F468520

General Info

Members Datasets Scaffolds Average Seq Length
605 459 1202 342

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0039828|Ga0496115_0039828_1322_2491
Length 389
Sequence VNGREEGNFDSQPARHGPKGIARLVHQQETDRGGNAAGPNNGSTSMNWKLTAAALGLSLLAVTGVAHADGELNIYNWGNYTSPDLIKKFEETYKIKVTVTDYDSNDTALAKVRQGASGYDIVVPSASVVPIWISEGLLLETDPNKMENFKNVDPRWVDVPFDPGRKYTVPWQWGTTGISVNKSVYAGDPNTSAIFLDPPPELVGKINVVPEMGDIMFLAIAYEGGKYCTNDMQVLKKVHDKLVEAKTKWLSLDYAAVDGLGRGDIAAGVNWNGISLRERLQNDKIVYGYPKEGFPIWMDNVAVLKDAKNVENAKLFQNFIMDPKNAAMISAFARYANGIKGSEAFMPDDMKTAPEVAIPAEFAAKGQFMPACPTDVQALYTKIWTDLQK

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
69 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
70 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
189 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
195 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
201 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
202 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
203 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
204 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
205 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
206 2512875024
207 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
208 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
209 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
210 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
211 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
212 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
213 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
214 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
215 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
216 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
217 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
218 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
219 2643221607 Rhizobium sp. Root73 Isolate Unclassified
220 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
221 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
222 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
223 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
224 2643221688 Rhizobium sp. Root482 Isolate Unclassified
225 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
226 2643221719 Rhizobium sp. Root274 Isolate Unclassified
227 2643221723 Ensifer sp. Root278 Isolate Unclassified
228 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
229 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
230 2738541293 Rhizobium sp. GV031 Isolate Unclassified
231 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
232 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
233 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
234 2791355260 Rhizobium sp. L9 Isolate Nodule
235 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
236 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
237 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
238 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
239 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
240 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
241 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
242 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
243 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
244 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
245 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
246 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
247 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
248 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
249 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
250 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
251 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
252 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
253 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
254 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
255 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
256 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
257 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
258 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
259 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
260 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
261 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
262 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
263 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
264 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
265 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
266 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
267 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
268 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
269 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
270 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
271 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
272 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
273 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
274 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
275 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
276 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
277 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
278 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
279 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
280 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
281 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
282 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
283 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
284 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
285 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
286 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
287 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
288 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
289 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
290 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
291 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
292 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
293 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
294 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
295 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
296 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
297 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
298 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
299 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
300 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
301 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
302 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
303 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
304 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
305 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
306 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
307 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
308 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
309 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
310 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
311 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
312 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
313 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
314 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
315 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
316 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
317 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
318 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
319 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
320 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
321 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
322 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
323 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
324 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
325 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
326 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
327 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
328 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
329 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
330 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
331 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
332 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
333 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
334 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
335 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
336 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
337 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
338 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
339 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
340 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
341 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
342 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
343 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
344 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
345 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
346 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
347 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
348 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
349 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
350 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
351 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
352 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
353 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
354 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
355 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
356 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
357 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
358 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
359 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
360 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
361 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
362 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
363 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
364 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
365 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
366 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
367 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
368 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
369 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
370 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
371 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
372 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
373 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
374 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
375 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
376 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
377 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
378 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
379 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
380 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
381 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
382 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
383 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
384 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
385 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
386 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
387 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
388 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
389 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
390 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
391 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
392 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
393 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
394 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
395 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
396 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
397 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
398 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
399 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
400 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
401 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
402 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
403 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
404 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
405 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
406 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
407 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
408 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
409 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
410 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
411 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
412 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
413 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
414 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
415 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
416 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
417 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
418 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
419 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
420 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
421 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
422 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
423 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
424 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
425 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
426 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
427 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
428 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
429 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
430 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
431 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
432 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
433 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
434 3004167301 Mesorhizobium loti 582 Isolate Unclassified
435 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
436 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
437 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
438 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
439 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
440 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
441 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
442 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
443 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
444 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
445 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
446 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
447 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
448 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
449 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
450 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
451 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
452 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
453 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
454 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
455 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
456 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
457 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
458 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
459 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.62
Metatranscriptomes 0.17
Isolates 54.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.37
Nodule 42.81
Rhizoplane 0.83
Rhizosphere 26.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0039828 3300048918 Bacteria 3734
2 JGI24740J21852_10027450 3300001979 Bacteria 1894
3 JGI25156J39149_1006146 3300002705 Bacteria 3325
4 JGI25162J39368_1001097 3300002737 Bacteria 16453
5 JGI25157J39369_1000913 3300002741 Bacteria 14131
6 JGI25152J39213_1000199 3300002773 Bacteria 40048
7 JGI25150J39212_1000022 3300002774 Bacteria 131963
8 JGI25159J45721_1000038 3300002987 Bacteria 72800
9 JGI25151J46595_10000023 3300003187 Bacteria 221548
10 JGI25151J46595_10004841 3300003187 Bacteria 7038
11 JGI25165J46597_1002055 3300003214 Bacteria 7560
12 JGI25153J46596_10003953 3300003215 Bacteria 8118
13 JGI25160J50197_1000007 3300003354 Bacteria 316012
14 JGI25161J50226_1000767 3300003374 Bacteria 12240
15 Ga0055542_1001014 3300003762 Bacteria 17858
16 Ga0055542_1001934 3300003762 Bacteria 8100
17 Ga0055529_1001752 3300003763 Bacteria 5418
18 Ga0055529_1001858 3300003763 Bacteria 4959
19 Ga0055529_1002059 3300003763 Bacteria 4349
20 Ga0055526_1001431 3300003771 Bacteria 17005
21 Ga0055536_1001555 3300003781 Bacteria 13761
22 Ga0055531_10004275 3300003794 Bacteria 8770
23 Ga0055543_1000367 3300004625 Bacteria 29881
24 Ga0065165_1000011 3300005262 Bacteria 316465
25 Ga0065704_10215865 3300005289 Bacteria 1091
26 Ga0065712_10074320 3300005290 Bacteria 4125
27 Ga0065715_10003351 3300005293 Bacteria 6503
28 Ga0070658_10148141 3300005327 Bacteria 1964
29 Ga0070676_10059924 3300005328 Bacteria 2259
30 Ga0070668_100066750 3300005347 Bacteria 2792
31 Ga0070668_100124654 3300005347 Bacteria 2063
32 Ga0070669_100263960 3300005353 Bacteria 1375
33 Ga0070674_100279349 3300005356 Bacteria 1323
34 Ga0070667_100078905 3300005367 Bacteria 2814
35 Ga0070707_100005464 3300005468 Bacteria 11878
36 Ga0070698_100044567 3300005471 Bacteria 4541
37 Ga0070699_100140750 3300005518 Bacteria 2130
38 Ga0068853_100286650 3300005539 Bacteria 1519
39 Ga0070695_100132754 3300005545 Bacteria 1718
40 Ga0070665_100034591 3300005548 Bacteria 5081
41 Ga0070665_100165660 3300005548 Bacteria 2212
42 Ga0068852_100082838 3300005616 Bacteria 2851
43 Ga0068861_100033294 3300005719 Bacteria 3800
44 Ga0068860_100169908 3300005843 Bacteria 2106
45 Ga0068862_100113698 3300005844 Bacteria 2379
46 Ga0081538_10004112 3300005981 Bacteria 13524
47 Ga0075365_10000541 3300006038 Bacteria 14537
48 Ga0075365_10079322 3300006038 Bacteria 2221
49 Ga0075368_10010788 3300006042 Bacteria 3312
50 Ga0075363_100039172 3300006048 Bacteria 2493
51 Ga0075364_10020379 3300006051 Bacteria 4169
52 Ga0075364_10027711 3300006051 Bacteria 3621
53 Ga0075364_10065709 3300006051 Bacteria 2381
54 Ga0075364_10106225 3300006051 Bacteria 1871
55 Ga0075362_10000295 3300006177 Bacteria 14123
56 Ga0075362_10091916 3300006177 Bacteria 1409
57 Ga0075367_10009008 3300006178 Bacteria 5197
58 Ga0075367_10012343 3300006178 Bacteria 4553
59 Ga0075367_10045469 3300006178 Bacteria 2576
60 Ga0075367_10046771 3300006178 Bacteria 2543
61 Ga0075369_10009580 3300006186 Bacteria 3768
62 Ga0075366_10148977 3300006195 Bacteria 1417
63 Ga0075370_10013777 3300006353 Bacteria 4301
64 Ga0075370_10072888 3300006353 Bacteria 1966
65 Ga0075431_100003794 3300006847 Bacteria 14691
66 Ga0068865_100275168 3300006881 Bacteria 1338
67 Ga0079104_1000243 3300006946 Bacteria 72656
68 Ga0105240_10188182 3300009093 Bacteria 2429
69 Ga0111539_10056892 3300009094 Bacteria 4647
70 Ga0111539_10534876 3300009094 Bacteria 1365
71 Ga0114129_10091425 3300009147 Bacteria 4216
72 Ga0114129_10205275 3300009147 Bacteria 2666
73 Ga0114129_10298597 3300009147 Bacteria 2148
74 Ga0105241_10090642 3300009174 Bacteria 2411
75 Ga0105242_10263908 3300009176 Bacteria 1557
76 Ga0105248_10577386 3300009177 Bacteria 1268
77 Ga0105237_10215958 3300009545 Bacteria 1918
78 Ga0105238_10138363 3300009551 Bacteria 2412
79 Ga0105249_10073327 3300009553 Bacteria 3167
80 Ga0105239_10060103 3300010375 Bacteria 4171
81 Ga0105239_10065042 3300010375 Bacteria 4004
82 Ga0105239_10204228 3300010375 Bacteria 2214
83 Ga0105239_10559215 3300010375 Bacteria 1303
84 Ga0157369_10238158 3300013105 Bacteria 1901
85 Ga0157372_10310749 3300013307 Bacteria 1834
86 Ga0157380_10063389 3300014326 Bacteria 2963
87 Ga0182008_10010476 3300014497 Bacteria 4960
88 Ga0163161_10090419 3300017792 Bacteria 2265
89 Ga0214544_1000029 3300021320 Bacteria 153924
90 Ga0214542_1004648 3300021321 Bacteria 26992
91 Ga0214543_1000045 3300021327 Bacteria 152699
92 Ga0209436_100319 3300025208 Bacteria 22066
93 Ga0209437_100023 3300025233 Bacteria 614195
94 Ga0207425_1000038 3300025245 Bacteria 221600
95 Ga0207425_1011015 3300025245 Bacteria 2178
96 Ga0209026_1000002 3300025250 Bacteria 1136158
97 Ga0209677_110988 3300025253 Bacteria 1454
98 Ga0209148_1000038 3300025254 Bacteria 493744
99 Ga0209148_1000080 3300025254 Bacteria 277806
100 Ga0209148_1000302 3300025254 Bacteria 70861
101 Ga0209759_1000897 3300025256 Bacteria 22261
102 Ga0209129_1000036 3300025258 Bacteria 328331
103 Ga0209233_1000062 3300025261 Bacteria 399685
104 Ga0209233_1013215 3300025261 Bacteria 2361
105 Ga0209455_1000068 3300025272 Bacteria 310024
106 Ga0209455_1000239 3300025272 Bacteria 68601
107 Ga0209455_1000284 3300025272 Bacteria 54580
108 Ga0209673_1041209 3300025273 Bacteria 1313
109 Ga0209130_1000033 3300025284 Bacteria 316064
110 Ga0209676_1002370 3300025292 Bacteria 13550
111 Ga0209025_1000032 3300025294 Bacteria 416141
112 Ga0209025_1000108 3300025294 Bacteria 221600
113 Ga0209025_1000121 3300025294 Bacteria 208700
114 Ga0209564_1000079 3300025295 Bacteria 266525
115 Ga0209758_1000104 3300025297 Bacteria 221600
116 Ga0209050_1002197 3300025298 Bacteria 17587
117 Ga0209256_1002048 3300025299 Bacteria 17889
118 Ga0207426_1000078 3300025302 Bacteria 316064
119 Ga0209051_1004598 3300025303 Bacteria 8415
120 Ga0209257_1007308 3300025304 Bacteria 6714
121 Ga0207645_10070251 3300025907 Bacteria 2240
122 Ga0207645_10193979 3300025907 Bacteria 1335
123 Ga0207654_10046353 3300025911 Bacteria 2479
124 Ga0207657_10058736 3300025919 Bacteria 3308
125 Ga0207657_10107402 3300025919 Bacteria 2309
126 Ga0207646_10022477 3300025922 Bacteria 5810
127 Ga0207646_10055729 3300025922 Bacteria 3534
128 Ga0207694_10035912 3300025924 Bacteria 3802
129 Ga0207706_10128979 3300025933 Bacteria 2224
130 Ga0207704_10163126 3300025938 Bacteria 1588
131 Ga0207668_10294684 3300025972 Bacteria 1336
132 Ga0207640_10131820 3300025981 Bacteria 1808
133 Ga0207678_10100134 3300026067 Bacteria 2475
134 Ga0207678_10122459 3300026067 Bacteria 2219
135 Ga0207708_10185143 3300026075 Bacteria 1654
136 Ga0207702_10230652 3300026078 Bacteria 1730
137 Ga0207675_100161209 3300026118 Bacteria 2139
138 Ga0207698_10108887 3300026142 Bacteria 2317
139 Ga0209281_1000179 3300027111 Bacteria 148102
140 Ga0209813_10018608 3300027866 Bacteria 1922
141 Ga0209813_10055028 3300027866 Bacteria 1256
142 Ga0207428_10000016 3300027907 Bacteria 327690
143 Ga0268266_10015913 3300028379 Bacteria 6437
144 Ga0268266_10209045 3300028379 Bacteria 1789
145 Ga0268265_10130162 3300028380 Bacteria 2090
146 Ga0268264_10109285 3300028381 Bacteria 2419
147 Ga0307513_10203052 3300031456 Bacteria 1821
148 Ga0307408_100045979 3300031548 Bacteria 3121
149 Ga0316576_10286454 3300031727 Bacteria 1233
150 Ga0307405_10051782 3300031731 Bacteria 2549
151 Ga0307413_10140061 3300031824 Bacteria 1670
152 Ga0307410_10038002 3300031852 Bacteria 3150
153 Ga0307411_10020567 3300032005 Bacteria 3842
154 Ga0395900_0106648 3300037418 Bacteria 2878
155 Ga0395901_0204171 3300038443 Bacteria 2071
156 Ga0439441_021997 3300042001 Bacteria 1182
157 Ga0466968_0028468 3300044735 Bacteria 2304
158 Ga0495638_0000084 3300046460 Bacteria 153168
159 Ga0495610_0001615 3300046512 Bacteria 19815
160 Ga0495632_0049431 3300046519 Bacteria 2079
161 Ga0495637_0071816 3300046520 Bacteria 1395
162 Ga0495643_0017445 3300046522 Bacteria 4196
163 Ga0495643_0076631 3300046522 Bacteria 1748
164 Ga0495633_0019886 3300046558 Bacteria 3387
165 Ga0495668_0197377 3300046616 Bacteria 1102
166 Ga0495625_0250622 3300046660 Bacteria 1149
167 Ga0495661_0131668 3300046665 Bacteria 1370
168 Ga0495672_0015363 3300047320 Bacteria 5201
169 Ga0495681_0063118 3300047470 Bacteria 1701
170 Ga0496109_0216687 3300048912 Bacteria 1800
171 Ga0496110_0041993 3300048913 Bacteria 3992
172 Ga0496111_0160327 3300048914 Bacteria 1670
173 Ga0496116_0020875 3300048919 Bacteria 4958
174 Ga0496117_0002366 3300048920 Bacteria 24056
175 Ga0496117_0002854 3300048920 Bacteria 21021
176 Ga0496117_0085528 3300048920 Bacteria 2052
177 Ga0496118_0001121 3300048921 Bacteria 41464
178 Ga0496119_0046934 3300048922 Bacteria 2692
179 Ga0496120_0010535 3300048923 Bacteria 6440
180 Ga0496121_0059415 3300048924 Bacteria 3152
181 Ga0496121_0127126 3300048924 Bacteria 1914
182 Ga0496122_0000106 3300048925 Bacteria 193672
183 Ga0496122_0005203 3300048925 Bacteria 15624
184 Ga0496122_0014741 3300048925 Bacteria 7536
185 Ga0496122_0041203 3300048925 Bacteria 3655
186 Ga0496123_0000018 3300048926 Bacteria 404553
187 Ga0496123_0000022 3300048926 Bacteria 361832
188 Ga0496123_0067725 3300048926 Bacteria 2253
189 Ga0496124_0000902 3300048927 Bacteria 48012
190 Ga0496124_0057763 3300048927 Bacteria 3268
191 Ga0496125_0000161 3300048928 Bacteria 150707
192 Ga0496125_0021183 3300048928 Bacteria 6073
193 Ga0496126_0000212 3300048929 Bacteria 128871
194 Ga0501031_0000007 3300049568 Bacteria 166008
195 Ga0501032_0000007 3300049569 Bacteria 253881
196 Ga0501033_0000040 3300049570 Bacteria 142586
197 Ga0501033_0017429 3300049570 Bacteria 5426
198 Ga0501033_0078247 3300049570 Bacteria 2427
199 Ga0501034_0000029 3300049571 Bacteria 253881
200 Ga0501034_0005001 3300049571 Bacteria 14587
201 Ga0501034_0021748 3300049571 Bacteria 6535
202 Ga0501034_0048172 3300049571 Bacteria 4301
203 Ga0501036_0000004 3300049572 Bacteria 253881
204 Ga0501037_0000004 3300049573 Bacteria 253989
205 Ga0501037_0038432 3300049573 Bacteria 3526
206 Ga0501038_0000005 3300049574 Bacteria 253881
207 Ga0501039_0000009 3300049575 Bacteria 253881
208 Ga0501040_0002023 3300049576 Bacteria 13063
209 Ga0501040_0004937 3300049576 Bacteria 8634
210 Ga0501040_0263128 3300049576 Bacteria 1231
211 Ga0501041_0019776 3300049577 Bacteria 4022
212 Ga0501042_0010845 3300049578 Bacteria 6129
213 Ga0501042_0264182 3300049578 Bacteria 1242
214 Ga0501043_0000595 3300049579 Bacteria 32044
215 Ga0501043_0119996 3300049579 Bacteria 2062
216 Ga0501046_0012657 3300049580 Bacteria 7174
217 Ga0501046_0145661 3300049580 Bacteria 1789
218 Ga0501047_0000895 3300049581 Bacteria 30440
219 Ga0501048_0025759 3300049582 Bacteria 4284
220 Ga0501048_0057690 3300049582 Bacteria 2753
221 Ga0501067_0029515 3300049583 Bacteria 3040
222 Ga0501067_0164280 3300049583 Bacteria 1236
223 Ga0501070_0002659 3300049586 Bacteria 15591
224 Ga0501071_0096658 3300049587 Bacteria 2174
225 Ga0501073_0142831 3300049589 Bacteria 1659
226 Ga0501075_0158287 3300049591 Bacteria 1727
227 Ga0501076_0003065 3300049592 Bacteria 11632
228 Ga0501077_0015558 3300049593 Bacteria 4789
229 Ga0501079_0008623 3300049741 Bacteria 7734
230 Ga0501080_0050009 3300049742 Bacteria 3891
231 Ga0501081_0004062 3300049743 Bacteria 9374
232 Ga0501035_0000014 3300049822 Bacteria 253874
233 Ga0501035_0091803 3300049822 Bacteria 2672
234 Ga0501044_0000012 3300049823 Bacteria 253881
235 Ga0501045_0068209 3300049824 Bacteria 2612
236 nmdc:mga03683_126_c1 3300050489 Bacteria 25411
237 nmdc:mga00v17_117935_c1 3300050491 Bacteria 1688
238 nmdc:mga00v17_1657_c1 3300050491 Bacteria 11604
239 nmdc:mga0yw44_2586_c1 3300050492 Bacteria 7780
240 nmdc:mga0yw44_5321_c1 3300050492 Bacteria 6055
241 nmdc:mga0yw44_62571_c1 3300050492 Bacteria 2286
242 nmdc:mga06z11_109309_c1 3300050494 Bacteria 1529
243 nmdc:mga06z11_72223_c1 3300050494 Bacteria 1829
244 nmdc:mga04h51_18106_c1 3300050495 Bacteria 2070
245 nmdc:mga04h51_26100_c1 3300050495 Bacteria 1803
246 nmdc:mga07m45_19227_c1 3300050496 Bacteria 3699
247 nmdc:mga05p37_166128_c1 3300050507 Bacteria 2693
248 nmdc:mga05p37_212436_c1 3300050507 Bacteria 2338
249 nmdc:mga05p37_471451_c1 3300050507 Bacteria 1448
250 nmdc:mga05p37_668840_c1 3300050507 Bacteria 1159
251 nmdc:mga06r32_54001_c1 3300050510 Bacteria 3852
252 nmdc:mga08y16_26_c1 3300050511 Bacteria 223965
253 nmdc:mga0n895_413852_c1 3300050512 Bacteria 1363
254 nmdc:mga0a205_125097_c1 3300050515 Bacteria 2470
255 nmdc:mga0sz30_11502_c1 3300050516 Bacteria 3418
256 nmdc:mga0sz30_2286_c2 3300050516 Bacteria 3500
257 Ga0500610_0018879 3300053079 Bacteria 3343
258 Ga0500618_000025 3300053125 Bacteria 150583
259 Ga0500658_0021839 3300053134 Bacteria 2428
260 Ga0500568_0000187 3300053139 Bacteria 54387
261 Ga0500573_0000328 3300053140 Bacteria 20195
262 Ga0500573_0004319 3300053140 Bacteria 7463
263 Ga0500616_0000872 3300053153 Bacteria 33370
264 Ga0500620_000056 3300053155 Bacteria 20390
265 Ga0500620_000594 3300053155 Bacteria 6227
266 Ga0500620_000644 3300053155 Bacteria 5962
267 Ga0500627_0013042 3300053158 Bacteria 3136
268 Ga0500627_0016193 3300053158 Bacteria 2902
269 Ga0500627_0018659 3300053158 Bacteria 2749
270 Ga0501084_0002425 3300054114 Bacteria 15008
271 Ga0587088_012432 3300059508 Bacteria 1288
272 Ga0501082_0000842 3300060353 Bacteria 27041
273 Ga0530510_0113537 3300061734 Bacteria 1985
274 2503200060 2503198000 Bacteria 6884444
275 2503202717 2503198000 Bacteria 6884444
276 2509142542 2508501127 Bacteria 7037543
277 2509394964 2509276022 Bacteria 6200534
278 2510313941 2510065059 Bacteria 6847884
279 2510319345 2510065059 Bacteria 6847884
280 2510841573 2510461069 Bacteria 5505000
281 2512930504 2512875016 Bacteria 6529530
282 2512932470 2512875016 Bacteria 6529530
283 2512958241 2512875024 Bacteria 7195110
284 2514032626 2513237164 Bacteria 7563725
285 2514417773 2513237305 Bacteria 7293571
286 2514589324 2513237351 Bacteria 6968952
287 2585167012 2582581283 Bacteria 6030556
288 2585255631 2582581304 Bacteria 5831370
289 2585269129 2582581306 Bacteria 6450535
290 2585390605 2582581865 Bacteria 6644329
291 2585842275 2585427594 Bacteria 6180594
292 2588516137 2588253730 Bacteria 6881675
293 2588518537 2588253730 Bacteria 6881675
294 2597812172 2597489875 Bacteria 7010078
295 2643770376 2643221550 Bacteria 4619371
296 2643984787 2643221595 Bacteria 6565519
297 2643989471 2643221595 Bacteria 6565519
298 2644047675 2643221607 Bacteria 6314006
299 2644153117 2643221627 Bacteria 6761570
300 2644153950 2643221627 Bacteria 6761570
301 2644205907 2643221636 Bacteria 6583769
302 2644299356 2643221653 Bacteria 4569637
303 2644481837 2643221686 Bacteria 6310811
304 2644495063 2643221688 Bacteria 5260751
305 2644497557 2643221689 Bacteria 6042950
306 2644657584 2643221719 Bacteria 4568197
307 2644677607 2643221723 Bacteria 7095460
308 2688598920 2687453392 Bacteria 6880454
309 2723576008 2721755686 Bacteria 7343952
310 2738801712 2738541293 Bacteria 7065685
311 2756671589 2756170246 Bacteria 7451806
312 2756677449 2756170246 Bacteria 7451806
313 2776914696 2775507049 Bacteria 6284736
314 2792747912 2791355123 Bacteria 8049106
315 2792751758 2791355123 Bacteria 8049106
316 2793323199 2791355260 Bacteria 6598818
317 2819243929 2818991272 Bacteria 4622173
318 2819642912 2818991453 Bacteria 7181617
319 2821126499 2821123053 Bacteria 7836056
320 2837654106 2837651117 Bacteria 3772164
321 2838030374 2838029111 Bacteria 6603031
322 2838737026 2838736955 Bacteria 5760694
323 2840880718 2840878972 Bacteria 5483153
324 2841738164 2841734538 Bacteria 6784580
325 2841842605 2841840854 Bacteria 5761912
326 2842142385 2842140634 Bacteria 5759631
327 2842477346 2842475841 Bacteria 6603183
328 2842504143 2842502639 Bacteria 6604161
329 2844006855 2844002411 Bacteria 7168230
330 2844012681 2844009547 Bacteria 6728125
331 2844014268 2844009547 Bacteria 6728125
332 2847675093 2847670302 Bacteria 6165597
333 2856320811 2856314179 Bacteria 6477897
334 2856323163 2856320880 Bacteria 7263508
335 2856324979 2856320880 Bacteria 7263508
336 2856330678 2856328259 Bacteria 6528202
337 2856334909 2856334872 Bacteria 7037011
338 2856347977 2856342000 Bacteria 7176905
339 2856354355 2856349417 Bacteria 6230045
340 2856368128 2856364286 Bacteria 6939991
341 2857372933 2857367948 Bacteria 6965560
342 2857533061 2857531043 Bacteria 6754041
343 2869175301 2869169390 Bacteria 6659796
344 2869244440 2869242130 Bacteria 6609239
345 2869256291 2869249662 Bacteria 6868783
346 2869257153 2869256925 Bacteria 6981691
347 2869257380 2869256925 Bacteria 6981691
348 2869264982 2869264136 Bacteria 6880765
349 2869271319 2869271264 Bacteria 6908218
350 2869280967 2869278585 Bacteria 7077053
351 2869282713 2869278585 Bacteria 7077053
352 2869290253 2869285874 Bacteria 6901219
353 2871432537 2871429161 Bacteria 6547891
354 2871448053 2871444079 Bacteria 6423508
355 2871453875 2871451962 Bacteria 7336357
356 2871462507 2871459585 Bacteria 6866887
357 2871472492 2871466892 Bacteria 6923287
358 2871480167 2871474448 Bacteria 6806570
359 2871486675 2871481445 Bacteria 6700002
360 2871495306 2871488783 Bacteria 6929816
361 2871500403 2871495908 Bacteria 6935695
362 2874120766 2874116593 Bacteria 6674494
363 2874134163 2874131515 Bacteria 6820270
364 2874141367 2874139085 Bacteria 7021506
365 2874142371 2874139085 Bacteria 7021506
366 2874152504 2874146452 Bacteria 7533118
367 2874159904 2874155637 Bacteria 6724144
368 2874166889 2874162495 Bacteria 6174670
369 2874168680 2874168670 Bacteria 8062617
370 2874173134 2874168670 Bacteria 8062617
371 2876367496 2876363079 Bacteria 6544991
372 2876368151 2876363079 Bacteria 6544991
373 2876388634 2876386047 Bacteria 6698674
374 2876398086 2876392853 Bacteria 6660880
375 2876405760 2876399893 Bacteria 6927900
376 2876411208 2876406927 Bacteria 6191900
377 2876418420 2876413966 Bacteria 6831344
378 2876424174 2876420981 Bacteria 6687741
379 2878035855 2878035449 Bacteria 6555736
380 2878743093 2878738818 Bacteria 7136951
381 2878744444 2878738818 Bacteria 7136951
382 2878750151 2878745973 Bacteria 6867388
383 2878758027 2878753008 Bacteria 6922523
384 2878764492 2878760144 Bacteria 6823465
385 2878771593 2878767105 Bacteria 6898628
386 2878780578 2878774303 Bacteria 6108671
387 2878785959 2878781027 Bacteria 6834456
388 2878789613 2878788777 Bacteria 6567085
389 2881149989 2881147464 Bacteria 7779814
390 2881155916 2881155292 Bacteria 6461656
391 2881161132 2881155292 Bacteria 6461656
392 2881166866 2881161766 Bacteria 7127907
393 2881850142 2881845957 Bacteria 6611900
394 2881855610 2881853255 Bacteria 6698367
395 2881855965 2881853255 Bacteria 6698367
396 2881866225 2881861095 Bacteria 7128710
397 2882632633 2882632389 Bacteria 8154593
398 2882633009 2882632389 Bacteria 8154593
399 2882916958 2882912400 Bacteria 6801539
400 2885312882 2885312484 Bacteria 6415165
401 2885325642 2885318864 Bacteria 6729568
402 2885348199 2885342637 Bacteria 7011821
403 2885349036 2885342637 Bacteria 7011821
404 2885354385 2885350715 Bacteria 6787678
405 2885354769 2885350715 Bacteria 6787678
406 2888338378 2888337043 Bacteria 6629336
407 2888340753 2888337043 Bacteria 6629336
408 2888345936 2888343758 Bacteria 6611049
409 2889010200 2889010040 Bacteria 6749192
410 2891376926 2891373044 Bacteria 5202277
411 2899804117 2899803654 Bacteria 5577784
412 2903450278 2903448605 Bacteria 7357801
413 2903452170 2903448605 Bacteria 7357801
414 2903453165 2903448605 Bacteria 7357801
415 2903497841 2903492973 Bacteria 13473544
416 2903502073 2903492973 Bacteria 13473544
417 2903521987 2903521522 Bacteria 6525694
418 2903527147 2903521522 Bacteria 6525694
419 2903528364 2903528002 Bacteria 6586099
420 2903533374 2903528002 Bacteria 6586099
421 2903545216 2903540706 Bacteria 7062119
422 2904664737 2904659560 Bacteria 6685615
423 2906312509 2906308376 Bacteria 6841989
424 2906325218 2906321335 Bacteria 6579571
425 2906369531 2906363423 Bacteria 6856682
426 2906373775 2906370794 Bacteria 6881062
427 2906382716 2906378014 Bacteria 6911440
428 2906390969 2906386501 Bacteria 5977019
429 2906399211 2906393657 Bacteria 6790866
430 2906406428 2906401398 Bacteria 6693206
431 2906411718 2906408224 Bacteria 6162342
432 2906419740 2906414383 Bacteria 6580790
433 2922155315 2922151315 Bacteria 6902399
434 2922159071 2922158528 Bacteria 6573167
435 2922177208 2922172374 Bacteria 6167644
436 2922181102 2922178524 Bacteria 6025201
437 2924715826 2924710171 Bacteria 6752351
438 2924725898 2924718760 Bacteria 6331356
439 2924726502 2924718760 Bacteria 6331356
440 2924732965 2924726620 Bacteria 6271473
441 2924737807 2924733363 Bacteria 7574837
442 2924739229 2924733363 Bacteria 7574837
443 2924747141 2924741084 Bacteria 6661321
444 2924761499 2924754689 Bacteria 6774424
445 2924765684 2924762789 Bacteria 6561353
446 2924768209 2924762789 Bacteria 6561353
447 2924780892 2924776078 Bacteria 7492003
448 2924782474 2924776078 Bacteria 7492003
449 2924784740 2924784321 Bacteria 7416538
450 2937819346 2937813078 Bacteria 7783518
451 2937826593 2937822353 Bacteria 7290551
452 2937827907 2937822353 Bacteria 7290551
453 2937842605 2937836603 Bacteria 6811263
454 2937851927 2937848649 Bacteria 6983481
455 2937852885 2937848649 Bacteria 6983481
456 2937866760 2937861824 Bacteria 6660327
457 2937874535 2937868953 Bacteria 6639878
458 2937879477 2937877337 Bacteria 7246526
459 2937881115 2937877337 Bacteria 7246526
460 2937895000 2937891427 Bacteria 6357007
461 2937974882 2937972304 Bacteria 7532020
462 2937977209 2937972304 Bacteria 7532020
463 2937985393 2937980651 Bacteria 6517427
464 2937999064 2937994558 Bacteria 7036190
465 2958036930 2958034702 Bacteria 6989922
466 2958039496 2958034702 Bacteria 6989922
467 2958050552 2958041894 Bacteria 13082850
468 2958052875 2958041894 Bacteria 13082850
469 2958054981 2958041894 Bacteria 13082850
470 2958065003 2958064165 Bacteria 7158582
471 2958067244 2958064165 Bacteria 7158582
472 2958071915 2958071322 Bacteria 6815895
473 2958086652 2958084443 Bacteria 7312792
474 2958088328 2958084443 Bacteria 7312792
475 2958099961 2958092219 Bacteria 6861151
476 2958108167 2958108152 Bacteria 6681128
477 2958123410 2958122699 Bacteria 7280457
478 2958134641 2958130278 Bacteria 6897202
479 2958139260 2958137437 Bacteria 6050276
480 2958146451 2958144490 Bacteria 6677056
481 2958151448 2958144490 Bacteria 6677056
482 2958159817 2958158011 Bacteria 6058449
483 2958169538 2958165035 Bacteria 6906348
484 2958186604 2958179912 Bacteria 6874908
485 2961085103 2961077736 Bacteria 7079850
486 2961119735 2961114664 Bacteria 6680456
487 2961134047 2961127735 Bacteria 7196641
488 2961135317 2961127735 Bacteria 7196641
489 2961141520 2961136820 Bacteria 6775228
490 2961167998 2961163497 Bacteria 6901077
491 2961174601 2961170736 Bacteria 7072258
492 2961186444 2961183825 Bacteria 6688536
493 2963646733 2963644680 Bacteria 6530403
494 2963648724 2963644680 Bacteria 6530403
495 2965022817 2965018300 Bacteria 6883036
496 2965028123 2965025482 Bacteria 6532201
497 2965034715 2965032056 Bacteria 6887443
498 2965041156 2965040258 Bacteria 6855979
499 2965051632 2965047637 Bacteria 6623551
500 2965094295 2965089291 Bacteria 6866420
501 2965109666 2965102966 Bacteria 6800987
502 2968000592 2967996073 Bacteria 6787468
503 2968010035 2968003550 Bacteria 6929263
504 2968020243 2968016561 Bacteria 7022047
505 2968020823 2968016561 Bacteria 7022047
506 2968083950 2968083720 Bacteria 7351627
507 2968086531 2968083720 Bacteria 7351627
508 2968090474 2968083720 Bacteria 7351627
509 2968115990 2968110612 Bacteria 6814636
510 2968144145 2968138860 Bacteria 6605449
511 2968144343 2968138860 Bacteria 6605449
512 2968176398 2968171901 Bacteria 6894245
513 2970473565 2970469710 Bacteria 6969209
514 2970474120 2970469710 Bacteria 6969209
515 2970490973 2970489779 Bacteria 6517260
516 2970495129 2970489779 Bacteria 6517260
517 2970507187 2970503327 Bacteria 7099517
518 2970512323 2970510686 Bacteria 7006402
519 2970515004 2970510686 Bacteria 7006402
520 2970527389 2970524798 Bacteria 6840927
521 2970536151 2970532167 Bacteria 6553173
522 2970542967 2970540015 Bacteria 6977556
523 2970552912 2970547951 Bacteria 6931819
524 2970559337 2970554993 Bacteria 6814252
525 2970595571 2970593180 Bacteria 7073582
526 2970597322 2970593180 Bacteria 7073582
527 2970624056 2970619444 Bacteria 6986144
528 2970624754 2970619444 Bacteria 6986144
529 2970631851 2970627176 Bacteria 6680862
530 2977828899 2977821940 Bacteria 6906439
531 2977829366 2977828996 Bacteria 7007971
532 2977833429 2977828996 Bacteria 7007971
533 2977848297 2977843712 Bacteria 6753583
534 2977851475 2977851361 Bacteria 6694324
535 2977910125 2977907340 Bacteria 6577984
536 2977921767 2977915119 Bacteria 6829656
537 2977924791 2977922695 Bacteria 6956781
538 2977925070 2977922695 Bacteria 6956781
539 2977940179 2977935797 Bacteria 6252826
540 2977944674 2977942078 Bacteria 7570577
541 2977956752 2977950692 Bacteria 6893264
542 2977961631 2977957713 Bacteria 6877875
543 2977990412 2977986579 Bacteria 6581278
544 2977990577 2977986579 Bacteria 6581278
545 2979767789 2979764755 Bacteria 6610066
546 2979775589 2979772303 Bacteria 6618277
547 2979796961 2979793036 Bacteria 6808957
548 2979812383 2979808191 Bacteria 7179355
549 2987646398 2987645492 Bacteria 6117018
550 2987656807 2987652177 Bacteria 6969023
551 2987664012 2987659509 Bacteria 6966464
552 2987668579 2987666974 Bacteria 6509233
553 2987671371 2987666974 Bacteria 6509233
554 2987673812 2987673487 Bacteria 6884027
555 2989352297 2989349275 Bacteria 6349068
556 2989352535 2989349275 Bacteria 6349068
557 2989776433 2989771324 Bacteria 5605128
558 2989780461 2989776772 Bacteria 4843317
559 2996312806 2996310559 Bacteria 6357320
560 2996314137 2996310559 Bacteria 6357320
561 2996344530 2996341866 Bacteria 6643098
562 2996351297 2996348954 Bacteria 7239054
563 2996352559 2996348954 Bacteria 7239054
564 2996390763 2996386984 Bacteria 6978667
565 3000136113 3000135777 Bacteria 6891109
566 3000139686 3000135777 Bacteria 6891109
567 3003935318 3003930520 Bacteria 5667563
568 3004167724 3004167301 Bacteria 8330599
569 3004170255 3004167301 Bacteria 8330599
570 3004193067 3004188549 Bacteria 6952365
571 3004200002 3004195979 Bacteria 6776956
572 3004213041 3004211236 Bacteria 7417683
573 3004218137 3004211236 Bacteria 7417683
574 3004220816 3004218560 Bacteria 7421728
575 3004222196 3004218560 Bacteria 7421728
576 3004247563 3004239961 Bacteria 6892290
577 3004253828 3004248173 Bacteria 6563236
578 3004271127 3004268573 Bacteria 7043476
579 3004273783 3004268573 Bacteria 7043476
580 3004277995 3004275668 Bacteria 7114440
581 3004279241 3004275668 Bacteria 7114440
582 3004289378 3004289098 Bacteria 6135450
583 3004291171 3004289098 Bacteria 6135450
584 3004340117 3004334049 Bacteria 8449246
585 637073501 637000159 Bacteria 7596297
586 637075567 637000159 Bacteria 7596297
587 637078833 637000159 Bacteria 7596297
588 649873436 649633066 Bacteria 6690028
589 8002291726 8002285264 Bacteria 6717907
590 8004303511 8004300914 Bacteria 6132239
591 8004318130 8004312739 Bacteria 7444653
592 8004367987 8004361976 Bacteria 6858373
593 8004379539 8004374579 Bacteria 6898112
594 8004392459 8004387939 Bacteria 7049250
595 8004402013 8004395343 Bacteria 6620908
596 8004638598 8004633249 Bacteria 6723080
597 8004718768 8004714634 Bacteria 6776161
598 8004733429 8004727605 Bacteria 6643904
599 8005248225 8005246636 Bacteria 4933972
600 8005659245 8005658619 Bacteria 4500593
601 8055619493 8055617313 Bacteria 7548464
602 Ga0496115_0039828
603 JGI24740J21852_10027450
604 JGI25156J39149_1006146
605 JGI25162J39368_1001097
606 JGI25157J39369_1000913
607 JGI25152J39213_1000199
608 JGI25150J39212_1000022
609 JGI25159J45721_1000038
610 JGI25151J46595_10000023
611 JGI25151J46595_10004841
612 JGI25165J46597_1002055
613 JGI25153J46596_10003953
614 JGI25160J50197_1000007
615 JGI25161J50226_1000767
616 Ga0055542_1001014
617 Ga0055542_1001934
618 Ga0055529_1001752
619 Ga0055529_1001858
620 Ga0055529_1002059
621 Ga0055526_1001431
622 Ga0055536_1001555
623 Ga0055531_10004275
624 Ga0055543_1000367
625 Ga0065165_1000011
626 Ga0065704_10215865
627 Ga0065712_10074320
628 Ga0065715_10003351
629 Ga0070658_10148141
630 Ga0070676_10059924
631 Ga0070668_100066750
632 Ga0070668_100124654
633 Ga0070669_100263960
634 Ga0070674_100279349
635 Ga0070667_100078905
636 Ga0070707_100005464
637 Ga0070698_100044567
638 Ga0070699_100140750
639 Ga0068853_100286650
640 Ga0070695_100132754
641 Ga0070665_100034591
642 Ga0070665_100165660
643 Ga0068852_100082838
644 Ga0068861_100033294
645 Ga0068860_100169908
646 Ga0068862_100113698
647 Ga0081538_10004112
648 Ga0075365_10000541
649 Ga0075365_10079322
650 Ga0075368_10010788
651 Ga0075363_100039172
652 Ga0075364_10020379
653 Ga0075364_10027711
654 Ga0075364_10065709
655 Ga0075364_10106225
656 Ga0075362_10000295
657 Ga0075362_10091916
658 Ga0075367_10009008
659 Ga0075367_10012343
660 Ga0075367_10045469
661 Ga0075367_10046771
662 Ga0075369_10009580
663 Ga0075366_10148977
664 Ga0075370_10013777
665 Ga0075370_10072888
666 Ga0075431_100003794
667 Ga0068865_100275168
668 Ga0079104_1000243
669 Ga0105240_10188182
670 Ga0111539_10056892
671 Ga0111539_10534876
672 Ga0114129_10091425
673 Ga0114129_10205275
674 Ga0114129_10298597
675 Ga0105241_10090642
676 Ga0105242_10263908
677 Ga0105248_10577386
678 Ga0105237_10215958
679 Ga0105238_10138363
680 Ga0105249_10073327
681 Ga0105239_10060103
682 Ga0105239_10065042
683 Ga0105239_10204228
684 Ga0105239_10559215
685 Ga0157369_10238158
686 Ga0157372_10310749
687 Ga0157380_10063389
688 Ga0182008_10010476
689 Ga0163161_10090419
690 Ga0214544_1000029
691 Ga0214542_1004648
692 Ga0214543_1000045
693 Ga0209436_100319
694 Ga0209437_100023
695 Ga0207425_1000038
696 Ga0207425_1011015
697 Ga0209026_1000002
698 Ga0209677_110988
699 Ga0209148_1000038
700 Ga0209148_1000080
701 Ga0209148_1000302
702 Ga0209759_1000897
703 Ga0209129_1000036
704 Ga0209233_1000062
705 Ga0209233_1013215
706 Ga0209455_1000068
707 Ga0209455_1000239
708 Ga0209455_1000284
709 Ga0209673_1041209
710 Ga0209130_1000033
711 Ga0209676_1002370
712 Ga0209025_1000032
713 Ga0209025_1000108
714 Ga0209025_1000121
715 Ga0209564_1000079
716 Ga0209758_1000104
717 Ga0209050_1002197
718 Ga0209256_1002048
719 Ga0207426_1000078
720 Ga0209051_1004598
721 Ga0209257_1007308
722 Ga0207645_10070251
723 Ga0207645_10193979
724 Ga0207654_10046353
725 Ga0207657_10058736
726 Ga0207657_10107402
727 Ga0207646_10022477
728 Ga0207646_10055729
729 Ga0207694_10035912
730 Ga0207706_10128979
731 Ga0207704_10163126
732 Ga0207668_10294684
733 Ga0207640_10131820
734 Ga0207678_10100134
735 Ga0207678_10122459
736 Ga0207708_10185143
737 Ga0207702_10230652
738 Ga0207675_100161209
739 Ga0207698_10108887
740 Ga0209281_1000179
741 Ga0209813_10018608
742 Ga0209813_10055028
743 Ga0207428_10000016
744 Ga0268266_10015913
745 Ga0268266_10209045
746 Ga0268265_10130162
747 Ga0268264_10109285
748 Ga0307513_10203052
749 Ga0307408_100045979
750 Ga0316576_10286454
751 Ga0307405_10051782
752 Ga0307413_10140061
753 Ga0307410_10038002
754 Ga0307411_10020567
755 Ga0395900_0106648
756 Ga0395901_0204171
757 Ga0439441_021997
758 Ga0466968_0028468
759 Ga0495638_0000084
760 Ga0495610_0001615
761 Ga0495632_0049431
762 Ga0495637_0071816
763 Ga0495643_0017445
764 Ga0495643_0076631
765 Ga0495633_0019886
766 Ga0495668_0197377
767 Ga0495625_0250622
768 Ga0495661_0131668
769 Ga0495672_0015363
770 Ga0495681_0063118
771 Ga0496109_0216687
772 Ga0496110_0041993
773 Ga0496111_0160327
774 Ga0496116_0020875
775 Ga0496117_0002366
776 Ga0496117_0002854
777 Ga0496117_0085528
778 Ga0496118_0001121
779 Ga0496119_0046934
780 Ga0496120_0010535
781 Ga0496121_0059415
782 Ga0496121_0127126
783 Ga0496122_0000106
784 Ga0496122_0005203
785 Ga0496122_0014741
786 Ga0496122_0041203
787 Ga0496123_0000018
788 Ga0496123_0000022
789 Ga0496123_0067725
790 Ga0496124_0000902
791 Ga0496124_0057763
792 Ga0496125_0000161
793 Ga0496125_0021183
794 Ga0496126_0000212
795 Ga0501031_0000007
796 Ga0501032_0000007
797 Ga0501033_0000040
798 Ga0501033_0017429
799 Ga0501033_0078247
800 Ga0501034_0000029
801 Ga0501034_0005001
802 Ga0501034_0021748
803 Ga0501034_0048172
804 Ga0501036_0000004
805 Ga0501037_0000004
806 Ga0501037_0038432
807 Ga0501038_0000005
808 Ga0501039_0000009
809 Ga0501040_0002023
810 Ga0501040_0004937
811 Ga0501040_0263128
812 Ga0501041_0019776
813 Ga0501042_0010845
814 Ga0501042_0264182
815 Ga0501043_0000595
816 Ga0501043_0119996
817 Ga0501046_0012657
818 Ga0501046_0145661
819 Ga0501047_0000895
820 Ga0501048_0025759
821 Ga0501048_0057690
822 Ga0501067_0029515
823 Ga0501067_0164280
824 Ga0501070_0002659
825 Ga0501071_0096658
826 Ga0501073_0142831
827 Ga0501075_0158287
828 Ga0501076_0003065
829 Ga0501077_0015558
830 Ga0501079_0008623
831 Ga0501080_0050009
832 Ga0501081_0004062
833 Ga0501035_0000014
834 Ga0501035_0091803
835 Ga0501044_0000012
836 Ga0501045_0068209
837 nmdc:mga03683_126_c1
838 nmdc:mga00v17_117935_c1
839 nmdc:mga00v17_1657_c1
840 nmdc:mga0yw44_2586_c1
841 nmdc:mga0yw44_5321_c1
842 nmdc:mga0yw44_62571_c1
843 nmdc:mga06z11_109309_c1
844 nmdc:mga06z11_72223_c1
845 nmdc:mga04h51_18106_c1
846 nmdc:mga04h51_26100_c1
847 nmdc:mga07m45_19227_c1
848 nmdc:mga05p37_166128_c1
849 nmdc:mga05p37_212436_c1
850 nmdc:mga05p37_471451_c1
851 nmdc:mga05p37_668840_c1
852 nmdc:mga06r32_54001_c1
853 nmdc:mga08y16_26_c1
854 nmdc:mga0n895_413852_c1
855 nmdc:mga0a205_125097_c1
856 nmdc:mga0sz30_11502_c1
857 nmdc:mga0sz30_2286_c2
858 Ga0500610_0018879
859 Ga0500618_000025
860 Ga0500658_0021839
861 Ga0500568_0000187
862 Ga0500573_0000328
863 Ga0500573_0004319
864 Ga0500616_0000872
865 Ga0500620_000056
866 Ga0500620_000594
867 Ga0500620_000644
868 Ga0500627_0013042
869 Ga0500627_0016193
870 Ga0500627_0018659
871 Ga0501084_0002425
872 Ga0587088_012432
873 Ga0501082_0000842
874 Ga0530510_0113537
875 2503200060
876 2503202717
877 2509142542
878 2509394964
879 2510313941
880 2510319345
881 2510841573
882 2512930504
883 2512932470
884 2512958241
885 2514032626
886 2514417773
887 2514589324
888 2585167012
889 2585255631
890 2585269129
891 2585390605
892 2585842275
893 2588516137
894 2588518537
895 2597812172
896 2643770376
897 2643984787
898 2643989471
899 2644047675
900 2644153117
901 2644153950
902 2644205907
903 2644299356
904 2644481837
905 2644495063
906 2644497557
907 2644657584
908 2644677607
909 2688598920
910 2723576008
911 2738801712
912 2756671589
913 2756677449
914 2776914696
915 2792747912
916 2792751758
917 2793323199
918 2819243929
919 2819642912
920 2821126499
921 2837654106
922 2838030374
923 2838737026
924 2840880718
925 2841738164
926 2841842605
927 2842142385
928 2842477346
929 2842504143
930 2844006855
931 2844012681
932 2844014268
933 2847675093
934 2856320811
935 2856323163
936 2856324979
937 2856330678
938 2856334909
939 2856347977
940 2856354355
941 2856368128
942 2857372933
943 2857533061
944 2869175301
945 2869244440
946 2869256291
947 2869257153
948 2869257380
949 2869264982
950 2869271319
951 2869280967
952 2869282713
953 2869290253
954 2871432537
955 2871448053
956 2871453875
957 2871462507
958 2871472492
959 2871480167
960 2871486675
961 2871495306
962 2871500403
963 2874120766
964 2874134163
965 2874141367
966 2874142371
967 2874152504
968 2874159904
969 2874166889
970 2874168680
971 2874173134
972 2876367496
973 2876368151
974 2876388634
975 2876398086
976 2876405760
977 2876411208
978 2876418420
979 2876424174
980 2878035855
981 2878743093
982 2878744444
983 2878750151
984 2878758027
985 2878764492
986 2878771593
987 2878780578
988 2878785959
989 2878789613
990 2881149989
991 2881155916
992 2881161132
993 2881166866
994 2881850142
995 2881855610
996 2881855965
997 2881866225
998 2882632633
999 2882633009
1000 2882916958
1001 2885312882
1002 2885325642
1003 2885348199
1004 2885349036
1005 2885354385
1006 2885354769
1007 2888338378
1008 2888340753
1009 2888345936
1010 2889010200
1011 2891376926
1012 2899804117
1013 2903450278
1014 2903452170
1015 2903453165
1016 2903497841
1017 2903502073
1018 2903521987
1019 2903527147
1020 2903528364
1021 2903533374
1022 2903545216
1023 2904664737
1024 2906312509
1025 2906325218
1026 2906369531
1027 2906373775
1028 2906382716
1029 2906390969
1030 2906399211
1031 2906406428
1032 2906411718
1033 2906419740
1034 2922155315
1035 2922159071
1036 2922177208
1037 2922181102
1038 2924715826
1039 2924725898
1040 2924726502
1041 2924732965
1042 2924737807
1043 2924739229
1044 2924747141
1045 2924761499
1046 2924765684
1047 2924768209
1048 2924780892
1049 2924782474
1050 2924784740
1051 2937819346
1052 2937826593
1053 2937827907
1054 2937842605
1055 2937851927
1056 2937852885
1057 2937866760
1058 2937874535
1059 2937879477
1060 2937881115
1061 2937895000
1062 2937974882
1063 2937977209
1064 2937985393
1065 2937999064
1066 2958036930
1067 2958039496
1068 2958050552
1069 2958052875
1070 2958054981
1071 2958065003
1072 2958067244
1073 2958071915
1074 2958086652
1075 2958088328
1076 2958099961
1077 2958108167
1078 2958123410
1079 2958134641
1080 2958139260
1081 2958146451
1082 2958151448
1083 2958159817
1084 2958169538
1085 2958186604
1086 2961085103
1087 2961119735
1088 2961134047
1089 2961135317
1090 2961141520
1091 2961167998
1092 2961174601
1093 2961186444
1094 2963646733
1095 2963648724
1096 2965022817
1097 2965028123
1098 2965034715
1099 2965041156
1100 2965051632
1101 2965094295
1102 2965109666
1103 2968000592
1104 2968010035
1105 2968020243
1106 2968020823
1107 2968083950
1108 2968086531
1109 2968090474
1110 2968115990
1111 2968144145
1112 2968144343
1113 2968176398
1114 2970473565
1115 2970474120
1116 2970490973
1117 2970495129
1118 2970507187
1119 2970512323
1120 2970515004
1121 2970527389
1122 2970536151
1123 2970542967
1124 2970552912
1125 2970559337
1126 2970595571
1127 2970597322
1128 2970624056
1129 2970624754
1130 2970631851
1131 2977828899
1132 2977829366
1133 2977833429
1134 2977848297
1135 2977851475
1136 2977910125
1137 2977921767
1138 2977924791
1139 2977925070
1140 2977940179
1141 2977944674
1142 2977956752
1143 2977961631
1144 2977990412
1145 2977990577
1146 2979767789
1147 2979775589
1148 2979796961
1149 2979812383
1150 2987646398
1151 2987656807
1152 2987664012
1153 2987668579
1154 2987671371
1155 2987673812
1156 2989352297
1157 2989352535
1158 2989776433
1159 2989780461
1160 2996312806
1161 2996314137
1162 2996344530
1163 2996351297
1164 2996352559
1165 2996390763
1166 3000136113
1167 3000139686
1168 3003935318
1169 3004167724
1170 3004170255
1171 3004193067
1172 3004200002
1173 3004213041
1174 3004218137
1175 3004220816
1176 3004222196
1177 3004247563
1178 3004253828
1179 3004271127
1180 3004273783
1181 3004277995
1182 3004279241
1183 3004289378
1184 3004291171
1185 3004340117
1186 637073501
1187 637075567
1188 637078833
1189 649873436
1190 8002291726
1191 8004303511
1192 8004318130
1193 8004367987
1194 8004379539
1195 8004392459
1196 8004402013
1197 8004638598
1198 8004718768
1199 8004733429
1200 8005248225
1201 8005659245
1202 8055619493

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

84

358

0.89

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

78

327

0.83

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

117

356

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.9333 24 343
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.9301 24 344
7oys-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine 0.9293 23 343
7oyz-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d in complex with spermidine 0.9277 24 344
4gl0-assembly1.cif.gz_A putative spermidine/putrescine abc transporter from listeria monocytogenes 0.9259 24 343
ID Description Score Start End Superfamily
af_Q2G2A8_37_140_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.935 27 126 3.40.190.10
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9229 27 128 3.40.190.10
4gl0A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9228 24 312 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9194 27 312 3.40.190.10
af_Q2G2A8_33_356_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9188 26 343 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3S1LI20-F1-model_v4 Extracellular solute-binding protein 0.9855 93 260 GO:0015846
GO:0019808
GO:0042597
AF-A0A3S1LI20-F1-model_v4 Extracellular solute-binding protein 0.9797 93 260 GO:0015846
GO:0019808
GO:0042597
AF-A0A7Y2FUT7-F1-model_v4 Extracellular solute-binding protein 0.9737 156 344 GO:0042597
AF-A0A527W360-F1-model_v4 Extracellular solute-binding protein 0.9658 56 344 GO:0015846
GO:0019808
GO:0042597
AF-A0A7Y2FUT7-F1-model_v4 Extracellular solute-binding protein 0.9637 156 344 GO:0042597

Map