F468371

General Info

Members Datasets Scaffolds Average Seq Length
604 290 496 342

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10004051|Ga0105251_100040515
Length 387
Sequence MRSLVTYFVERKTWHYVCFINVGQSHRQVKRLKRLYNDKFRHTGCIMKKTMIASLAAAGMLFAVAGQAHAGTTLDAVKKKGFVQCGISDGLPGFSYADANGKFTGIDVDVCRGVAAAVFGDDSKVKYTPLTAKERFTALQSGEVDMLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDEDWFSIVRWTLFAMLNAEEMGINSKNVDEKAAKPSTPDMAHLLGTEGDFGKDLKLDNKWAYNIIKQVGNYAEIFERNVGSESPLKIKRGQNNLWNNGGIQYAPPVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
10 2561511199 Enterobacter sp. R4-368 Isolate Nodule
11 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
12 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
13 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
14 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
15 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
16 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
17 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
18 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
19 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
20 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
21 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
22 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
23 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
24 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
25 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
26 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
27 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
28 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
29 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
30 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
31 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
32 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
33 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
34 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
35 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
36 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
37 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
38 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
39 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
40 2751185917 Enterobacter sp. HK169 Isolate Unclassified
41 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
42 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
43 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
44 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
45 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
46 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
47 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
48 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
49 2821118458 Enterobacter asburiae 609 Isolate Unclassified
50 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
51 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
52 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
53 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
54 2847085930 Erwinia persicina B64 Isolate Bulb
55 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
56 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
57 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
58 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
59 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
60 2865014394 Pantoea sp. R-71966 Isolate Unclassified
61 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
62 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
63 2876601092 Pantoea endophytica 596 Isolate Unclassified
64 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
65 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
66 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
67 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
68 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
69 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
70 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
71 2904504865 Serratia marcescens 1822 Isolate Unclassified
72 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
73 2919150387 Rahnella aceris 1817 Isolate Unclassified
74 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
75 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
76 2927143783 Rahnella sp. 2050 Isolate Unclassified
77 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
78 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
79 2937539931 Pantoea sp. LS15 Isolate Unclassified
80 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
81 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
82 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
83 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
84 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
85 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
86 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
87 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
88 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
89 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
90 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
91 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
92 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
93 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
94 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
95 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
96 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
97 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
98 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
99 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
100 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
101 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
102 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
103 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
104 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
105 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
106 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
107 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
147 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
148 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
149 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
150 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
151 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
176 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
182 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
188 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
196 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
200 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
201 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
206 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
207 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
208 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
209 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
210 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
211 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
275 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
276 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
277 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
278 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
279 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
280 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
281 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
282 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
283 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
284 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
285 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
286 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
287 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
288 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
289 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
290 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.79
Metatranscriptomes 0.33
Isolates 17.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0.17
Endosphere 6.62
Nodule 3.48
Rhizoplane 6.13
Rhizosphere 55.96
Stem 0.17
Stem Tuber 0.99
Unclassified 26.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2504277 2162886007 Bacteria 4758
2 JGI24739J22299_10000122 3300001989 Bacteria 24161
3 JGI25162J39368_1000031 3300002737 Bacteria 210480
4 JGI25162J39368_1004244 3300002737 Bacteria 3465
5 JGI25163J39215_1000033 3300002771 Bacteria 64420
6 JGI25163J39215_1000094 3300002771 Bacteria 37245
7 JGI25164J39214_1000050 3300002772 Bacteria 122934
8 JGI25152J39213_1000063 3300002773 Bacteria 71659
9 JGI25152J39213_1013553 3300002773 Bacteria 1693
10 rootH2_10021021 3300003320 Bacteria 50751
11 Ga0055538_1000004 3300003751 Bacteria 615646
12 Ga0055539_1000004 3300003752 Bacteria 615646
13 Ga0055533_1000007 3300003756 Bacteria 615646
14 Ga0055525_1000007 3300003759 Bacteria 615646
15 Ga0055541_1000004 3300003841 Bacteria 615646
16 Ga0058692_1002935 3300003856 Bacteria 5488
17 Ga0058692_1003207 3300003856 Bacteria 5146
18 Ga0058692_1003303 3300003856 Bacteria 5026
19 Ga0058692_1003610 3300003856 Bacteria 4747
20 Ga0058692_1003750 3300003856 Bacteria 4638
21 Ga0058692_1004489 3300003856 Bacteria 4129
22 Ga0058692_1014441 3300003856 Bacteria 1809
23 Ga0065704_10000712 3300005289 Bacteria 13435
24 Ga0065704_10001217 3300005289 Bacteria 9073
25 Ga0065704_10006679 3300005289 Bacteria 2970
26 Ga0065704_10008489 3300005289 Bacteria 3603
27 Ga0065704_10080636 3300005289 Bacteria 3911
28 Ga0065704_10097991 3300005289 Bacteria 2357
29 Ga0070668_100141621 3300005347 Bacteria 1938
30 Ga0070659_100251227 3300005366 Bacteria 1465
31 Ga0070662_100002594 3300005457 Bacteria 11142
32 Ga0070665_100005050 3300005548 Bacteria 13692
33 Ga0070665_100049180 3300005548 Bacteria 4230
34 Ga0070665_100051904 3300005548 Bacteria 4112
35 Ga0070665_100533875 3300005548 Unclassified 1185
36 Ga0068857_100000020 3300005577 Bacteria 89305
37 Ga0068861_100080169 3300005719 Bacteria 2553
38 Ga0068862_100083780 3300005844 Bacteria 2769
39 Ga0075365_10092773 3300006038 Bacteria 2059
40 Ga0075368_10002203 3300006042 Bacteria 6322
41 Ga0075363_100005154 3300006048 Bacteria 5782
42 Ga0075364_10010311 3300006051 Bacteria 5640
43 Ga0075364_10122784 3300006051 Bacteria 1739
44 Ga0075364_10239965 3300006051 Bacteria 1231
45 Ga0075432_10002859 3300006058 Bacteria 5800
46 Ga0075367_10003244 3300006178 Bacteria 7698
47 Ga0075366_10003383 3300006195 Bacteria 8404
48 Ga0075428_100042255 3300006844 Bacteria 5012
49 Ga0075431_100016829 3300006847 Bacteria 7427
50 Ga0079104_1000755 3300006946 Bacteria 27825
51 Ga0079104_1001722 3300006946 Bacteria 13936
52 Ga0079104_1001767 3300006946 Bacteria 13616
53 Ga0079104_1001790 3300006946 Bacteria 13366
54 Ga0079104_1001794 3300006946 Bacteria 13331
55 Ga0079104_1001938 3300006946 Bacteria 12310
56 Ga0079104_1002782 3300006946 Bacteria 8826
57 Ga0079104_1004806 3300006946 Bacteria 5625
58 Ga0079104_1004936 3300006946 Bacteria 5506
59 Ga0099795_10014950 3300007788 Bacteria 2419
60 Ga0105251_10001844 3300009011 Bacteria 17428
61 Ga0105251_10004051 3300009011 Bacteria 10313
62 Ga0105251_10010643 3300009011 Bacteria 5314
63 Ga0105251_10023008 3300009011 Bacteria 3224
64 Ga0105251_10031969 3300009011 Bacteria 2627
65 Ga0105251_10037639 3300009011 Bacteria 2372
66 Ga0105251_10058655 3300009011 Bacteria 1817
67 Ga0105244_10000101 3300009036 Bacteria 88841
68 Ga0105244_10001452 3300009036 Bacteria 19192
69 Ga0105244_10002633 3300009036 Bacteria 13457
70 Ga0105244_10002708 3300009036 Bacteria 13249
71 Ga0105244_10007403 3300009036 Bacteria 6978
72 Ga0105244_10008485 3300009036 Bacteria 6411
73 Ga0105244_10011458 3300009036 Bacteria 5315
74 Ga0105244_10013065 3300009036 Bacteria 4872
75 Ga0105244_10040810 3300009036 Bacteria 2407
76 Ga0105244_10058267 3300009036 Bacteria 1950
77 Ga0105244_10065604 3300009036 Bacteria 1818
78 Ga0105244_10112381 3300009036 Bacteria 1324
79 Ga0105244_10116090 3300009036 Bacteria 1299
80 Ga0105244_10128384 3300009036 Bacteria 1224
81 Ga0105250_10000084 3300009092 Bacteria 82520
82 Ga0105250_10001532 3300009092 Bacteria 12440
83 Ga0105250_10003323 3300009092 Bacteria 7651
84 Ga0105250_10004860 3300009092 Bacteria 6112
85 Ga0105250_10006056 3300009092 Bacteria 5325
86 Ga0105250_10006982 3300009092 Bacteria 4884
87 Ga0105250_10037239 3300009092 Bacteria 1952
88 Ga0105250_10062334 3300009092 Bacteria 1500
89 Ga0105240_10063612 3300009093 Bacteria 4588
90 Ga0111539_10009327 3300009094 Bacteria 12394
91 Ga0111539_10113738 3300009094 Bacteria 3174
92 Ga0105245_10133655 3300009098 Bacteria 2329
93 Ga0114129_10286019 3300009147 Bacteria 2201
94 Ga0105243_10031693 3300009148 Bacteria 4077
95 Ga0105237_10140258 3300009545 Bacteria 2411
96 Ga0105239_10286733 3300010375 Bacteria 1854
97 Ga0105246_10121407 3300011119 Bacteria 1937
98 Ga0105246_10317849 3300011119 Bacteria 1264
99 Ga0157373_10005354 3300013100 Bacteria 9642
100 Ga0157373_10016831 3300013100 Bacteria 5331
101 Ga0157373_10038319 3300013100 Bacteria 3436
102 Ga0157373_10132536 3300013100 Bacteria 1752
103 Ga0157371_10000272 3300013102 Bacteria 70187
104 Ga0157371_10001735 3300013102 Bacteria 22103
105 Ga0157371_10003873 3300013102 Bacteria 13342
106 Ga0157371_10005679 3300013102 Bacteria 10465
107 Ga0157371_10061398 3300013102 Bacteria 2665
108 Ga0157371_10073958 3300013102 Bacteria 2413
109 Ga0157371_10110366 3300013102 Bacteria 1952
110 Ga0157370_10013232 3300013104 Bacteria 8502
111 Ga0157370_10030456 3300013104 Bacteria 5286
112 Ga0157370_10064439 3300013104 Bacteria 3470
113 Ga0157369_10025611 3300013105 Bacteria 6546
114 Ga0157369_10227221 3300013105 Bacteria 1952
115 Ga0157378_10143360 3300013297 Bacteria 2220
116 Ga0163162_10005165 3300013306 Bacteria 12586
117 Ga0163162_10158256 3300013306 Bacteria 2386
118 Ga0157372_10000395 3300013307 Bacteria 48165
119 Ga0157372_10051355 3300013307 Bacteria 4588
120 Ga0157372_10052396 3300013307 Bacteria 4543
121 Ga0157372_10062648 3300013307 Bacteria 4167
122 Ga0157372_10064133 3300013307 Bacteria 4121
123 Ga0157372_10276530 3300013307 Bacteria 1952
124 Ga0157372_10277097 3300013307 Bacteria 1950
125 Ga0157375_10333113 3300013308 Bacteria 1683
126 Ga0157380_10036649 3300014326 Unclassified 3796
127 Ga0182008_10007205 3300014497 Bacteria 6154
128 Ga0157379_10146100 3300014968 Bacteria 2132
129 Ga0182006_1000145 3300015261 Bacteria 75431
130 Ga0182006_1000500 3300015261 Bacteria 30063
131 Ga0182006_1035670 3300015261 Bacteria 1981
132 Ga0182007_10027497 3300015262 Bacteria 1961
133 Ga0183366_1002 3300015679 Bacteria 791639
134 Ga0183370_1002 3300015680 Bacteria 791639
135 Ga0183369_1002 3300015685 Bacteria 791621
136 Ga0183368_1005 3300015687 Bacteria 791621
137 Ga0163161_10017911 3300017792 Bacteria 4964
138 Ga0163161_10034192 3300017792 Bacteria 3635
139 Ga0163161_10236816 3300017792 Bacteria 1418
140 Ga0213874_10017558 3300021377 Bacteria 1921
141 Ga0213876_10002849 3300021384 Bacteria 10056
142 Ga0209760_100006 3300025207 Bacteria 224535
143 Ga0209784_100001 3300025224 Bacteria 3600592
144 Ga0209566_100001 3300025225 Bacteria 3600765
145 Ga0209674_100002 3300025226 Bacteria 3600592
146 Ga0209563_100008 3300025230 Bacteria 1554545
147 Ga0207427_100002 3300025231 Bacteria 1355321
148 Ga0209437_100114 3300025233 Bacteria 210697
149 Ga0209437_100218 3300025233 Bacteria 105141
150 Ga0207425_1003138 3300025245 Bacteria 5422
151 Ga0209677_100004 3300025253 Bacteria 1554545
152 Ga0209129_1000010 3300025258 Bacteria 583357
153 Ga0209676_1010607 3300025292 Bacteria 3811
154 Ga0207656_10039310 3300025321 Bacteria 2000
155 Ga0207696_1000022 3300025711 Bacteria 427529
156 Ga0207696_1000048 3300025711 Bacteria 284649
157 Ga0207696_1000222 3300025711 Bacteria 82527
158 Ga0207696_1000244 3300025711 Bacteria 74116
159 Ga0207696_1000268 3300025711 Bacteria 65040
160 Ga0207696_1000639 3300025711 Bacteria 25370
161 Ga0207696_1001519 3300025711 Bacteria 12448
162 Ga0207696_1002610 3300025711 Bacteria 8741
163 Ga0207696_1004084 3300025711 Bacteria 6395
164 Ga0207696_1006218 3300025711 Bacteria 4844
165 Ga0207696_1023257 3300025711 Bacteria 1957
166 Ga0207655_1000065 3300025728 Bacteria 252767
167 Ga0207655_1000186 3300025728 Bacteria 110125
168 Ga0207655_1000209 3300025728 Bacteria 102459
169 Ga0207655_1000244 3300025728 Bacteria 88845
170 Ga0207655_1000422 3300025728 Bacteria 57692
171 Ga0207655_1000459 3300025728 Bacteria 53395
172 Ga0207655_1002142 3300025728 Bacteria 16452
173 Ga0207655_1002895 3300025728 Bacteria 13244
174 Ga0207655_1005615 3300025728 Bacteria 8491
175 Ga0207655_1010706 3300025728 Bacteria 5540
176 Ga0207655_1011393 3300025728 Bacteria 5299
177 Ga0207655_1013232 3300025728 Bacteria 4751
178 Ga0207655_1016316 3300025728 Bacteria 4071
179 Ga0207655_1044277 3300025728 Bacteria 1872
180 Ga0207713_1000145 3300025735 Bacteria 106522
181 Ga0207713_1001612 3300025735 Bacteria 17594
182 Ga0207713_1012280 3300025735 Bacteria 4593
183 Ga0207713_1014838 3300025735 Bacteria 4022
184 Ga0207713_1015296 3300025735 Bacteria 3946
185 Ga0207713_1024673 3300025735 Bacteria 2797
186 Ga0207713_1027303 3300025735 Bacteria 2596
187 Ga0207713_1048366 3300025735 Bacteria 1713
188 Ga0207713_1064366 3300025735 Bacteria 1381
189 Ga0207713_1082091 3300025735 Bacteria 1156
190 Ga0207671_10116318 3300025914 Bacteria 2039
191 Ga0207706_10021464 3300025933 Bacteria 5800
192 Ga0207709_10138494 3300025935 Bacteria 1670
193 Ga0207709_10224558 3300025935 Bacteria 1357
194 Ga0207674_10000119 3300026116 Bacteria 91959
195 Ga0207675_100064645 3300026118 Bacteria 3420
196 Ga0209281_1000025 3300027111 Bacteria 488275
197 Ga0209281_1000279 3300027111 Bacteria 96898
198 Ga0209281_1000281 3300027111 Bacteria 96061
199 Ga0209281_1000328 3300027111 Bacteria 82899
200 Ga0209281_1000511 3300027111 Bacteria 51049
201 Ga0209281_1000828 3300027111 Bacteria 27770
202 Ga0209281_1001482 3300027111 Bacteria 13560
203 Ga0209281_1001496 3300027111 Bacteria 13370
204 Ga0209281_1001499 3300027111 Bacteria 13344
205 Ga0209281_1003401 3300027111 Bacteria 5290
206 Ga0209371_1000013 3300027312 Bacteria 691516
207 Ga0209371_1000019 3300027312 Bacteria 583561
208 Ga0209371_1000248 3300027312 Bacteria 66811
209 Ga0209371_1000458 3300027312 Bacteria 40174
210 Ga0209371_1000797 3300027312 Bacteria 26027
211 Ga0209371_1001520 3300027312 Bacteria 15375
212 Ga0209371_1001655 3300027312 Bacteria 14314
213 Ga0209371_1001795 3300027312 Bacteria 13422
214 Ga0209371_1002900 3300027312 Bacteria 8979
215 Ga0209371_1003193 3300027312 Bacteria 8260
216 Ga0209371_1003650 3300027312 Bacteria 7317
217 Ga0209371_1004287 3300027312 Bacteria 6316
218 Ga0209371_1005172 3300027312 Bacteria 5309
219 Ga0209371_1005250 3300027312 Bacteria 5222
220 Ga0209371_1005289 3300027312 Bacteria 5198
221 Ga0209371_1006731 3300027312 Bacteria 4185
222 Ga0209371_1017432 3300027312 Bacteria 1861
223 Ga0209813_10000429 3300027866 Bacteria 10264
224 Ga0207428_10010860 3300027907 Bacteria 8113
225 Ga0207428_10012406 3300027907 Bacteria 7489
226 Ga0268266_10003971 3300028379 Bacteria 14343
227 Ga0268266_10495118 3300028379 Unclassified 1166
228 Ga0268265_10028520 3300028380 Bacteria 3997
229 Ga0268256_1000014 3300030500 Bacteria 691435
230 Ga0268256_1000088 3300030500 Bacteria 156662
231 Ga0268256_1001303 3300030500 Bacteria 15370
232 Ga0268256_1001565 3300030500 Bacteria 13420
233 Ga0268256_1002056 3300030500 Bacteria 10847
234 Ga0268256_1002700 3300030500 Bacteria 8728
235 Ga0268256_1003653 3300030500 Bacteria 6814
236 Ga0268256_1004780 3300030500 Bacteria 5506
237 Ga0268256_1005219 3300030500 Bacteria 5152
238 Ga0268256_1006116 3300030500 Bacteria 4545
239 Ga0268256_1006229 3300030500 Bacteria 4476
240 Ga0268256_1006920 3300030500 Bacteria 4139
241 Ga0268256_1008548 3300030500 Bacteria 3491
242 Ga0268256_1017595 3300030500 Bacteria 2008
243 Ga0268256_1019432 3300030500 Bacteria 1861
244 Ga0268256_1031998 3300030500 Bacteria 1257
245 Ga0268256_1038993 3300030500 Bacteria 1076
246 Ga0316575_10077682 3300031665 Bacteria 1337
247 Ga0316579_10008365 3300031691 Bacteria 4309
248 Ga0316576_10011203 3300031727 Bacteria 5862
249 Ga0316576_10037630 3300031727 Bacteria 3465
250 Ga0316576_10041505 3300031727 Bacteria 3312
251 Ga0316578_10031899 3300031728 Bacteria 3005
252 Ga0307412_10000195 3300031911 Bacteria 41902
253 Ga0316580_10007776 3300032139 Bacteria 3199
254 Ga0316592_1004791 3300033524 Bacteria 2535
255 Ga0316588_1002359 3300033528 Bacteria 3282
256 Ga0316574_0012014 3300035398 Bacteria 4940
257 Ga0316574_0100331 3300035398 Bacteria 1853
258 Ga0316582_0034230 3300036647 Bacteria 3127
259 Ga0316582_0035044 3300036647 Bacteria 3095
260 Ga0316582_0092288 3300036647 Bacteria 1995
261 Ga0316582_0195458 3300036647 Bacteria 1379
262 Ga0316584_0004146 3300036712 Bacteria 9567
263 Ga0316584_0098923 3300036712 Bacteria 2184
264 Ga0395900_0003258 3300037418 Bacteria 17580
265 Ga0395898_0186050 3300037466 Bacteria 1984
266 Ga0400484_03109 3300038725 Bacteria 3249
267 Ga0400484_11573 3300038725 Bacteria 6864
268 Ga0400489_65594 3300039093 Bacteria 5000
269 Ga0436365_0471682 3300039437 Bacteria 352256
270 Ga0436365_1167659 3300039437 Bacteria 2819
271 Ga0436363_1297008 3300039450 Bacteria 5332
272 Ga0439436_0000180 3300041404 Bacteria 15023
273 Ga0439438_000003 3300041405 Bacteria 464587
274 Ga0439438_001642 3300041405 Bacteria 9817
275 Ga0439438_003447 3300041405 Bacteria 6390
276 Ga0439438_004532 3300041405 Bacteria 5299
277 Ga0439438_008013 3300041405 Bacteria 3553
278 Ga0439447_001931 3300041407 Bacteria 7584
279 Ga0439447_003628 3300041407 Bacteria 5453
280 Ga0439447_023275 3300041407 Bacteria 1615
281 Ga0439466_0000004 3300041411 Bacteria 462654
282 Ga0439466_0001268 3300041411 Bacteria 9815
283 Ga0451853_3873808 3300041512 Bacteria 4500
284 Ga0439432_002693 3300042006 Bacteria 6650
285 Ga0439432_004662 3300042006 Bacteria 4993
286 Ga0439432_007188 3300042006 Bacteria 3955
287 Ga0439432_043694 3300042006 Bacteria 1413
288 Ga0439452_000009 3300042010 Bacteria 569493
289 Ga0439452_000011 3300042010 Bacteria 428451
290 Ga0439452_000078 3300042010 Bacteria 83572
291 Ga0439452_000584 3300042010 Bacteria 18889
292 Ga0439452_000897 3300042010 Bacteria 13634
293 Ga0439452_003711 3300042010 Bacteria 5280
294 Ga0439456_001970 3300042013 Bacteria 4136
295 Ga0439463_003991 3300042016 Bacteria 3713
296 Ga0450907_001020 3300042146 Bacteria 6562
297 Ga0439446_0003257 3300042156 Bacteria 4007
298 Ga0439464_0000239 3300042439 Bacteria 10102
299 Ga0439464_0000303 3300042439 Bacteria 9355
300 Ga0466981_0000151 3300044669 Bacteria 19080
301 Ga0466963_0012128 3300044694 Bacteria 5268
302 Ga0453684_0005396 3300044712 Bacteria 25382
303 Ga0466967_0008969 3300045976 Bacteria 7387
304 Ga0495591_000004 3300046458 Bacteria 410200
305 Ga0495591_001433 3300046458 Bacteria 14814
306 Ga0495591_001707 3300046458 Bacteria 13114
307 Ga0495591_026849 3300046458 Bacteria 1782
308 Ga0495638_0020994 3300046460 Bacteria 4310
309 Ga0495650_0000004 3300046471 Bacteria 779487
310 Ga0495650_0000008 3300046471 Bacteria 688246
311 Ga0495650_0000040 3300046471 Bacteria 366254
312 Ga0495650_0025064 3300046471 Bacteria 2804
313 Ga0495605_0041756 3300046474 Bacteria 2283
314 Ga0495584_0004114 3300046491 Bacteria 7851
315 Ga0495585_0021464 3300046492 Bacteria 3707
316 Ga0495607_0006268 3300046501 Bacteria 8387
317 Ga0495606_0000399 3300046507 Bacteria 73352
318 Ga0495606_0004391 3300046507 Bacteria 14128
319 Ga0495620_0002175 3300046515 Bacteria 11385
320 Ga0495631_0014300 3300046518 Bacteria 3835
321 Ga0495643_0000689 3300046522 Bacteria 39031
322 Ga0495644_0006296 3300046523 Bacteria 4611
323 Ga0495648_0010014 3300046524 Bacteria 7269
324 Ga0495648_0017969 3300046524 Bacteria 5031
325 Ga0495654_0000086 3300046530 Bacteria 106881
326 Ga0495654_0000089 3300046530 Bacteria 102765
327 Ga0495597_0002225 3300046542 Bacteria 12685
328 Ga0495668_0070947 3300046616 Bacteria 1915
329 Ga0495625_0013860 3300046660 Bacteria 6456
330 Ga0495671_0000922 3300046692 Bacteria 20820
331 Ga0495671_0001019 3300046692 Bacteria 19494
332 Ga0495649_0002507 3300046694 Bacteria 12897
333 Ga0495649_0002508 3300046694 Bacteria 12897
334 Ga0495649_0005994 3300046694 Bacteria 7614
335 Ga0495649_0012491 3300046694 Bacteria 4937
336 Ga0495589_0024590 3300046794 Bacteria 3061
337 Ga0495660_0000022 3300046810 Bacteria 284337
338 Ga0495660_0000650 3300046810 Bacteria 26974
339 Ga0495660_0023385 3300046810 Bacteria 3524
340 Ga0495672_0000003 3300047320 Bacteria 728845
341 Ga0495672_0000082 3300047320 Bacteria 159422
342 Ga0495672_0000149 3300047320 Bacteria 101419
343 Ga0495683_0031883 3300047323 Bacteria 2684
344 Ga0495679_000059 3300047446 Bacteria 109922
345 Ga0495679_001465 3300047446 Bacteria 13385
346 Ga0495679_008423 3300047446 Bacteria 4192
347 Ga0495679_038823 3300047446 Bacteria 1489
348 Ga0495673_0000011 3300047469 Bacteria 674140
349 Ga0495673_0000117 3300047469 Bacteria 148662
350 Ga0495681_0040834 3300047470 Bacteria 2256
351 Ga0496100_0016990 3300048903 Bacteria 4284
352 Ga0496100_0019089 3300048903 Bacteria 4083
353 Ga0496101_0002189 3300048904 Bacteria 11935
354 Ga0496102_0047391 3300048905 Bacteria 3905
355 Ga0496102_0451169 3300048905 Bacteria 1206
356 Ga0496104_0001060 3300048907 Bacteria 23455
357 Ga0496104_0005301 3300048907 Bacteria 11279
358 Ga0496104_0012074 3300048907 Bacteria 7753
359 Ga0496104_0026078 3300048907 Bacteria 5391
360 Ga0496105_0001151 3300048908 Bacteria 18430
361 Ga0496105_0051538 3300048908 Bacteria 3400
362 Ga0496105_0075292 3300048908 Bacteria 2788
363 Ga0496108_0001082 3300048911 Bacteria 21247
364 Ga0496109_0003115 3300048912 Bacteria 13831
365 Ga0496110_0000990 3300048913 Bacteria 19925
366 Ga0496111_0008781 3300048914 Bacteria 6711
367 Ga0496112_0069479 3300048915 Bacteria 3480
368 Ga0496113_0093278 3300048916 Bacteria 2323
369 Ga0496116_0000188 3300048919 Bacteria 123223
370 Ga0496116_0000671 3300048919 Bacteria 44585
371 Ga0496116_0004703 3300048919 Bacteria 12898
372 Ga0496116_0004976 3300048919 Bacteria 12521
373 Ga0496116_0018167 3300048919 Bacteria 5430
374 Ga0496116_0023269 3300048919 Bacteria 4617
375 Ga0496116_0035325 3300048919 Bacteria 3511
376 Ga0496116_0063480 3300048919 Bacteria 2379
377 Ga0496116_0076267 3300048919 Bacteria 2100
378 Ga0496116_0126047 3300048919 Bacteria 1470
379 Ga0496117_0000234 3300048920 Bacteria 105021
380 Ga0496117_0000548 3300048920 Bacteria 61658
381 Ga0496117_0002142 3300048920 Bacteria 25768
382 Ga0496117_0005415 3300048920 Bacteria 13428
383 Ga0496117_0007842 3300048920 Bacteria 10271
384 Ga0496117_0018692 3300048920 Bacteria 5728
385 Ga0496117_0020804 3300048920 Bacteria 5339
386 Ga0496117_0032318 3300048920 Bacteria 3978
387 Ga0496117_0066574 3300048920 Bacteria 2442
388 Ga0496117_0075381 3300048920 Bacteria 2241
389 Ga0496117_0076909 3300048920 Bacteria 2210
390 Ga0496117_0102782 3300048920 Bacteria 1802
391 Ga0496118_0000203 3300048921 Bacteria 104542
392 Ga0496118_0004116 3300048921 Bacteria 17610
393 Ga0496118_0004900 3300048921 Bacteria 15561
394 Ga0496118_0009366 3300048921 Bacteria 9916
395 Ga0496118_0013985 3300048921 Bacteria 7538
396 Ga0496118_0017350 3300048921 Bacteria 6554
397 Ga0496118_0019393 3300048921 Bacteria 6079
398 Ga0496118_0026634 3300048921 Bacteria 4918
399 Ga0496118_0029925 3300048921 Bacteria 4556
400 Ga0496118_0033926 3300048921 Bacteria 4176
401 Ga0496118_0051356 3300048921 Bacteria 3155
402 Ga0496119_0000096 3300048922 Bacteria 129464
403 Ga0496119_0001129 3300048922 Bacteria 33640
404 Ga0496119_0001384 3300048922 Bacteria 29475
405 Ga0496119_0004961 3300048922 Bacteria 13007
406 Ga0496119_0007717 3300048922 Bacteria 9617
407 Ga0496119_0008420 3300048922 Bacteria 9060
408 Ga0496119_0011497 3300048922 Bacteria 7319
409 Ga0496119_0013399 3300048922 Bacteria 6538
410 Ga0496119_0018337 3300048922 Bacteria 5217
411 Ga0496119_0021724 3300048922 Bacteria 4625
412 Ga0496119_0035323 3300048922 Bacteria 3276
413 Ga0496119_0042187 3300048922 Bacteria 2896
414 Ga0496120_0000440 3300048923 Bacteria 65855
415 Ga0496120_0001179 3300048923 Bacteria 33269
416 Ga0496120_0003008 3300048923 Bacteria 15983
417 Ga0496120_0003970 3300048923 Bacteria 12862
418 Ga0496120_0004823 3300048923 Bacteria 11037
419 Ga0496120_0005481 3300048923 Bacteria 10103
420 Ga0496120_0007695 3300048923 Bacteria 7978
421 Ga0496120_0008628 3300048923 Bacteria 7361
422 Ga0496120_0008691 3300048923 Bacteria 7319
423 Ga0496120_0010842 3300048923 Bacteria 6311
424 Ga0496120_0013586 3300048923 Bacteria 5471
425 Ga0496121_0001930 3300048924 Bacteria 33136
426 Ga0496121_0003401 3300048924 Bacteria 22756
427 Ga0496121_0006781 3300048924 Bacteria 14038
428 Ga0496121_0007334 3300048924 Bacteria 13332
429 Ga0496121_0010039 3300048924 Bacteria 10749
430 Ga0496121_0010148 3300048924 Bacteria 10669
431 Ga0496121_0010605 3300048924 Bacteria 10354
432 Ga0496122_0000070 3300048925 Bacteria 223198
433 Ga0496122_0000227 3300048925 Bacteria 125743
434 Ga0496122_0003732 3300048925 Bacteria 19657
435 Ga0496122_0006839 3300048925 Bacteria 12931
436 Ga0496122_0008770 3300048925 Bacteria 10811
437 Ga0496122_0012428 3300048925 Bacteria 8476
438 Ga0496122_0031053 3300048925 Bacteria 4456
439 Ga0496122_0032303 3300048925 Bacteria 4332
440 Ga0496122_0036313 3300048925 Bacteria 3988
441 Ga0496122_0045585 3300048925 Bacteria 3407
442 Ga0496122_0099523 3300048925 Bacteria 1948
443 Ga0496122_0120564 3300048925 Bacteria 1692
444 Ga0496123_0000183 3300048926 Bacteria 126284
445 Ga0496123_0000565 3300048926 Bacteria 63347
446 Ga0496123_0001751 3300048926 Bacteria 28639
447 Ga0496123_0006949 3300048926 Bacteria 10811
448 Ga0496123_0009615 3300048926 Bacteria 8677
449 Ga0496123_0010096 3300048926 Viruses 8397
450 Ga0496123_0010858 3300048926 Bacteria 7980
451 Ga0496123_0019109 3300048926 Bacteria 5409
452 Ga0496123_0020522 3300048926 Bacteria 5165
453 Ga0496123_0041848 3300048926 Bacteria 3170
454 Ga0496124_0000169 3300048927 Bacteria 131658
455 Ga0496124_0001191 3300048927 Bacteria 40521
456 Ga0496124_0002649 3300048927 Bacteria 22989
457 Ga0496124_0003583 3300048927 Bacteria 18875
458 Ga0496124_0005663 3300048927 Bacteria 13937
459 Ga0496124_0026751 3300048927 Bacteria 5196
460 Ga0496124_0027384 3300048927 Bacteria 5116
461 Ga0496124_0027908 3300048927 Bacteria 5055
462 Ga0496124_0030343 3300048927 Bacteria 4800
463 Ga0496124_0121693 3300048927 Bacteria 2084
464 Ga0496124_0132055 3300048927 Bacteria 1982
465 Ga0496124_0148170 3300048927 Bacteria 1844
466 Ga0496124_0168991 3300048927 Bacteria 1696
467 Ga0496124_0267263 3300048927 Bacteria 1254
468 Ga0496125_0000056 3300048928 Bacteria 271016
469 Ga0496125_0000329 3300048928 Bacteria 91776
470 Ga0496125_0005963 3300048928 Bacteria 13340
471 Ga0496125_0007885 3300048928 Bacteria 11246
472 Ga0496125_0011547 3300048928 Bacteria 8824
473 Ga0496125_0011646 3300048928 Bacteria 8781
474 Ga0496125_0021273 3300048928 Bacteria 6057
475 Ga0496125_0025899 3300048928 Bacteria 5359
476 Ga0496125_0134728 3300048928 Bacteria 1730
477 Ga0496126_0000137 3300048929 Bacteria 167415
478 Ga0496126_0004504 3300048929 Bacteria 16600
479 Ga0496126_0005462 3300048929 Bacteria 14500
480 Ga0496126_0043271 3300048929 Bacteria 4154
481 Ga0496126_0295414 3300048929 Bacteria 1338
482 Ga0495678_003061 3300049459 Bacteria 10617
483 Ga0495682_0000034 3300049460 Bacteria 131806
484 Ga0495682_0010373 3300049460 Bacteria 3610
485 nmdc:mga03n38_6571_c1 3300050490 Bacteria 4050
486 nmdc:mga00v17_170485_c1 3300050491 Bacteria 1403
487 nmdc:mga00v17_2337_c1 3300050491 Bacteria 9712
488 nmdc:mga0yw44_50497_c1 3300050492 Bacteria 2515
489 nmdc:mga0k408_894_c2 3300050493 Bacteria 4405
490 nmdc:mga06z11_26479_c1 3300050494 Bacteria 2760
491 nmdc:mga09592_331942_c1 3300050508 Bacteria 1316
492 nmdc:mga0qj67_167033_c1 3300050509 Bacteria 1787
493 nmdc:mga06r32_124110_c1 3300050510 Unclassified 2549
494 nmdc:mga08y16_238378_c1 3300050511 Bacteria 1881
495 nmdc:mga08y16_69972_c1 3300050511 Bacteria 3658
496 Ga0500621_000010 3300053126 Bacteria 169537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007788 Ga0099795_10014950 Ga0099795_100149502 303
2 3300044694 Ga0466963_0012128 Ga0466963_0012128_3762_4922 309
3 3300045976 Ga0466967_0008969 Ga0466967_0008969_1181_2341 309
4 3300050490 nmdc:mga03n38_6571_c1 nmdc:mga03n38_6571_c1_924_1868 314
5 3300048919 Ga0496116_0063480 Ga0496116_0063480_1396_2355 318
6 3300050508 nmdc:mga09592_331942_c1 nmdc:mga09592_331942_c1_32_1030 323
7 3300048927 Ga0496124_0148170 Ga0496124_0148170_741_1766 324
8 3300050511 nmdc:mga08y16_238378_c1 nmdc:mga08y16_238378_c1_523_1506 326
9 3300005366 Ga0070659_100251227 Ga0070659_1002512271 327
10 3300050509 nmdc:mga0qj67_167033_c1 nmdc:mga0qj67_167033_c1_174_1166 329
11 3300027312 Ga0209371_1000458 Ga0209371_100045832 330
12 3300030500 Ga0268256_1017595 Ga0268256_10175952 330
13 3300030500 Ga0268256_1031998 Ga0268256_10319981 330
14 3300035398 Ga0316574_0100331 Ga0316574_0100331_806_1801 331
15 3300050511 nmdc:mga08y16_69972_c1 nmdc:mga08y16_69972_c1_743_1837 331
16 3300009098 Ga0105245_10133655 Ga0105245_101336552 333
17 3300013297 Ga0157378_10143360 Ga0157378_101433602 333
18 3300013308 Ga0157375_10333113 Ga0157375_103331131 333
19 3300014968 Ga0157379_10146100 Ga0157379_101461002 333
20 iso_pu_bacteria 2894652903 2894657411 333
21 iso_pu_bacteria 2923525760 2923529443 333
22 3300021377 Ga0213874_10017558 Ga0213874_100175582 334
23 iso_pu_bacteria 2739367655 2739610515 334
24 iso_pu_bacteria 2881927736 2881929234 334
25 iso_pu_bacteria 2887375801 2887375875 334
26 iso_pu_bacteria 646564506 646812773 334
27 iso_pu_bacteria 8002392321 8002395605 334
28 iso_pu_bacteria 8048746797 8048748708 334
29 3300031691 Ga0316579_10008365 Ga0316579_100083652 336
30 3300031727 Ga0316576_10037630 Ga0316576_100376302 336
31 3300033524 Ga0316592_1004791 Ga0316592_10047913 336
32 3300033528 Ga0316588_1002359 Ga0316588_10023591 336
33 3300036647 Ga0316582_0034230 Ga0316582_0034230_1203_2417 336
34 3300036647 Ga0316582_0035044 Ga0316582_0035044_1333_2352 336
35 3300036712 Ga0316584_0004146 Ga0316584_0004146_4137_5351 336
36 3300036712 Ga0316584_0098923 Ga0316584_0098923_253_1272 336
37 3300039093 Ga0400489_65594 Ga0400489_65594_315_1340 336
38 iso_pu_bacteria 2599185170 2599419135 336
39 iso_pu_bacteria 2687453129 2687577406 336
40 iso_pu_bacteria 2687453129 2687578187 336
41 3300006038 Ga0075365_10092773 Ga0075365_100927733 337
42 3300006844 Ga0075428_100042255 Ga0075428_1000422553 337
43 3300006847 Ga0075431_100016829 Ga0075431_1000168296 337
44 3300009094 Ga0111539_10113738 Ga0111539_101137383 337
45 3300044712 Ga0453684_0005396 Ga0453684_0005396_14539_15558 337
46 3300050510 nmdc:mga06r32_124110_c1 nmdc:mga06r32_124110_c1_859_1890 337
47 iso_pu_bacteria 2511231025 2511380526 337
48 iso_pu_bacteria 2511231035 2511436825 337
49 iso_pu_bacteria 2537561728 2538427925 337
50 iso_pu_bacteria 2547132181 2547695923 337
51 iso_pu_bacteria 2554235132 2554813427 337
52 iso_pu_bacteria 2561511199 2562464691 337
53 iso_pu_bacteria 2585427591 2585826431 337
54 iso_pu_bacteria 2585427592 2585830535 337
55 iso_pu_bacteria 2599185299 2599928319 337
56 iso_pu_bacteria 2600255256 2601534497 337
57 iso_pu_bacteria 2600255257 2601538724 337
58 iso_pu_bacteria 2600255310 2601757073 337
59 iso_pu_bacteria 2600255311 2601762326 337
60 iso_pu_bacteria 2602042046 2603639422 337
61 iso_pu_bacteria 2602042047 2603644416 337
62 iso_pu_bacteria 2602042067 2603705028 337
63 iso_pu_bacteria 2606217733 2608381398 337
64 iso_pu_bacteria 2608642108 2608671323 337
65 iso_pu_bacteria 2609459761 2609911330 337
66 iso_pu_bacteria 2648501693 2650898381 337
67 iso_pu_bacteria 2667528172 2671104453 337
68 iso_pu_bacteria 2667528173 2671106724 337
69 iso_pu_bacteria 2671180115 2671586249 337
70 iso_pu_bacteria 2681812866 2681998179 337
71 iso_pu_bacteria 2681812869 2682008305 337
72 iso_pu_bacteria 2684622997 2686355422 337
73 iso_pu_bacteria 2711768156 2712472284 337
74 iso_pu_bacteria 2751185917 2753857810 337
75 iso_pu_bacteria 2765235842 2765590931 337
76 iso_pu_bacteria 2775506706 2775540495 337
77 iso_pu_bacteria 2791354903 2791925356 337
78 iso_pu_bacteria 2791355010 2792312506 337
79 iso_pu_bacteria 2791355275 2793403796 337
80 iso_pu_bacteria 2808606414 2809127042 337
81 iso_pu_bacteria 2811995292 2813726709 337
82 iso_pu_bacteria 2814123068 2814694082 337
83 iso_pu_bacteria 2821118458 2821120810 337
84 iso_pu_bacteria 2823373977 2823376693 337
85 iso_pu_bacteria 2844425489 2844429304 337
86 iso_pu_bacteria 2844528606 2844529974 337
87 iso_pu_bacteria 2847085930 2847090256 337
88 iso_pu_bacteria 2847797336 2847797823 337
89 iso_pu_bacteria 2852103415 2852105966 337
90 iso_pu_bacteria 2855195626 2855199889 337
91 iso_pu_bacteria 2858466076 2858466079 337
92 iso_pu_bacteria 2865014394 2865016688 337
93 iso_pu_bacteria 2871272651 2871273511 337
94 iso_pu_bacteria 2871282230 2871282804 337
95 iso_pu_bacteria 2876601092 2876602220 337
96 iso_pu_bacteria 2881609920 2881611435 337
97 iso_pu_bacteria 2891670763 2891675448 337
98 iso_pu_bacteria 2900051742 2900056349 337
99 iso_pu_bacteria 2904474040 2904474130 337
100 iso_pu_bacteria 2904504865 2904507252 337
101 iso_pu_bacteria 2908669403 2908672816 337
102 iso_pu_bacteria 2919150387 2919150477 337
103 iso_pu_bacteria 2923634449 2923636826 337
104 iso_pu_bacteria 2927143783 2927145350 337
105 iso_pu_bacteria 2927833300 2927836722 337
106 iso_pu_bacteria 2935625433 2935629573 337
107 iso_pu_bacteria 2937539931 2937544199 337
108 iso_pu_bacteria 2939568625 2939572509 337
109 iso_pu_bacteria 2939573065 2939576672 337
110 iso_pu_bacteria 2939602548 2939603981 337
111 iso_pu_bacteria 2939607340 2939610649 337
112 iso_pu_bacteria 2939617950 2939620636 337
113 iso_pu_bacteria 2939642701 2939645718 337
114 iso_pu_bacteria 2945874760 2945875761 337
115 iso_pu_bacteria 2945951305 2945955409 337
116 iso_pu_bacteria 2974310843 2974314838 337
117 iso_pu_bacteria 2974435778 2974440370 337
118 iso_pu_bacteria 2978975091 2978977884 337
119 iso_pu_bacteria 2984494565 2984499255 337
120 iso_pu_bacteria 2990261002 2990264656 337
121 iso_pu_bacteria 8016733728 8016734188 337
122 iso_pu_bacteria 8018405270 8018407171 337
123 iso_pu_bacteria 8019499862 8019503205 337
124 iso_pu_bacteria 8019504834 8019507407 337
125 iso_pu_bacteria 8054844752 8054848442 337
126 iso_pu_bacteria 8054849141 8054849820 337
127 iso_pu_bacteria 8055087960 8055089454 337
128 iso_pu_bacteria 8055092621 8055096069 337
129 iso_pu_bacteria 8055097453 8055101811 337
130 iso_pu_bacteria 8057304971 8057308540 337
131 3300035398 Ga0316574_0012014 Ga0316574_0012014_3306_4322 338
132 3300036647 Ga0316582_0195458 Ga0316582_0195458_99_1115 338
133 3300037418 Ga0395900_0003258 Ga0395900_0003258_232_1248 338
134 3300037466 Ga0395898_0186050 Ga0395898_0186050_191_1207 338
135 3300038725 Ga0400484_03109 Ga0400484_03109_978_2000 338
136 iso_pu_bacteria 2510065053 2510284800 338
137 iso_pu_bacteria 2510065055 2510295110 338
138 iso_pu_bacteria 2510065058 2510312178 338
139 iso_pu_bacteria 2599185155 2599328180 338
140 iso_pu_bacteria 2728369097 2729145951 338
141 iso_pu_bacteria 2738543020 2739286806 338
142 iso_pu_bacteria 2738543021 2739292119 338
143 iso_pu_bacteria 2842805378 2842808942 338
144 iso_pu_bacteria 8011350971 8011353756 338
145 iso_pu_bacteria 8056115690 8056117233 338
146 iso_pu_bacteria 8056137416 8056138382 338
147 3300002773 JGI25152J39213_1013553 JGI25152J39213_10135531 339
148 3300005548 Ga0070665_100533875 Ga0070665_1005338751 339
149 3300005719 Ga0068861_100080169 Ga0068861_1000801691 339
150 3300005844 Ga0068862_100083780 Ga0068862_1000837802 339
151 3300006042 Ga0075368_10002203 Ga0075368_100022032 339
152 3300006048 Ga0075363_100005154 Ga0075363_1000051547 339
153 3300006178 Ga0075367_10003244 Ga0075367_100032449 339
154 3300009094 Ga0111539_10009327 Ga0111539_100093275 339
155 3300009147 Ga0114129_10286019 Ga0114129_102860192 339
156 3300014326 Ga0157380_10036649 Ga0157380_100366492 339
157 3300025292 Ga0209676_1010607 Ga0209676_10106074 339
158 3300026118 Ga0207675_100064645 Ga0207675_1000646455 339
159 3300027866 Ga0209813_10000429 Ga0209813_100004298 339
160 3300027907 Ga0207428_10010860 Ga0207428_100108607 339
161 3300028379 Ga0268266_10495118 Ga0268266_104951181 339
162 3300028380 Ga0268265_10028520 Ga0268265_100285205 339
163 3300031665 Ga0316575_10077682 Ga0316575_100776821 339
164 3300031727 Ga0316576_10041505 Ga0316576_100415052 339
165 3300031911 Ga0307412_10000195 Ga0307412_1000019529 339
166 3300032139 Ga0316580_10007776 Ga0316580_100077763 339
167 3300036647 Ga0316582_0092288 Ga0316582_0092288_269_1294 339
168 3300039437 Ga0436365_1167659 Ga0436365_1167659_1231_2367 339
169 3300039450 Ga0436363_1297008 Ga0436363_1297008_123_1259 339
170 3300048907 Ga0496104_0001060 Ga0496104_0001060_11800_12837 339
171 3300048911 Ga0496108_0001082 Ga0496108_0001082_9817_10854 339
172 3300048912 Ga0496109_0003115 Ga0496109_0003115_11150_12187 339
173 3300048913 Ga0496110_0000990 Ga0496110_0000990_969_2006 339
174 3300048914 Ga0496111_0008781 Ga0496111_0008781_2791_3828 339
175 3300048915 Ga0496112_0069479 Ga0496112_0069479_287_1324 339
176 3300048916 Ga0496113_0093278 Ga0496113_0093278_1038_2075 339
177 3300048920 Ga0496117_0066574 Ga0496117_0066574_960_1985 339
178 3300048921 Ga0496118_0033926 Ga0496118_0033926_1375_2400 339
179 3300048925 Ga0496122_0000227 Ga0496122_0000227_58133_59155 339
180 3300048928 Ga0496125_0134728 Ga0496125_0134728_22_1047 339
181 3300050492 nmdc:mga0yw44_50497_c1 nmdc:mga0yw44_50497_c1_748_1785 339
182 3300050494 nmdc:mga06z11_26479_c1 nmdc:mga06z11_26479_c1_867_1904 339
183 iso_pu_bacteria 2706794495 2707101186 339
184 iso_pu_bacteria 2854601825 2854604895 339
185 3300005289 Ga0065704_10097991 Ga0065704_100979911 340
186 3300006058 Ga0075432_10002859 Ga0075432_1000285910 340
187 3300009036 Ga0105244_10001452 Ga0105244_1000145214 340
188 3300013102 Ga0157371_10073958 Ga0157371_100739581 340
189 3300015261 Ga0182006_1035670 Ga0182006_10356702 340
190 3300017792 Ga0163161_10236816 Ga0163161_102368162 340
191 3300025711 Ga0207696_1000022 Ga0207696_1000022270 340
192 3300025728 Ga0207655_1016316 Ga0207655_10163162 340
193 3300025735 Ga0207713_1015296 Ga0207713_10152964 340
194 3300025935 Ga0207709_10138494 Ga0207709_101384942 340
195 3300025935 Ga0207709_10224558 Ga0207709_102245581 340
196 3300027907 Ga0207428_10012406 Ga0207428_100124062 340
197 3300030500 Ga0268256_1004780 Ga0268256_10047802 340
198 3300031727 Ga0316576_10011203 Ga0316576_100112033 340
199 3300031728 Ga0316578_10031899 Ga0316578_100318993 340
200 3300041404 Ga0439436_0000180 Ga0439436_0000180_7629_8657 340
201 3300041405 Ga0439438_001642 Ga0439438_001642_2135_3163 340
202 3300041407 Ga0439447_001931 Ga0439447_001931_2051_3079 340
203 3300041411 Ga0439466_0001268 Ga0439466_0001268_6907_7935 340
204 3300042006 Ga0439432_007188 Ga0439432_007188_1469_2497 340
205 3300042010 Ga0439452_003711 Ga0439452_003711_1710_2738 340
206 3300042156 Ga0439446_0003257 Ga0439446_0003257_1242_2270 340
207 3300046507 Ga0495606_0004391 Ga0495606_0004391_1344_2372 340
208 3300046522 Ga0495643_0000689 Ga0495643_0000689_2560_3588 340
209 3300046692 Ga0495671_0001019 Ga0495671_0001019_1944_2972 340
210 3300046694 Ga0495649_0005994 Ga0495649_0005994_1116_2144 340
211 3300048908 Ga0496105_0075292 Ga0496105_0075292_1134_2156 340
212 3300048920 Ga0496117_0076909 Ga0496117_0076909_72_1100 340
213 3300048921 Ga0496118_0029925 Ga0496118_0029925_1814_2842 340
214 3300048928 Ga0496125_0011547 Ga0496125_0011547_1896_2924 340
215 3300049460 Ga0495682_0010373 Ga0495682_0010373_1888_2910 340
216 2162886007 SwRhRL2b_contig_2504277 SwRhRL2b_0150.00013710 341
217 3300001989 JGI24739J22299_10000122 JGI24739J22299_1000012218 341
218 3300002737 JGI25162J39368_1000031 JGI25162J39368_100003190 341
219 3300002737 JGI25162J39368_1004244 JGI25162J39368_10042442 341
220 3300002771 JGI25163J39215_1000033 JGI25163J39215_100003337 341
221 3300002771 JGI25163J39215_1000094 JGI25163J39215_100009422 341
222 3300002772 JGI25164J39214_1000050 JGI25164J39214_100005022 341
223 3300002773 JGI25152J39213_1000063 JGI25152J39213_10000634 341
224 3300003320 rootH2_10021021 rootH2_100210216 341
225 3300003751 Ga0055538_1000004 Ga0055538_100000490 341
226 3300003752 Ga0055539_1000004 Ga0055539_1000004467 341
227 3300003756 Ga0055533_1000007 Ga0055533_100000790 341
228 3300003759 Ga0055525_1000007 Ga0055525_100000790 341
229 3300003841 Ga0055541_1000004 Ga0055541_100000490 341
230 3300003856 Ga0058692_1002935 Ga0058692_10029356 341
231 3300003856 Ga0058692_1003207 Ga0058692_10032073 341
232 3300003856 Ga0058692_1003303 Ga0058692_10033032 341
233 3300003856 Ga0058692_1003610 Ga0058692_10036102 341
234 3300003856 Ga0058692_1003750 Ga0058692_10037501 341
235 3300003856 Ga0058692_1004489 Ga0058692_10044892 341
236 3300003856 Ga0058692_1014441 Ga0058692_10144411 341
237 3300005289 Ga0065704_10000712 Ga0065704_100007125 341
238 3300005289 Ga0065704_10001217 Ga0065704_100012178 341
239 3300005289 Ga0065704_10006679 Ga0065704_100066792 341
240 3300005289 Ga0065704_10008489 Ga0065704_100084893 341
241 3300005289 Ga0065704_10080636 Ga0065704_100806363 341
242 3300005347 Ga0070668_100141621 Ga0070668_1001416212 341
243 3300005457 Ga0070662_100002594 Ga0070662_1000025942 341
244 3300005548 Ga0070665_100005050 Ga0070665_1000050505 341
245 3300005548 Ga0070665_100049180 Ga0070665_1000491803 341
246 3300005548 Ga0070665_100051904 Ga0070665_1000519046 341
247 3300005577 Ga0068857_100000020 Ga0068857_1000000207 341
248 3300006051 Ga0075364_10010311 Ga0075364_100103113 341
249 3300006051 Ga0075364_10122784 Ga0075364_101227842 341
250 3300006051 Ga0075364_10239965 Ga0075364_102399651 341
251 3300006195 Ga0075366_10003383 Ga0075366_100033833 341
252 3300006946 Ga0079104_1000755 Ga0079104_10007554 341
253 3300006946 Ga0079104_1001722 Ga0079104_10017228 341
254 3300006946 Ga0079104_1001767 Ga0079104_10017675 341
255 3300006946 Ga0079104_1001790 Ga0079104_10017908 341
256 3300006946 Ga0079104_1001794 Ga0079104_10017948 341
257 3300006946 Ga0079104_1001938 Ga0079104_10019389 341
258 3300006946 Ga0079104_1002782 Ga0079104_10027821 341
259 3300006946 Ga0079104_1004806 Ga0079104_10048067 341
260 3300006946 Ga0079104_1004936 Ga0079104_10049363 341
261 3300009011 Ga0105251_10001844 Ga0105251_100018445 341
262 3300009011 Ga0105251_10004051 Ga0105251_100040515 341
263 3300009011 Ga0105251_10010643 Ga0105251_100106432 341
264 3300009011 Ga0105251_10023008 Ga0105251_100230082 341
265 3300009011 Ga0105251_10031969 Ga0105251_100319691 341
266 3300009011 Ga0105251_10037639 Ga0105251_100376392 341
267 3300009011 Ga0105251_10058655 Ga0105251_100586552 341
268 3300009036 Ga0105244_10000101 Ga0105244_1000010174 341
269 3300009036 Ga0105244_10002633 Ga0105244_100026338 341
270 3300009036 Ga0105244_10002708 Ga0105244_100027088 341
271 3300009036 Ga0105244_10007403 Ga0105244_100074034 341
272 3300009036 Ga0105244_10008485 Ga0105244_100084854 341
273 3300009036 Ga0105244_10011458 Ga0105244_100114585 341
274 3300009036 Ga0105244_10013065 Ga0105244_100130651 341
275 3300009036 Ga0105244_10040810 Ga0105244_100408102 341
276 3300009036 Ga0105244_10058267 Ga0105244_100582672 341
277 3300009036 Ga0105244_10065604 Ga0105244_100656042 341
278 3300009036 Ga0105244_10112381 Ga0105244_101123811 341
279 3300009036 Ga0105244_10116090 Ga0105244_101160902 341
280 3300009036 Ga0105244_10128384 Ga0105244_101283841 341
281 3300009092 Ga0105250_10000084 Ga0105250_1000008477 341
282 3300009092 Ga0105250_10001532 Ga0105250_100015328 341
283 3300009092 Ga0105250_10003323 Ga0105250_100033236 341
284 3300009092 Ga0105250_10004860 Ga0105250_100048604 341
285 3300009092 Ga0105250_10006056 Ga0105250_100060564 341
286 3300009092 Ga0105250_10006982 Ga0105250_100069825 341
287 3300009092 Ga0105250_10037239 Ga0105250_100372392 341
288 3300009092 Ga0105250_10062334 Ga0105250_100623342 341
289 3300009093 Ga0105240_10063612 Ga0105240_100636122 341
290 3300009148 Ga0105243_10031693 Ga0105243_100316933 341
291 3300009545 Ga0105237_10140258 Ga0105237_101402582 341
292 3300010375 Ga0105239_10286733 Ga0105239_102867332 341
293 3300011119 Ga0105246_10121407 Ga0105246_101214072 341
294 3300011119 Ga0105246_10317849 Ga0105246_103178491 341
295 3300013100 Ga0157373_10005354 Ga0157373_100053549 341
296 3300013100 Ga0157373_10016831 Ga0157373_100168315 341
297 3300013100 Ga0157373_10038319 Ga0157373_100383193 341
298 3300013100 Ga0157373_10132536 Ga0157373_101325361 341
299 3300013102 Ga0157371_10000272 Ga0157371_1000027236 341
300 3300013102 Ga0157371_10001735 Ga0157371_100017355 341
301 3300013102 Ga0157371_10003873 Ga0157371_100038735 341
302 3300013102 Ga0157371_10005679 Ga0157371_100056797 341
303 3300013102 Ga0157371_10061398 Ga0157371_100613982 341
304 3300013102 Ga0157371_10110366 Ga0157371_101103662 341
305 3300013104 Ga0157370_10013232 Ga0157370_100132326 341
306 3300013104 Ga0157370_10030456 Ga0157370_100304565 341
307 3300013104 Ga0157370_10064439 Ga0157370_100644392 341
308 3300013105 Ga0157369_10025611 Ga0157369_100256113 341
309 3300013105 Ga0157369_10227221 Ga0157369_102272212 341
310 3300013306 Ga0163162_10005165 Ga0163162_100051651 341
311 3300013306 Ga0163162_10158256 Ga0163162_101582562 341
312 3300013307 Ga0157372_10000395 Ga0157372_1000039540 341
313 3300013307 Ga0157372_10051355 Ga0157372_100513551 341
314 3300013307 Ga0157372_10052396 Ga0157372_100523964 341
315 3300013307 Ga0157372_10062648 Ga0157372_100626483 341
316 3300013307 Ga0157372_10064133 Ga0157372_100641332 341
317 3300013307 Ga0157372_10276530 Ga0157372_102765302 341
318 3300013307 Ga0157372_10277097 Ga0157372_102770972 341
319 3300014497 Ga0182008_10007205 Ga0182008_100072056 341
320 3300015261 Ga0182006_1000145 Ga0182006_100014561 341
321 3300015261 Ga0182006_1000500 Ga0182006_10005003 341
322 3300015262 Ga0182007_10027497 Ga0182007_100274971 341
323 3300015679 Ga0183366_1002 Ga0183366_1002791 341
324 3300015680 Ga0183370_1002 Ga0183370_1002791 341
325 3300015685 Ga0183369_1002 Ga0183369_1002791 341
326 3300015687 Ga0183368_1005 Ga0183368_1005791 341
327 3300017792 Ga0163161_10017911 Ga0163161_100179112 341
328 3300017792 Ga0163161_10034192 Ga0163161_100341922 341
329 3300021384 Ga0213876_10002849 Ga0213876_100028497 341
330 3300025207 Ga0209760_100006 Ga0209760_100006194 341
331 3300025224 Ga0209784_100001 Ga0209784_10000189 341
332 3300025225 Ga0209566_100001 Ga0209566_10000189 341
333 3300025226 Ga0209674_100002 Ga0209674_10000289 341
334 3300025230 Ga0209563_100008 Ga0209563_10000890 341
335 3300025231 Ga0207427_100002 Ga0207427_1000021190 341
336 3300025233 Ga0209437_100114 Ga0209437_100114110 341
337 3300025233 Ga0209437_100218 Ga0209437_1002185 341
338 3300025245 Ga0207425_1003138 Ga0207425_10031383 341
339 3300025253 Ga0209677_100004 Ga0209677_10000490 341
340 3300025258 Ga0209129_1000010 Ga0209129_10000107 341
341 3300025321 Ga0207656_10039310 Ga0207656_100393102 341
342 3300025711 Ga0207696_1000048 Ga0207696_1000048267 341
343 3300025711 Ga0207696_1000222 Ga0207696_100022276 341
344 3300025711 Ga0207696_1000244 Ga0207696_100024469 341
345 3300025711 Ga0207696_1000268 Ga0207696_10002686 341
346 3300025711 Ga0207696_1000639 Ga0207696_10006394 341
347 3300025711 Ga0207696_1001519 Ga0207696_10015196 341
348 3300025711 Ga0207696_1002610 Ga0207696_10026105 341
349 3300025711 Ga0207696_1004084 Ga0207696_10040847 341
350 3300025711 Ga0207696_1006218 Ga0207696_10062182 341
351 3300025711 Ga0207696_1023257 Ga0207696_10232572 341
352 3300025728 Ga0207655_1000065 Ga0207655_10000655 341
353 3300025728 Ga0207655_1000186 Ga0207655_1000186105 341
354 3300025728 Ga0207655_1000209 Ga0207655_10002097 341
355 3300025728 Ga0207655_1000244 Ga0207655_10002445 341
356 3300025728 Ga0207655_1000422 Ga0207655_100042251 341
357 3300025728 Ga0207655_1000459 Ga0207655_10004595 341
358 3300025728 Ga0207655_1002142 Ga0207655_100214215 341
359 3300025728 Ga0207655_1002895 Ga0207655_10028958 341
360 3300025728 Ga0207655_1005615 Ga0207655_10056155 341
361 3300025728 Ga0207655_1010706 Ga0207655_10107064 341
362 3300025728 Ga0207655_1011393 Ga0207655_10113932 341
363 3300025728 Ga0207655_1013232 Ga0207655_10132326 341
364 3300025728 Ga0207655_1044277 Ga0207655_10442772 341
365 3300025735 Ga0207713_1000145 Ga0207713_10001459 341
366 3300025735 Ga0207713_1001612 Ga0207713_10016123 341
367 3300025735 Ga0207713_1012280 Ga0207713_10122803 341
368 3300025735 Ga0207713_1014838 Ga0207713_10148381 341
369 3300025735 Ga0207713_1024673 Ga0207713_10246732 341
370 3300025735 Ga0207713_1027303 Ga0207713_10273032 341
371 3300025735 Ga0207713_1048366 Ga0207713_10483662 341
372 3300025735 Ga0207713_1064366 Ga0207713_10643661 341
373 3300025735 Ga0207713_1082091 Ga0207713_10820911 341
374 3300025914 Ga0207671_10116318 Ga0207671_101163182 341
375 3300025933 Ga0207706_10021464 Ga0207706_100214642 341
376 3300026116 Ga0207674_10000119 Ga0207674_100001195 341
377 3300027111 Ga0209281_1000025 Ga0209281_10000255 341
378 3300027111 Ga0209281_1000279 Ga0209281_100027992 341
379 3300027111 Ga0209281_1000281 Ga0209281_10002815 341
380 3300027111 Ga0209281_1000328 Ga0209281_10003287 341
381 3300027111 Ga0209281_1000511 Ga0209281_100051142 341
382 3300027111 Ga0209281_1000828 Ga0209281_10008284 341
383 3300027111 Ga0209281_1001482 Ga0209281_10014828 341
384 3300027111 Ga0209281_1001496 Ga0209281_10014968 341
385 3300027111 Ga0209281_1001499 Ga0209281_10014998 341
386 3300027111 Ga0209281_1003401 Ga0209281_10034014 341
387 3300027312 Ga0209371_1000013 Ga0209371_1000013671 341
388 3300027312 Ga0209371_1000019 Ga0209371_1000019536 341
389 3300027312 Ga0209371_1000248 Ga0209371_100024860 341
390 3300027312 Ga0209371_1000797 Ga0209371_100079722 341
391 3300027312 Ga0209371_1001520 Ga0209371_100152014 341
392 3300027312 Ga0209371_1001655 Ga0209371_10016557 341
393 3300027312 Ga0209371_1001795 Ga0209371_10017958 341
394 3300027312 Ga0209371_1002900 Ga0209371_10029004 341
395 3300027312 Ga0209371_1003193 Ga0209371_10031933 341
396 3300027312 Ga0209371_1003650 Ga0209371_10036507 341
397 3300027312 Ga0209371_1004287 Ga0209371_10042873 341
398 3300027312 Ga0209371_1005172 Ga0209371_10051725 341
399 3300027312 Ga0209371_1005250 Ga0209371_10052505 341
400 3300027312 Ga0209371_1005289 Ga0209371_10052893 341
401 3300027312 Ga0209371_1006731 Ga0209371_10067313 341
402 3300027312 Ga0209371_1017432 Ga0209371_10174322 341
403 3300028379 Ga0268266_10003971 Ga0268266_100039718 341
404 3300030500 Ga0268256_1000014 Ga0268256_10000147 341
405 3300030500 Ga0268256_1000088 Ga0268256_10000886 341
406 3300030500 Ga0268256_1001303 Ga0268256_100130314 341
407 3300030500 Ga0268256_1001565 Ga0268256_10015655 341
408 3300030500 Ga0268256_1002056 Ga0268256_10020567 341
409 3300030500 Ga0268256_1002700 Ga0268256_10027005 341
410 3300030500 Ga0268256_1003653 Ga0268256_10036537 341
411 3300030500 Ga0268256_1005219 Ga0268256_10052193 341
412 3300030500 Ga0268256_1006116 Ga0268256_10061162 341
413 3300030500 Ga0268256_1006229 Ga0268256_10062293 341
414 3300030500 Ga0268256_1006920 Ga0268256_10069203 341
415 3300030500 Ga0268256_1008548 Ga0268256_10085484 341
416 3300030500 Ga0268256_1019432 Ga0268256_10194322 341
417 3300030500 Ga0268256_1038993 Ga0268256_10389931 341
418 3300038725 Ga0400484_11573 Ga0400484_11573_3179_4222 341
419 3300039437 Ga0436365_0471682 Ga0436365_0471682_4106_5131 341
420 3300041405 Ga0439438_000003 Ga0439438_000003_459796_460821 341
421 3300041405 Ga0439438_003447 Ga0439438_003447_4322_5347 341
422 3300041405 Ga0439438_004532 Ga0439438_004532_658_1683 341
423 3300041405 Ga0439438_008013 Ga0439438_008013_2190_3215 341
424 3300041407 Ga0439447_003628 Ga0439447_003628_141_1166 341
425 3300041407 Ga0439447_023275 Ga0439447_023275_419_1444 341
426 3300041411 Ga0439466_0000004 Ga0439466_0000004_457937_458962 341
427 3300041512 Ga0451853_3873808 Ga0451853_3873808_2149_3312 341
428 3300042006 Ga0439432_002693 Ga0439432_002693_4455_5609 341
429 3300042006 Ga0439432_004662 Ga0439432_004662_2869_3894 341
430 3300042006 Ga0439432_043694 Ga0439432_043694_170_1195 341
431 3300042010 Ga0439452_000009 Ga0439452_000009_564582_565607 341
432 3300042010 Ga0439452_000011 Ga0439452_000011_3617_4642 341
433 3300042010 Ga0439452_000078 Ga0439452_000078_3898_4923 341
434 3300042010 Ga0439452_000584 Ga0439452_000584_3361_4524 341
435 3300042010 Ga0439452_000897 Ga0439452_000897_9137_10162 341
436 3300042013 Ga0439456_001970 Ga0439456_001970_1739_2764 341
437 3300042016 Ga0439463_003991 Ga0439463_003991_2471_3496 341
438 3300042146 Ga0450907_001020 Ga0450907_001020_2012_3037 341
439 3300042439 Ga0439464_0000239 Ga0439464_0000239_150_1313 341
440 3300042439 Ga0439464_0000303 Ga0439464_0000303_337_1362 341
441 3300044669 Ga0466981_0000151 Ga0466981_0000151_3602_4627 341
442 3300046458 Ga0495591_000004 Ga0495591_000004_405326_406351 341
443 3300046458 Ga0495591_001433 Ga0495591_001433_3420_4445 341
444 3300046458 Ga0495591_001707 Ga0495591_001707_8687_9712 341
445 3300046458 Ga0495591_026849 Ga0495591_026849_376_1401 341
446 3300046460 Ga0495638_0020994 Ga0495638_0020994_2705_3730 341
447 3300046471 Ga0495650_0000004 Ga0495650_0000004_98355_99380 341
448 3300046471 Ga0495650_0000008 Ga0495650_0000008_3540_4565 341
449 3300046471 Ga0495650_0000040 Ga0495650_0000040_3600_4763 341
450 3300046471 Ga0495650_0025064 Ga0495650_0025064_55_1080 341
451 3300046474 Ga0495605_0041756 Ga0495605_0041756_1116_2141 341
452 3300046491 Ga0495584_0004114 Ga0495584_0004114_3365_4390 341
453 3300046492 Ga0495585_0021464 Ga0495585_0021464_1344_2369 341
454 3300046501 Ga0495607_0006268 Ga0495607_0006268_4208_5233 341
455 3300046507 Ga0495606_0000399 Ga0495606_0000399_3434_4459 341
456 3300046515 Ga0495620_0002175 Ga0495620_0002175_3327_4352 341
457 3300046518 Ga0495631_0014300 Ga0495631_0014300_736_1761 341
458 3300046523 Ga0495644_0006296 Ga0495644_0006296_3239_4264 341
459 3300046524 Ga0495648_0010014 Ga0495648_0010014_2715_3740 341
460 3300046524 Ga0495648_0017969 Ga0495648_0017969_3528_4553 341
461 3300046530 Ga0495654_0000086 Ga0495654_0000086_3415_4440 341
462 3300046530 Ga0495654_0000089 Ga0495654_0000089_98150_99175 341
463 3300046542 Ga0495597_0002225 Ga0495597_0002225_3320_4345 341
464 3300046616 Ga0495668_0070947 Ga0495668_0070947_788_1813 341
465 3300046660 Ga0495625_0013860 Ga0495625_0013860_3380_4405 341
466 3300046692 Ga0495671_0000922 Ga0495671_0000922_1391_2416 341
467 3300046694 Ga0495649_0002507 Ga0495649_0002507_8598_9623 341
468 3300046694 Ga0495649_0002508 Ga0495649_0002508_8598_9623 341
469 3300046694 Ga0495649_0012491 Ga0495649_0012491_3623_4648 341
470 3300046794 Ga0495589_0024590 Ga0495589_0024590_315_1340 341
471 3300046810 Ga0495660_0000022 Ga0495660_0000022_98611_99636 341
472 3300046810 Ga0495660_0000650 Ga0495660_0000650_22479_23504 341
473 3300046810 Ga0495660_0023385 Ga0495660_0023385_344_1369 341
474 3300047320 Ga0495672_0000003 Ga0495672_0000003_724206_725231 341
475 3300047320 Ga0495672_0000082 Ga0495672_0000082_3333_4358 341
476 3300047320 Ga0495672_0000149 Ga0495672_0000149_3432_4457 341
477 3300047323 Ga0495683_0031883 Ga0495683_0031883_1432_2457 341
478 3300047446 Ga0495679_000059 Ga0495679_000059_3355_4380 341
479 3300047446 Ga0495679_001465 Ga0495679_001465_8802_9827 341
480 3300047446 Ga0495679_008423 Ga0495679_008423_1557_2582 341
481 3300047446 Ga0495679_038823 Ga0495679_038823_175_1200 341
482 3300047469 Ga0495673_0000011 Ga0495673_0000011_3804_4829 341
483 3300047469 Ga0495673_0000117 Ga0495673_0000117_3598_4623 341
484 3300047470 Ga0495681_0040834 Ga0495681_0040834_292_1317 341
485 3300048903 Ga0496100_0016990 Ga0496100_0016990_146_1171 341
486 3300048903 Ga0496100_0019089 Ga0496100_0019089_466_1491 341
487 3300048904 Ga0496101_0002189 Ga0496101_0002189_3650_4675 341
488 3300048905 Ga0496102_0047391 Ga0496102_0047391_653_1678 341
489 3300048905 Ga0496102_0451169 Ga0496102_0451169_111_1136 341
490 3300048907 Ga0496104_0005301 Ga0496104_0005301_634_1659 341
491 3300048907 Ga0496104_0012074 Ga0496104_0012074_5737_6762 341
492 3300048907 Ga0496104_0026078 Ga0496104_0026078_764_1789 341
493 3300048908 Ga0496105_0001151 Ga0496105_0001151_16211_17236 341
494 3300048908 Ga0496105_0051538 Ga0496105_0051538_1699_2724 341
495 3300048919 Ga0496116_0000188 Ga0496116_0000188_98604_99629 341
496 3300048919 Ga0496116_0000671 Ga0496116_0000671_40152_41177 341
497 3300048919 Ga0496116_0004703 Ga0496116_0004703_8522_9547 341
498 3300048919 Ga0496116_0004976 Ga0496116_0004976_7968_8993 341
499 3300048919 Ga0496116_0018167 Ga0496116_0018167_803_1828 341
500 3300048919 Ga0496116_0023269 Ga0496116_0023269_235_1260 341
501 3300048919 Ga0496116_0035325 Ga0496116_0035325_2164_3189 341
502 3300048919 Ga0496116_0076267 Ga0496116_0076267_289_1314 341
503 3300048919 Ga0496116_0126047 Ga0496116_0126047_220_1245 341
504 3300048920 Ga0496117_0000234 Ga0496117_0000234_4002_5027 341
505 3300048920 Ga0496117_0000548 Ga0496117_0000548_59580_60605 341
506 3300048920 Ga0496117_0002142 Ga0496117_0002142_3080_4243 341
507 3300048920 Ga0496117_0005415 Ga0496117_0005415_3385_4416 341
508 3300048920 Ga0496117_0007842 Ga0496117_0007842_3757_4782 341
509 3300048920 Ga0496117_0018692 Ga0496117_0018692_3884_4909 341
510 3300048920 Ga0496117_0020804 Ga0496117_0020804_1176_2201 341
511 3300048920 Ga0496117_0032318 Ga0496117_0032318_1276_2301 341
512 3300048920 Ga0496117_0075381 Ga0496117_0075381_853_1878 341
513 3300048920 Ga0496117_0102782 Ga0496117_0102782_28_1053 341
514 3300048921 Ga0496118_0000203 Ga0496118_0000203_3644_4669 341
515 3300048921 Ga0496118_0004116 Ga0496118_0004116_3433_4458 341
516 3300048921 Ga0496118_0004900 Ga0496118_0004900_10799_11962 341
517 3300048921 Ga0496118_0009366 Ga0496118_0009366_5615_6640 341
518 3300048921 Ga0496118_0013985 Ga0496118_0013985_3375_4400 341
519 3300048921 Ga0496118_0017350 Ga0496118_0017350_2779_3804 341
520 3300048921 Ga0496118_0019393 Ga0496118_0019393_585_1610 341
521 3300048921 Ga0496118_0026634 Ga0496118_0026634_3603_4628 341
522 3300048921 Ga0496118_0051356 Ga0496118_0051356_1072_2097 341
523 3300048922 Ga0496119_0000096 Ga0496119_0000096_3375_4400 341
524 3300048922 Ga0496119_0001129 Ga0496119_0001129_7336_8361 341
525 3300048922 Ga0496119_0001384 Ga0496119_0001384_3601_4626 341
526 3300048922 Ga0496119_0004961 Ga0496119_0004961_2932_3957 341
527 3300048922 Ga0496119_0007717 Ga0496119_0007717_6412_7437 341
528 3300048922 Ga0496119_0008420 Ga0496119_0008420_7531_8556 341
529 3300048922 Ga0496119_0011497 Ga0496119_0011497_3372_4397 341
530 3300048922 Ga0496119_0013399 Ga0496119_0013399_1880_2905 341
531 3300048922 Ga0496119_0018337 Ga0496119_0018337_3442_4467 341
532 3300048922 Ga0496119_0021724 Ga0496119_0021724_2837_3862 341
533 3300048922 Ga0496119_0035323 Ga0496119_0035323_1957_2982 341
534 3300048922 Ga0496119_0042187 Ga0496119_0042187_746_1771 341
535 3300048923 Ga0496120_0000440 Ga0496120_0000440_61210_62235 341
536 3300048923 Ga0496120_0001179 Ga0496120_0001179_6078_7103 341
537 3300048923 Ga0496120_0003008 Ga0496120_0003008_3433_4458 341
538 3300048923 Ga0496120_0003970 Ga0496120_0003970_8489_9514 341
539 3300048923 Ga0496120_0004823 Ga0496120_0004823_6412_7437 341
540 3300048923 Ga0496120_0005481 Ga0496120_0005481_9051_10076 341
541 3300048923 Ga0496120_0007695 Ga0496120_0007695_3369_4394 341
542 3300048923 Ga0496120_0008628 Ga0496120_0008628_3407_4432 341
543 3300048923 Ga0496120_0008691 Ga0496120_0008691_3372_4397 341
544 3300048923 Ga0496120_0010842 Ga0496120_0010842_3412_4437 341
545 3300048923 Ga0496120_0013586 Ga0496120_0013586_751_1776 341
546 3300048924 Ga0496121_0001930 Ga0496121_0001930_28735_29760 341
547 3300048924 Ga0496121_0003401 Ga0496121_0003401_3693_4718 341
548 3300048924 Ga0496121_0006781 Ga0496121_0006781_3385_4416 341
549 3300048924 Ga0496121_0007334 Ga0496121_0007334_9007_10032 341
550 3300048924 Ga0496121_0010039 Ga0496121_0010039_7166_8329 341
551 3300048924 Ga0496121_0010148 Ga0496121_0010148_1779_2804 341
552 3300048924 Ga0496121_0010605 Ga0496121_0010605_7850_8875 341
553 3300048925 Ga0496122_0000070 Ga0496122_0000070_39838_40863 341
554 3300048925 Ga0496122_0003732 Ga0496122_0003732_3358_4383 341
555 3300048925 Ga0496122_0006839 Ga0496122_0006839_3651_4676 341
556 3300048925 Ga0496122_0008770 Ga0496122_0008770_6302_7465 341
557 3300048925 Ga0496122_0012428 Ga0496122_0012428_3815_4840 341
558 3300048925 Ga0496122_0031053 Ga0496122_0031053_2313_3338 341
559 3300048925 Ga0496122_0032303 Ga0496122_0032303_3261_4286 341
560 3300048925 Ga0496122_0036313 Ga0496122_0036313_1027_2052 341
561 3300048925 Ga0496122_0045585 Ga0496122_0045585_326_1351 341
562 3300048925 Ga0496122_0099523 Ga0496122_0099523_753_1778 341
563 3300048925 Ga0496122_0120564 Ga0496122_0120564_310_1335 341
564 3300048926 Ga0496123_0000183 Ga0496123_0000183_96536_97561 341
565 3300048926 Ga0496123_0000565 Ga0496123_0000565_3584_4609 341
566 3300048926 Ga0496123_0001751 Ga0496123_0001751_3358_4383 341
567 3300048926 Ga0496123_0006949 Ga0496123_0006949_6302_7465 341
568 3300048926 Ga0496123_0009615 Ga0496123_0009615_3614_4639 341
569 3300048926 Ga0496123_0010096 Ga0496123_0010096_3977_5002 341
570 3300048926 Ga0496123_0010858 Ga0496123_0010858_4643_5668 341
571 3300048926 Ga0496123_0019109 Ga0496123_0019109_3458_4483 341
572 3300048926 Ga0496123_0020522 Ga0496123_0020522_3953_4978 341
573 3300048926 Ga0496123_0041848 Ga0496123_0041848_1015_2040 341
574 3300048927 Ga0496124_0000169 Ga0496124_0000169_98370_99395 341
575 3300048927 Ga0496124_0001191 Ga0496124_0001191_35946_36971 341
576 3300048927 Ga0496124_0002649 Ga0496124_0002649_337_1362 341
577 3300048927 Ga0496124_0003583 Ga0496124_0003583_14242_15396 341
578 3300048927 Ga0496124_0005663 Ga0496124_0005663_9292_10317 341
579 3300048927 Ga0496124_0026751 Ga0496124_0026751_2671_3696 341
580 3300048927 Ga0496124_0027384 Ga0496124_0027384_618_1643 341
581 3300048927 Ga0496124_0027908 Ga0496124_0027908_616_1641 341
582 3300048927 Ga0496124_0030343 Ga0496124_0030343_173_1198 341
583 3300048927 Ga0496124_0121693 Ga0496124_0121693_1021_2046 341
584 3300048927 Ga0496124_0132055 Ga0496124_0132055_322_1347 341
585 3300048927 Ga0496124_0168991 Ga0496124_0168991_565_1590 341
586 3300048927 Ga0496124_0267263 Ga0496124_0267263_165_1190 341
587 3300048928 Ga0496125_0000056 Ga0496125_0000056_171384_172409 341
588 3300048928 Ga0496125_0000329 Ga0496125_0000329_87174_88199 341
589 3300048928 Ga0496125_0005963 Ga0496125_0005963_9007_10032 341
590 3300048928 Ga0496125_0007885 Ga0496125_0007885_2385_3410 341
591 3300048928 Ga0496125_0011646 Ga0496125_0011646_6612_7637 341
592 3300048928 Ga0496125_0021273 Ga0496125_0021273_4583_5608 341
593 3300048928 Ga0496125_0025899 Ga0496125_0025899_1146_2171 341
594 3300048929 Ga0496126_0000137 Ga0496126_0000137_162990_164015 341
595 3300048929 Ga0496126_0004504 Ga0496126_0004504_3765_4790 341
596 3300048929 Ga0496126_0005462 Ga0496126_0005462_12332_13357 341
597 3300048929 Ga0496126_0043271 Ga0496126_0043271_423_1448 341
598 3300048929 Ga0496126_0295414 Ga0496126_0295414_47_1072 341
599 3300049459 Ga0495678_003061 Ga0495678_003061_3407_4432 341
600 3300049460 Ga0495682_0000034 Ga0495682_0000034_127208_128233 341
601 3300050491 nmdc:mga00v17_170485_c1 nmdc:mga00v17_170485_c1_77_1102 341
602 3300050491 nmdc:mga00v17_2337_c1 nmdc:mga00v17_2337_c1_4898_5923 341
603 3300050493 nmdc:mga0k408_894_c2 nmdc:mga0k408_894_c2_1500_2525 341
604 3300053126 Ga0500621_000010 Ga0500621_000010_165042_166067 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

83

307

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.9846 27 341
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.9663 27 341
6q3u-assembly1.cif.gz_A gly52ala mutant of arginine-bound argbp from t. maritima 0.9201 28 245
4psh-assembly1.cif.gz_B structure of holo argbp from t. maritima 0.9159 29 244
6ggv-assembly1.cif.gz_A structure of the arginine-bound form of truncated (residues 20-233) argbp from t. maritima 0.911 29 246
ID Description Score Start End Superfamily
2v25B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9551 27 113 3.40.190.10
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9387 124 225 3.40.190.10
2yjpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9278 26 126 3.40.190.10
5eyfA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9177 28 113 3.40.190.10
2ia4B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9161 129 223 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7G2KH48-F1-model_v4 deleted 1 132 317
AF-A0A2T9UUK1-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9982 98 238 GO:0006865
AF-F2IXB3-F1-model_v4 Amino acid ABC transporter, periplasmic amino acid-binding protein 0.9963 42 341 GO:0006865
AF-A0A4Q8QMC4-F1-model_v4 Amino acid ABC transporter substrate-bindnig protein 0.9927 30 341 GO:0006865
AF-A0A1W9X180-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9917 75 341 GO:0006865

Feature Viewer

pLDDT pTM Quality
91.42 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map