680_c1 3300050489 Bacteria 1971
559 nmdc:mga03683_5014_c2 3300050489 Bacteria 3417
560 nmdc:mga03n38_164247_c1 3300050490 Bacteria 1126
561 nmdc:mga03n38_19894_c1 3300050490 Bacteria 2676
562 nmdc:mga03n38_2649_c1 3300050490 Bacteria 5587
563 nmdc:mga03n38_406185_c1 3300050490 Bacteria 751
564 nmdc:mga03n38_41974_c1 3300050490 Bacteria 1997
565 nmdc:mga03n38_632690_c1 3300050490 Bacteria 612
566 nmdc:mga03n38_86217_c1 3300050490 Bacteria 1486
567 nmdc:mga03n38_88837_c1 3300050490 Bacteria 1467
568 nmdc:mga00v17_31125_c1 3300050491 Bacteria 3145
569 nmdc:mga00v17_319559_c1 3300050491 Bacteria 1009
570 nmdc:mga00v17_330983_c1 3300050491 Bacteria 990
571 nmdc:mga00v17_61380_c1 3300050491 Bacteria 2311
572 nmdc:mga00v17_6215_c1 3300050491 Bacteria 6334
573 nmdc:mga0yw44_124877_c1 3300050492 Bacteria 1661
574 nmdc:mga0yw44_18449_c2 3300050492 Bacteria 2343
575 nmdc:mga0yw44_38112_c1 3300050492 Bacteria 2842
576 nmdc:mga06z11_107464_c1 3300050494 Bacteria 1540
577 nmdc:mga06z11_137355_c1 3300050494 Bacteria 1378
578 nmdc:mga06z11_25315_c1 3300050494 Bacteria 2811
579 nmdc:mga06z11_253943_c1 3300050494 Bacteria 1036
580 nmdc:mga06z11_320018_c1 3300050494 Bacteria 925
581 nmdc:mga06z11_716952_c1 3300050494 Bacteria 609
582 nmdc:mga07m45_12915_c1 3300050496 Bacteria 4419
583 nmdc:mga07m45_147899_c1 3300050496 Bacteria 1362
584 nmdc:mga07m45_175508_c1 3300050496 Bacteria 1246
585 nmdc:mga07m45_352609_c1 3300050496 Bacteria 855
586 nmdc:mga07m45_417742_c1 3300050496 Bacteria 778
587 nmdc:mga07m45_43621_c1 3300050496 Bacteria 2515
588 nmdc:mga05p37_14495_c2 3300050507 Bacteria 8751
589 nmdc:mga0qj67_32207_c1 3300050509 Bacteria 4087
590 nmdc:mga0qj67_71298_c1 3300050509 Bacteria 2773
591 nmdc:mga06r32_93354_c1 3300050510 Bacteria 2943
592 nmdc:mga08x19_925278_c1 3300050514 Bacteria 619
593 nmdc:mga0sz30_105099_c1 3300050516 Bacteria 1235
594 nmdc:mga0sz30_150354_c1 3300050516 Bacteria 1030
595 nmdc:mga0sz30_4368_c1 3300050516 Bacteria 5106
596 nmdc:mga0sz30_4708_c1 3300050516 Bacteria 4953
597 nmdc:mga0sz30_5802_c1 3300050516 Bacteria 4548
598 Ga0500610_0069680 3300053079 Bacteria 1834
599 Ga0495655_0009315 3300053083 Bacteria 1900
600 Ga0500644_0029911 3300053088 Bacteria 1718
601 Ga0500562_008330 3300053108 Bacteria 2619
602 Ga0500562_159561 3300053108 Bacteria 614
603 Ga0500642_0105006 3300053130 Bacteria 1317
604 Ga0466962_0002379 3300061719 Bacteria 8909
605 Ga0466962_0043507 3300061719 Bacteria 2149
606 Ga0466962_0158224 3300061719 Bacteria 1101
607 Ga0070674_100067887
608 JGI24739J22299_10064285
609 JGI24743J22301_10017106
610 JGI24750J21931_1042965
611 JGI24745J21846_1001481
612 JGI24748J21848_1034589
613 JGI24749J21850_1000704
614 JGI24744J21845_10000579
615 JGI24744J21845_10001887
616 JGI24742J22300_10012385
617 Ga0070676_10002983
618 Ga0070683_100047745
619 Ga0070683_100558460
620 Ga0070690_100027745
621 Ga0070670_100536443
622 Ga0068869_100002460
623 Ga0068869_100022024
624 Ga0070666_10026179
625 Ga0070666_10044621
626 Ga0070682_100035219
627 Ga0070682_100222256
628 Ga0070682_100329134
629 Ga0068868_100000389
630 Ga0068868_100487703
631 Ga0070660_100194698
632 Ga0070689_100017445
633 Ga0070689_100063768
634 Ga0070687_100349363
635 Ga0070661_101462805
636 Ga0070668_100003585
637 Ga0070668_100007157
638 Ga0070668_100073886
639 Ga0070668_101138666
640 Ga0070669_100023456
641 Ga0070669_100037489
642 Ga0070675_100525255
643 Ga0070675_100890878
644 Ga0070671_100004266
645 Ga0070671_100382023
646 Ga0070674_100000125
647 Ga0070674_100067918
648 Ga0070674_100785463
649 Ga0070673_100049241
650 Ga0070688_100005716
651 Ga0070688_100064202
652 Ga0070688_101595039
653 Ga0070659_100025969
654 Ga0070659_100539016
655 Ga0070667_100035604
656 Ga0070667_100040279
657 Ga0070667_100114032
658 Ga0070667_100501216
659 Ga0070709_10014619
660 Ga0070714_100090463
661 Ga0070714_100093807
662 Ga0070714_100133809
663 Ga0070714_100236098
664 Ga0070713_100331117
665 Ga0070710_10000998
666 Ga0070710_10022299
667 Ga0070701_10118273
668 Ga0070711_100000244
669 Ga0070705_100009171
670 Ga0070705_100238025
671 Ga0070700_100000508
672 Ga0070700_100239971
673 Ga0070694_100044937
674 Ga0070694_100306839
675 Ga0070663_100019323
676 Ga0070663_100061540
677 Ga0070663_100678557
678 Ga0070678_100001179
679 Ga0070678_100046404
680 Ga0070678_100139752
681 Ga0070678_100388292
682 Ga0070662_100057950
683 Ga0070662_101107369
684 Ga0068867_100000535
685 Ga0070685_10239073
686 Ga0070685_11074757
687 Ga0070707_101070708
688 Ga0070684_100511814
689 Ga0070684_100548642
690 Ga0068853_100001519
691 Ga0070672_100104060
692 Ga0070686_100820831
693 Ga0070695_100036272
694 Ga0070695_100926306
695 Ga0070696_100001935
696 Ga0070696_100048911
697 Ga0070665_100001305
698 Ga0070665_100348948
699 Ga0070665_100890926
700 Ga0070665_101072085
701 Ga0070704_100000174
702 Ga0068855_100081725
703 Ga0068855_100652973
704 Ga0070664_100161684
705 Ga0068854_100021666
706 Ga0068854_100049301
707 Ga0068854_100069471
708 Ga0068856_100314609
709 Ga0070702_100001917
710 Ga0070702_100119132
711 Ga0068852_100006688
712 Ga0068852_100293088
713 Ga0068859_100000801
714 Ga0068859_100362669
715 Ga0068864_100225266
716 Ga0068866_10007585
717 Ga0068861_100001120
718 Ga0068861_100183293
719 Ga0068863_100108540
720 Ga0068863_100173974
721 Ga0068863_100371838
722 Ga0068858_100001869
723 Ga0068858_100017025
724 Ga0068860_100000743
725 Ga0068860_100213742
726 Ga0068860_100245647
727 Ga0068862_100001026
728 Ga0068862_100501859
729 Ga0081455_10044627
730 Ga0081455_10083296
731 Ga0081455_10306014
732 Ga0081538_10072604
733 Ga0070717_10302650
734 Ga0075365_10004619
735 Ga0075365_10007664
736 Ga0075365_10066185
737 Ga0075365_10070307
738 Ga0075368_10045600
739 Ga0075363_100001048
740 Ga0075363_100002626
741 Ga0075363_100006337
742 Ga0075363_100009225
743 Ga0075363_100016825
744 Ga0075363_100034249
745 Ga0075363_100036604
746 Ga0075363_100043685
747 Ga0075363_100097538
748 Ga0075363_100108212
749 Ga0075363_100209763
750 Ga0075363_100337218
751 Ga0075363_100459225
752 Ga0075364_10003298
753 Ga0075364_10010821
754 Ga0075364_10011804
755 Ga0075364_10034163
756 Ga0075364_10053074
757 Ga0075364_10103129
758 Ga0070715_10018541
759 Ga0070715_10103781
760 Ga0070716_100004418
761 Ga0070716_100013940
762 Ga0070712_100001412
763 Ga0070712_100034871
764 Ga0070712_100124739
765 Ga0075362_10035466
766 Ga0075362_10164641
767 Ga0075367_10008822
768 Ga0075367_10029647
769 Ga0075367_10029720
770 Ga0075367_10048752
771 Ga0075367_10296727
772 Ga0075367_10441017
773 Ga0075369_10005518
774 Ga0075369_10006877
775 Ga0075369_10045102
776 Ga0075369_10108346
777 Ga0075369_10115331
778 Ga0075369_10122548
779 Ga0075370_10000221
780 Ga0075370_10002682
781 Ga0075370_10037972
782 Ga0075370_10210438
783 Ga0075370_10402215
784 Ga0068871_100619349
785 Ga0075428_100021051
786 Ga0075430_100010789
787 Ga0075431_100071733
788 Ga0068865_100000524
789 Ga0068865_100309244
790 Ga0097620_100000801
791 Ga0097620_100362679
792 Ga0099795_10008103
793 Ga0099795_10043487
794 Ga0105250_10040197
795 Ga0105240_11359981
796 Ga0105240_11368144
797 Ga0111539_10593742
798 Ga0111539_12086205
799 Ga0105245_10000805
800 Ga0105245_10045086
801 Ga0105245_11134749
802 Ga0105247_10000806
803 Ga0105247_10098042
804 Ga0105247_10177945
805 Ga0114129_10024084
806 Ga0105243_10000892
807 Ga0105241_10035178
808 Ga0105241_11085106
809 Ga0105242_10000906
810 Ga0105242_10168310
811 Ga0105242_10178073
812 Ga0105248_10000634
813 Ga0105248_10174435
814 Ga0105237_10033645
815 Ga0105237_10356785
816 Ga0105238_10346317
817 Ga0105249_10002484
818 Ga0105249_10016052
819 Ga0105249_10189334
820 Ga0105249_10300081
821 Ga0105239_10148422
822 Ga0105239_10157411
823 Ga0105239_10521733
824 Ga0105239_10665596
825 Ga0105239_11603126
826 Ga0105246_10177312
827 Ga0157369_10170757
828 Ga0157369_10639886
829 Ga0157369_10785826
830 Ga0157374_10029376
831 Ga0157374_10149026
832 Ga0157374_11148287
833 Ga0157378_10002708
834 Ga0157378_10262888
835 Ga0157378_10567256
836 Ga0163162_10001291
837 Ga0163162_10088265
838 Ga0163162_10191522
839 Ga0163162_10354421
840 Ga0163162_10844671
841 Ga0163162_10915537
842 Ga0157372_10038530
843 Ga0157372_10743153
844 Ga0157372_10820681
845 Ga0157372_11047809
846 Ga0157375_10000618
847 Ga0157375_10164842
848 Ga0163163_10005850
849 Ga0163163_11069309
850 Ga0157380_10001643
851 Ga0157380_11418713
852 Ga0157377_10136720
853 Ga0157377_10368428
854 Ga0157377_10512880
855 Ga0157379_10004513
856 Ga0157379_10167932
857 Ga0157376_11301234
858 Ga0163161_10000599
859 Ga0163161_10392263
860 Ga0213876_10001584
861 Ga0213876_10004064
862 Ga0213876_10007047
863 Ga0213876_10435075
864 Ga0213875_10073245
865 Ga0207692_10017950
866 Ga0207692_10115508
867 Ga0207642_10003369
868 Ga0207710_10002182
869 Ga0207688_10000270
870 Ga0207688_10000382
871 Ga0207680_10247662
872 Ga0207680_10284378
873 Ga0207647_10052122
874 Ga0207685_10020626
875 Ga0207699_10219901
876 Ga0207645_10006454
877 Ga0207654_10225041
878 Ga0207654_10244027
879 Ga0207671_10118504
880 Ga0207671_10529207
881 Ga0207693_10001225
882 Ga0207693_10001655
883 Ga0207693_10871538
884 Ga0207663_10002421
885 Ga0207663_11357422
886 Ga0207660_10390975
887 Ga0207662_10288619
888 Ga0207657_10065807
889 Ga0207646_10880800
890 Ga0207681_10501013
891 Ga0207694_10240492
892 Ga0207659_10498603
893 Ga0207659_10734131
894 Ga0207687_10001234
895 Ga0207687_10100267
896 Ga0207700_10118359
897 Ga0207664_10037472
898 Ga0207664_10074650
899 Ga0207664_10083213
900 Ga0207644_10001978
901 Ga0207644_10310917
902 Ga0207690_10214143
903 Ga0207690_10331503
904 Ga0207706_10007698
905 Ga0207706_10045648
906 Ga0207686_10008090
907 Ga0207686_10289443
908 Ga0207709_10003516
909 Ga0207670_10559539
910 Ga0207670_11879242
911 Ga0207669_10002869
912 Ga0207669_10087374
913 Ga0207669_10488940
914 Ga0207704_10001123
915 Ga0207704_10254824
916 Ga0207665_10001338
917 Ga0207665_10017396
918 Ga0207691_10160279
919 Ga0207711_10115319
920 Ga0207711_10430655
921 Ga0207711_11106676
922 Ga0207689_10006263
923 Ga0207661_10147973
924 Ga0207661_10507409
925 Ga0207679_11638988
926 Ga0207667_10331089
927 Ga0207651_10202985
928 Ga0207712_10008147
929 Ga0207712_10017694
930 Ga0207668_10000479
931 Ga0207668_10006207
932 Ga0207668_10065194
933 Ga0207668_10196764
934 Ga0207668_10534515
935 Ga0207640_10026132
936 Ga0207640_10045786
937 Ga0207658_10005225
938 Ga0207658_10021670
939 Ga0207658_10074079
940 Ga0207658_10091775
941 Ga0207658_10519180
942 Ga0207658_11174523
943 Ga0207677_10003876
944 Ga0207677_10647450
945 Ga0207677_11534102
946 Ga0207703_10046821
947 Ga0207703_10266878
948 Ga0207639_10020634
949 Ga0207639_10157364
950 Ga0207678_10047504
951 Ga0207678_10105960
952 Ga0207678_11243318
953 Ga0207708_10001666
954 Ga0207708_10159426
955 Ga0207702_10439079
956 Ga0207641_10347305
957 Ga0207648_10000503
958 Ga0207676_10186035
959 Ga0207675_100000419
960 Ga0207675_100015207
961 Ga0207675_100244914
962 Ga0207675_101036826
963 Ga0207675_101053387
964 Ga0207683_10000386
965 Ga0207683_10008028
966 Ga0207683_10080820
967 Ga0207698_10024355
968 Ga0207698_10307403
969 Ga0207698_10739986
970 Ga0207428_10734750
971 Ga0268266_10001251
972 Ga0268266_10406888
973 Ga0268266_10949173
974 Ga0268265_10002139
975 Ga0268265_11003874
976 Ga0268264_10002766
977 Ga0268264_10128031
978 Ga0268264_10618445
979 Ga0307408_101312159
980 Ga0307408_101708470
981 Ga0307405_10143273
982 Ga0307413_10028476
983 Ga0307410_10330441
984 Ga0307409_100007080
985 Ga0307409_100084507
986 Ga0307409_100306125
987 Ga0307409_100807870
988 Ga0307414_10570681
989 Ga0307411_10765188
990 Ga0307415_100493129
991 Ga0373938_0021490
992 Ga0373931_0105078
993 Ga0395905_1744030
994 Ga0436364_0030999
995 Ga0436364_0242294
996 Ga0436364_0665239
997 Ga0436364_0802881
998 Ga0436365_0721081
999 Ga0436365_0794149
1000 Ga0436365_0960868
1001 Ga0436365_1223684
1002 Ga0436365_1377785
1003 Ga0436365_1889369
1004 Ga0436360_1120387
1005 Ga0436361_0681598
1006 Ga0436363_1258598
1007 Ga0439461_0008990
1008 Ga0439466_0017846
1009 Ga0439466_0070176
1010 Ga0439466_0086454
1011 Ga0439465_0027323
1012 Ga0439465_0029587
1013 Ga0439465_0071135
1014 Ga0451839_0295342
1015 Ga0439442_008156
1016 Ga0439434_0046251
1017 Ga0439435_0022302
1018 Ga0466969_0164046
1019 Ga0466972_0002516
1020 Ga0466965_0011032
1021 Ga0466966_0001679
1022 Ga0466966_0022144
1023 Ga0466966_0519389
1024 Ga0466966_0530695
1025 Ga0466961_0096110
1026 Ga0466961_0118602
1027 Ga0466963_0066094
1028 Ga0466963_0137175
1029 Ga0466963_0217551
1030 Ga0466964_0268110
1031 Ga0466964_0455860
1032 Ga0466964_0817567
1033 Ga0466971_0004569
1034 Ga0466971_0333423
1035 Ga0466971_0469560
1036 Ga0466968_0034198
1037 Ga0466968_0127744
1038 Ga0466968_0177488
1039 Ga0466970_0025149
1040 Ga0466970_0032195
1041 Ga0466957_0017541
1042 Ga0466957_0059953
1043 Ga0466960_0074193
1044 Ga0466960_0125083
1045 Ga0466960_0489614
1046 Ga0466960_0530902
1047 Ga0466960_0693878
1048 Ga0466959_0004496
1049 Ga0466959_0033627
1050 Ga0466959_0037394
1051 Ga0466959_0269289
1052 Ga0466958_0004643
1053 Ga0466958_0004830
1054 Ga0466958_0012441
1055 Ga0466958_0053295
1056 Ga0466958_0144513
1057 Ga0466958_0275596
1058 Ga0466967_0008819
1059 Ga0466967_0030088
1060 Ga0466967_0030948
1061 Ga0466967_0106591
1062 Ga0466967_0367282
1063 Ga0466967_0540036
1064 Ga0466967_1164391
1065 Ga0466967_1365433
1066 Ga0495638_0002268
1067 Ga0495638_0342812
1068 Ga0495641_0104866
1069 Ga0495582_0014315
1070 Ga0495620_0175831
1071 Ga0495665_0201679
1072 Ga0495640_0018975
1073 Ga0495667_0220744
1074 Ga0495624_0176157
1075 Ga0495581_0222451
1076 Ga0495674_0193718
1077 Ga0495672_0405907
1078 Ga0495676_0093224
1079 Ga0495686_0365164
1080 Ga0495593_0015017
1081 Ga0495626_0325355
1082 Ga0496100_0187772
1083 Ga0496100_0191174
1084 Ga0496101_0000975
1085 Ga0496101_0009128
1086 Ga0496101_0589547
1087 Ga0496102_0003144
1088 Ga0496102_0008220
1089 Ga0496102_0138570
1090 Ga0496102_0658859
1091 Ga0496103_0001134
1092 Ga0496103_0037533
1093 Ga0496103_0341929
1094 Ga0496104_0166863
1095 Ga0496104_0660451
1096 Ga0496104_0663000
1097 Ga0496105_0035091
1098 Ga0496105_0366192
1099 Ga0496105_0572925
1100 Ga0496106_0000769
1101 Ga0496106_0010379
1102 Ga0496107_0000672
1103 Ga0496107_0016601
1104 Ga0496107_0188925
1105 Ga0496108_0017265
1106 Ga0496108_0017612
1107 Ga0496108_0058779
1108 Ga0496108_0169503
1109 Ga0496108_0738505
1110 Ga0496109_0010719
1111 Ga0496109_0110430
1112 Ga0496109_1963235
1113 Ga0496110_0439274
1114 Ga0496110_0659217
1115 Ga0496110_1115535
1116 Ga0496111_0108143
1117 Ga0496111_0199894
1118 Ga0496112_0005828
1119 Ga0496112_0006731
1120 Ga0496112_0431381
1121 Ga0496112_0632785
1122 Ga0496112_0912298
1123 Ga0496113_0080841
1124 Ga0496113_0161762
1125 Ga0496114_0000486
1126 Ga0496114_0004712
1127 Ga0496114_0052904
1128 Ga0496115_0003434
1129 Ga0496115_0026040
1130 Ga0496115_0096325
1131 Ga0496115_0921436
1132 Ga0496117_0241953
1133 Ga0496118_0000237
1134 Ga0496126_0015493
1135 Ga0501031_0398825
1136 Ga0501033_0015347
1137 Ga0501033_0115667
1138 Ga0501034_0001933
1139 Ga0501034_0071795
1140 Ga0501034_0236485
1141 Ga0501037_0008336
1142 Ga0501046_0000668
1143 Ga0501046_0490863
1144 Ga0501047_0133298
1145 Ga0501047_0253380
1146 Ga0501047_0288812
1147 Ga0501048_0013996
1148 Ga0501048_0161680
1149 Ga0501069_1006894
1150 Ga0501070_0003985
1151 Ga0501070_0164859
1152 Ga0501070_0755794
1153 Ga0501072_0874875
1154 Ga0501080_0072691
1155 Ga0501080_0734159
1156 Ga0501083_0622299
1157 Ga0501035_0000435
1158 Ga0501035_0007079
1159 Ga0501035_0241891
1160 Ga0501044_0004535
1161 Ga0501044_0036668
1162 Ga0501044_0157229
1163 nmdc:mga03683_114293_c1
1164 nmdc:mga03683_37680_c1
1165 nmdc:mga03683_5014_c2
1166 nmdc:mga03n38_164247_c1
1167 nmdc:mga03n38_19894_c1
1168 nmdc:mga03n38_2649_c1
1169 nmdc:mga03n38_406185_c1
1170 nmdc:mga03n38_41974_c1
1171 nmdc:mga03n38_632690_c1
1172 nmdc:mga03n38_86217_c1
1173 nmdc:mga03n38_88837_c1
1174 nmdc:mga00v17_31125_c1
1175 nmdc:mga00v17_319559_c1
1176 nmdc:mga00v17_330983_c1
1177 nmdc:mga00v17_61380_c1
1178 nmdc:mga00v17_6215_c1
1179 nmdc:mga0yw44_124877_c1
1180 nmdc:mga0yw44_18449_c2
1181 nmdc:mga0yw44_38112_c1
1182 nmdc:mga06z11_107464_c1
1183 nmdc:mga06z11_137355_c1
1184 nmdc:mga06z11_25315_c1
1185 nmdc:mga06z11_253943_c1
1186 nmdc:mga06z11_320018_c1
1187 nmdc:mga06z11_716952_c1
1188 nmdc:mga07m45_12915_c1
1189 nmdc:mga07m45_147899_c1
1190 nmdc:mga07m45_175508_c1
1191 nmdc:mga07m45_352609_c1
1192 nmdc:mga07m45_417742_c1
1193 nmdc:mga07m45_43621_c1
1194 nmdc:mga05p37_14495_c2
1195 nmdc:mga0qj67_32207_c1
1196 nmdc:mga0qj67_71298_c1
1197 nmdc:mga06r32_93354_c1
1198 nmdc:mga08x19_925278_c1
1199 nmdc:mga0sz30_105099_c1
1200 nmdc:mga0sz30_150354_c1
1201 nmdc:mga0sz30_4368_c1
1202 nmdc:mga0sz30_4708_c1
1203 nmdc:mga0sz30_5802_c1
1204 Ga0500610_0069680
1205 Ga0495655_0009315
1206 Ga0500644_0029911
1207 Ga0500562_008330
1208 Ga0500562_159561
1209 Ga0500642_0105006
1210 Ga0466962_0002379
1211 Ga0466962_0043507
1212 Ga0466962_0158224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

11

128

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bnv-assembly1.cif.gz_B crystal structure of cj0977, a sigma28-regulated virulence protein from campylobacter jejuni. 0.8799 54 143
4zrb-assembly1.cif.gz_D crystal structure of hypothetical thioesterase protein sp_1851 with coenzyme a from streptococcus pneumoniae tigr4 0.8581 54 141
4zrb-assembly2.cif.gz_G crystal structure of hypothetical thioesterase protein sp_1851 with coenzyme a from streptococcus pneumoniae tigr4 0.8518 54 141
4xy6-assembly1.cif.gz_A crystal structure of mutant (thr68ala) hypothetical thioesterase protein sp_1851 from streptococcus pneumoniae tigr4 0.838 54 141
3bnv-assembly2.cif.gz_C crystal structure of cj0977, a sigma28-regulated virulence protein from campylobacter jejuni. 0.8351 54 143
ID Description Score Start End Superfamily
3bnvB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8586 54 143 3.10.129.10
af_Q9ZW37_24_155_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8492 54 139 3.10.129.10
3cjyA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8348 65 139 2.40.160.210
2uvaG08 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8324 76 139 3.10.129.10
3lwgA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8282 52 141 3.10.129.10
ID Description Score Start End GO Terms
AF-X7Y3A3-F1-model_v4 deleted 0.9795 58 141
AF-X7Y3A3-F1-model_v4 deleted 0.9572 58 141
AF-A0A0F9FNA1-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9038 51 141 GO:0006633
GO:0016020
GO:0019171
AF-A0A011SS11-F1-model_v4 3-methylfumaryl-CoA hydratase 0.8973 74 140 GO:0019171
AF-I7JPS9-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.8958 76 139 GO:0019171

Map