F468359

General Info

Members Datasets Scaffolds Average Seq Length
604 238 1208 71

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_101673631|Ga0068852_1016736312
Length 78
Sequence VRSIFLSMANKPDQDENRKTGFAYAAGITLFASVATFCALGWFLDKWLGTEPWCLIGGIVLGSAAGLFEFVRLSSKTY

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
199 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
200 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
201 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
202 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
203 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
204 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
207 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
208 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
209 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
210 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
211 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
212 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
213 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
223 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
224 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
225 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
226 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
227 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
228 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
229 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.8
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 42.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_101673631 3300005616 Unclassified 659
2 SwRhRL3b_contig_1266107 2162886006 Unclassified 963
3 CNBas_1002431 3300000531 Bacteria 1027
4 CNAas_1000665 3300000532 Bacteria 3291
5 JGI25406J46586_10048117 3300003203 Unclassified 1448
6 Ga0065714_10064454 3300005288 Bacteria 72991
7 Ga0065704_10076020 3300005289 Bacteria 5303
8 Ga0065704_10114080 3300005289 Bacteria 1899
9 Ga0065712_10000129 3300005290 Bacteria 72972
10 Ga0065715_10015972 3300005293 Bacteria 1845
11 Ga0065715_10023290 3300005293 Bacteria 1321
12 Ga0065715_10108203 3300005293 Unclassified 2726
13 Ga0065715_10125346 3300005293 Unclassified 2133
14 Ga0065715_10153838 3300005293 Bacteria 1699
15 Ga0065715_10194224 3300005293 Bacteria 1397
16 Ga0065715_10196506 3300005293 Bacteria 1385
17 Ga0065715_10360215 3300005293 Unclassified 937
18 Ga0065715_10750726 3300005293 Unclassified 630
19 Ga0065707_10002257 3300005295 Bacteria 9187
20 Ga0070676_10521013 3300005328 Unclassified 847
21 Ga0070676_11259206 3300005328 Unclassified 564
22 Ga0070683_100831744 3300005329 Unclassified 885
23 Ga0070690_100272576 3300005330 Unclassified 1204
24 Ga0070690_101696047 3300005330 Unclassified 514
25 Ga0070670_100027974 3300005331 Bacteria 4852
26 Ga0070670_100097718 3300005331 Bacteria 2526
27 Ga0070670_101528586 3300005331 Unclassified 613
28 Ga0070677_10521353 3300005333 Unclassified 647
29 Ga0068869_100283652 3300005334 Bacteria 1332
30 Ga0070666_10455785 3300005335 Bacteria 924
31 Ga0070666_10795811 3300005335 Unclassified 696
32 Ga0070680_100005606 3300005336 Bacteria 9508
33 Ga0070680_100056565 3300005336 Bacteria 3206
34 Ga0070682_100018107 3300005337 Bacteria 4112
35 Ga0070682_100039090 3300005337 Unclassified 2913
36 Ga0070682_101260181 3300005337 Unclassified 626
37 Ga0068868_100689722 3300005338 Bacteria 913
38 Ga0070660_100031027 3300005339 Unclassified 4012
39 Ga0070660_100600319 3300005339 Unclassified 920
40 Ga0070660_101935515 3300005339 Unclassified 503
41 Ga0070689_100350136 3300005340 Unclassified 1239
42 Ga0070691_10207597 3300005341 Bacteria 1032
43 Ga0070687_100907921 3300005343 Bacteria 632
44 Ga0070687_101100441 3300005343 Unclassified 581
45 Ga0070687_101182902 3300005343 Bacteria 563
46 Ga0070661_100231987 3300005344 Unclassified 1419
47 Ga0070661_100251454 3300005344 Unclassified 1364
48 Ga0070692_10017150 3300005345 Bacteria 3457
49 Ga0070692_10028073 3300005345 Unclassified 2795
50 Ga0070669_100776431 3300005353 Unclassified 813
51 Ga0070669_102003673 3300005353 Bacteria 506
52 Ga0070673_100174000 3300005364 Bacteria 1839
53 Ga0070673_100305249 3300005364 Bacteria 1402
54 Ga0070673_101185815 3300005364 Bacteria 715
55 Ga0070673_101359626 3300005364 Unclassified 668
56 Ga0070688_100875721 3300005365 Unclassified 707
57 Ga0070659_100002273 3300005366 Bacteria 13683
58 Ga0070667_100159688 3300005367 Bacteria 1985
59 Ga0070703_10006463 3300005406 Unclassified 3286
60 Ga0070705_100006565 3300005440 Bacteria 5712
61 Ga0070705_100235989 3300005440 Unclassified 1275
62 Ga0070705_101043053 3300005440 Unclassified 666
63 Ga0070705_101379140 3300005440 Unclassified 587
64 Ga0070700_100006434 3300005441 Bacteria 6283
65 Ga0070700_100031495 3300005441 Unclassified 3179
66 Ga0070700_100044794 3300005441 Bacteria 2727
67 Ga0070700_100047449 3300005441 Unclassified 2658
68 Ga0070700_100282623 3300005441 Bacteria 1204
69 Ga0070694_100011628 3300005444 Bacteria 5449
70 Ga0070694_100016906 3300005444 Unclassified 4600
71 Ga0070694_100072060 3300005444 Bacteria 2383
72 Ga0070694_100121504 3300005444 Unclassified 1875
73 Ga0070694_100293408 3300005444 Unclassified 1244
74 Ga0070694_100627915 3300005444 Unclassified 868
75 Ga0070694_100969626 3300005444 Unclassified 705
76 Ga0070708_100831210 3300005445 Bacteria 868
77 Ga0070708_102003663 3300005445 Unclassified 536
78 Ga0070678_100069303 3300005456 Bacteria 2633
79 Ga0070678_100322204 3300005456 Unclassified 1320
80 Ga0070678_100509247 3300005456 Bacteria 1063
81 Ga0070662_100070622 3300005457 Unclassified 2573
82 Ga0070662_100161910 3300005457 Bacteria 1751
83 Ga0070662_100211002 3300005457 Unclassified 1545
84 Ga0070681_10000362 3300005458 Bacteria 36657
85 Ga0070681_10015191 3300005458 Bacteria 7658
86 Ga0070681_12039996 3300005458 Bacteria 502
87 Ga0068867_100158240 3300005459 Bacteria 1785
88 Ga0068867_100228540 3300005459 Unclassified 1503
89 Ga0068867_101171318 3300005459 Bacteria 705
90 Ga0070707_100028094 3300005468 Bacteria 5352
91 Ga0070707_101755855 3300005468 Unclassified 588
92 Ga0070707_102083631 3300005468 Unclassified 535
93 Ga0070698_100034683 3300005471 Bacteria 5221
94 Ga0070699_100002843 3300005518 Bacteria 15446
95 Ga0070699_100009653 3300005518 Bacteria 8354
96 Ga0070699_101536367 3300005518 Bacteria 610
97 Ga0070679_100000540 3300005530 Bacteria 32202
98 Ga0070679_100030221 3300005530 Bacteria 5348
99 Ga0070679_101005384 3300005530 Unclassified 778
100 Ga0070684_100919328 3300005535 Unclassified 820
101 Ga0070684_101982354 3300005535 Unclassified 549
102 Ga0070697_100035763 3300005536 Bacteria 4009
103 Ga0070697_100489326 3300005536 Bacteria 1075
104 Ga0070697_101890599 3300005536 Unclassified 534
105 Ga0068853_100055988 3300005539 Unclassified 3399
106 Ga0068853_100486244 3300005539 Unclassified 1164
107 Ga0068853_101842483 3300005539 Unclassified 587
108 Ga0068853_102061365 3300005539 Bacteria 553
109 Ga0070672_100066259 3300005543 Bacteria 2859
110 Ga0070695_100074589 3300005545 Unclassified 2230
111 Ga0070695_100087375 3300005545 Bacteria 2074
112 Ga0070695_100098614 3300005545 Unclassified 1964
113 Ga0070695_100103388 3300005545 Bacteria 1922
114 Ga0070695_100468587 3300005545 Unclassified 968
115 Ga0070695_101063804 3300005545 Bacteria 661
116 Ga0070696_100204892 3300005546 Bacteria 1474
117 Ga0070696_100341009 3300005546 Bacteria 1158
118 Ga0070693_100016399 3300005547 Unclassified 3834
119 Ga0070693_100095804 3300005547 Bacteria 1798
120 Ga0070693_100204481 3300005547 Bacteria 1284
121 Ga0070693_100383805 3300005547 Unclassified 970
122 Ga0070693_100537457 3300005547 Unclassified 835
123 Ga0070704_100008763 3300005549 Bacteria 6085
124 Ga0070704_100097811 3300005549 Unclassified 2203
125 Ga0070704_100100030 3300005549 Unclassified 2182
126 Ga0070704_100127978 3300005549 Bacteria 1963
127 Ga0070704_102257650 3300005549 Unclassified 506
128 Ga0068855_101023089 3300005563 Bacteria 867
129 Ga0068855_101828890 3300005563 Unclassified 617
130 Ga0070664_100003825 3300005564 Bacteria 12152
131 Ga0070664_100227643 3300005564 Unclassified 1670
132 Ga0070664_101076926 3300005564 Bacteria 757
133 Ga0070664_101668172 3300005564 Bacteria 604
134 Ga0068857_100003794 3300005577 Bacteria 12716
135 Ga0068857_100261412 3300005577 Unclassified 1588
136 Ga0068857_100525352 3300005577 Bacteria 1113
137 Ga0068857_100555522 3300005577 Bacteria 1082
138 Ga0068857_100957421 3300005577 Unclassified 823
139 Ga0068857_101156012 3300005577 Bacteria 749
140 Ga0068857_101678722 3300005577 Unclassified 621
141 Ga0068854_100553364 3300005578 Bacteria 976
142 Ga0068854_100948657 3300005578 Unclassified 759
143 Ga0068856_100073874 3300005614 Bacteria 3376
144 Ga0070702_100021459 3300005615 Unclassified 3398
145 Ga0070702_100025583 3300005615 Unclassified 3164
146 Ga0070702_100033665 3300005615 Bacteria 2819
147 Ga0070702_100185959 3300005615 Bacteria 1363
148 Ga0070702_100405385 3300005615 Unclassified 976
149 Ga0068852_100110605 3300005616 Unclassified 2497
150 Ga0068852_101031052 3300005616 Bacteria 842
151 Ga0068859_100012155 3300005617 Bacteria 8652
152 Ga0068859_100014303 3300005617 Bacteria 7960
153 Ga0068859_100055655 3300005617 Bacteria 3980
154 Ga0068859_100072946 3300005617 Bacteria 3470
155 Ga0068859_100202370 3300005617 Unclassified 2070
156 Ga0068859_100233550 3300005617 Bacteria 1928
157 Ga0068859_100430991 3300005617 Bacteria 1415
158 Ga0068859_102850186 3300005617 Bacteria 530
159 Ga0068864_100009677 3300005618 Bacteria 7952
160 Ga0068864_100067598 3300005618 Bacteria 3103
161 Ga0068864_100093107 3300005618 Unclassified 2661
162 Ga0068864_100408581 3300005618 Bacteria 1291
163 Ga0068864_100615851 3300005618 Bacteria 1055
164 Ga0068864_100744972 3300005618 Unclassified 960
165 Ga0068864_100782836 3300005618 Unclassified 936
166 Ga0068864_101717433 3300005618 Unclassified 632
167 Ga0068864_102382251 3300005618 Unclassified 536
168 Ga0068866_10008736 3300005718 Bacteria 4281
169 Ga0068861_100066551 3300005719 Unclassified 2778
170 Ga0068870_10155919 3300005840 Unclassified 1349
171 Ga0068870_10231248 3300005840 Bacteria 1137
172 Ga0068870_10280640 3300005840 Bacteria 1044
173 Ga0068870_10582645 3300005840 Bacteria 758
174 Ga0068863_100073163 3300005841 Unclassified 3242
175 Ga0068863_100088501 3300005841 Bacteria 2934
176 Ga0068863_100100105 3300005841 Bacteria 2754
177 Ga0068863_100422825 3300005841 Bacteria 1305
178 Ga0068863_100656418 3300005841 Bacteria 1040
179 Ga0068863_100823013 3300005841 Bacteria 927
180 Ga0068858_100044468 3300005842 Unclassified 4116
181 Ga0068858_100048180 3300005842 Bacteria 3949
182 Ga0068858_100084247 3300005842 Bacteria 2957
183 Ga0068858_101424899 3300005842 Unclassified 683
184 Ga0068858_101583307 3300005842 Unclassified 646
185 Ga0068858_101666573 3300005842 Bacteria 630
186 Ga0068860_100050408 3300005843 Bacteria 3963
187 Ga0068860_100077347 3300005843 Bacteria 3164
188 Ga0068860_100105967 3300005843 Bacteria 2685
189 Ga0068860_100233990 3300005843 Bacteria 1786
190 Ga0068860_100777538 3300005843 Bacteria 970
191 Ga0068860_101657366 3300005843 Bacteria 661
192 Ga0068862_100008193 3300005844 Bacteria 8640
193 Ga0068862_100301694 3300005844 Unclassified 1474
194 Ga0068862_100424923 3300005844 Bacteria 1248
195 Ga0068862_101034452 3300005844 Bacteria 814
196 Ga0081539_10004393 3300005985 Bacteria 15647
197 Ga0081539_10254855 3300005985 Bacteria 777
198 Ga0070716_100161078 3300006173 Bacteria 1454
199 Ga0097621_100062172 3300006237 Unclassified 3065
200 Ga0097621_100085043 3300006237 Bacteria 2637
201 Ga0097621_101943274 3300006237 Unclassified 562
202 Ga0068871_100001909 3300006358 Bacteria 14090
203 Ga0068871_100060225 3300006358 Bacteria 3096
204 Ga0068871_100950125 3300006358 Unclassified 798
205 Ga0075428_100081118 3300006844 Unclassified 3540
206 Ga0075428_102621995 3300006844 Bacteria 515
207 Ga0075430_100046477 3300006846 Bacteria 3666
208 Ga0075431_100537991 3300006847 Bacteria 1156
209 Ga0075433_10064779 3300006852 Bacteria 3204
210 Ga0075433_10098057 3300006852 Bacteria 2594
211 Ga0075433_10117076 3300006852 Bacteria 2364
212 Ga0075433_10119569 3300006852 Unclassified 2339
213 Ga0075433_10125579 3300006852 Bacteria 2278
214 Ga0075433_10192584 3300006852 Bacteria 1814
215 Ga0075433_10277450 3300006852 Unclassified 1485
216 Ga0075434_100064420 3300006871 Unclassified 3649
217 Ga0075434_100395125 3300006871 Unclassified 1404
218 Ga0075434_100976359 3300006871 Unclassified 861
219 Ga0075429_100115559 3300006880 Bacteria 2346
220 Ga0075429_100301353 3300006880 Bacteria 1403
221 Ga0075429_100551535 3300006880 Bacteria 1010
222 Ga0068865_100001742 3300006881 Bacteria 12771
223 Ga0075436_100035941 3300006914 Unclassified 3418
224 Ga0097620_100012155 3300006931 Bacteria 8652
225 Ga0097620_100014302 3300006931 Bacteria 7960
226 Ga0097620_100055655 3300006931 Bacteria 3980
227 Ga0097620_100072949 3300006931 Bacteria 3470
228 Ga0097620_100202369 3300006931 Unclassified 2070
229 Ga0097620_100233564 3300006931 Bacteria 1928
230 Ga0097620_100431046 3300006931 Bacteria 1415
231 Ga0097620_102850832 3300006931 Bacteria 530
232 Ga0075435_100218401 3300007076 Bacteria 1618
233 Ga0075435_100496718 3300007076 Unclassified 1055
234 Ga0105251_10080883 3300009011 Bacteria 1502
235 Ga0105251_10113395 3300009011 Bacteria 1234
236 Ga0105244_10167484 3300009036 Unclassified 1047
237 Ga0105240_10078482 3300009093 Bacteria 4066
238 Ga0105240_11276250 3300009093 Unclassified 775
239 Ga0105240_11446777 3300009093 Bacteria 721
240 Ga0105240_11531696 3300009093 Bacteria 699
241 Ga0111539_10001823 3300009094 Bacteria 28370
242 Ga0111539_10327527 3300009094 Bacteria 1783
243 Ga0111539_11707972 3300009094 Unclassified 730
244 Ga0105245_10094291 3300009098 Bacteria 2759
245 Ga0105245_10581849 3300009098 Bacteria 1144
246 Ga0105245_10938547 3300009098 Unclassified 908
247 Ga0105245_12454737 3300009098 Unclassified 575
248 Ga0105247_10119754 3300009101 Unclassified 1704
249 Ga0105247_10384033 3300009101 Bacteria 996
250 Ga0105247_11218856 3300009101 Bacteria 600
251 Ga0105247_11454051 3300009101 Unclassified 557
252 Ga0105247_11547829 3300009101 Bacteria 542
253 Ga0114129_10037171 3300009147 Bacteria 6875
254 Ga0114129_10037717 3300009147 Bacteria 6822
255 Ga0114129_10042987 3300009147 Bacteria 6360
256 Ga0114129_10120413 3300009147 Bacteria 3613
257 Ga0114129_10325953 3300009147 Bacteria 2041
258 Ga0105243_10012306 3300009148 Bacteria 6470
259 Ga0105243_10092140 3300009148 Bacteria 2498
260 Ga0105243_10988896 3300009148 Unclassified 843
261 Ga0105243_11183086 3300009148 Unclassified 777
262 Ga0105243_11326802 3300009148 Unclassified 738
263 Ga0105243_11940505 3300009148 Bacteria 622
264 Ga0105243_12976009 3300009148 Bacteria 514
265 Ga0105241_10125935 3300009174 Unclassified 2069
266 Ga0105241_10350669 3300009174 Unclassified 1281
267 Ga0105241_10471533 3300009174 Archaea 1114
268 Ga0105241_10650598 3300009174 Bacteria 957
269 Ga0105241_10726908 3300009174 Bacteria 908
270 Ga0105241_10762827 3300009174 Unclassified 888
271 Ga0105241_10874752 3300009174 Unclassified 833
272 Ga0105241_11571104 3300009174 Unclassified 635
273 Ga0105241_11859052 3300009174 Unclassified 589
274 Ga0105241_12149048 3300009174 Bacteria 553
275 Ga0105242_10184118 3300009176 Unclassified 1845
276 Ga0105242_10291432 3300009176 Bacteria 1486
277 Ga0105242_12241817 3300009176 Bacteria 592
278 Ga0105242_12908514 3300009176 Unclassified 529
279 Ga0105248_10028552 3300009177 Bacteria 6216
280 Ga0105248_10089068 3300009177 Bacteria 3474
281 Ga0105248_10166970 3300009177 Bacteria 2481
282 Ga0105248_10168269 3300009177 Bacteria 2470
283 Ga0105248_10775551 3300009177 Bacteria 1082
284 Ga0105248_11173424 3300009177 Unclassified 868
285 Ga0105248_11766586 3300009177 Unclassified 701
286 Ga0105248_12447803 3300009177 Unclassified 595
287 Ga0105237_10150953 3300009545 Bacteria 2320
288 Ga0105237_10165842 3300009545 Bacteria 2208
289 Ga0105238_10003265 3300009551 Bacteria 16179
290 Ga0105238_10622099 3300009551 Bacteria 1089
291 Ga0105249_10034607 3300009553 Bacteria 4579
292 Ga0105249_10133657 3300009553 Bacteria 2371
293 Ga0105249_12240602 3300009553 Bacteria 619
294 Ga0105239_10297182 3300010375 Bacteria 1818
295 Ga0105239_10349565 3300010375 Bacteria 1669
296 Ga0105239_10536498 3300010375 Bacteria 1332
297 Ga0105239_11018605 3300010375 Unclassified 952
298 Ga0105246_10043358 3300011119 Bacteria 3052
299 Ga0105246_10124288 3300011119 Unclassified 1917
300 Ga0105246_10624225 3300011119 Bacteria 934
301 Ga0105246_10778208 3300011119 Unclassified 847
302 Ga0105246_11524949 3300011119 Bacteria 629
303 Ga0157373_10089893 3300013100 Bacteria 2163
304 Ga0157373_10102894 3300013100 Bacteria 2009
305 Ga0157373_11186479 3300013100 Archaea 575
306 Ga0157373_11196676 3300013100 Unclassified 573
307 Ga0157371_10535516 3300013102 Unclassified 867
308 Ga0157371_10969039 3300013102 Unclassified 648
309 Ga0157374_10021074 3300013296 Bacteria 5793
310 Ga0157378_10060916 3300013297 Bacteria 3367
311 Ga0157378_10929994 3300013297 Unclassified 901
312 Ga0157378_11367125 3300013297 Bacteria 750
313 Ga0163162_10002140 3300013306 Bacteria 18529
314 Ga0163162_11256787 3300013306 Bacteria 841
315 Ga0163162_11330519 3300013306 Bacteria 817
316 Ga0157372_10026279 3300013307 Bacteria 6334
317 Ga0157372_10128556 3300013307 Bacteria 2914
318 Ga0157372_12008750 3300013307 Unclassified 664
319 Ga0157375_11213148 3300013308 Bacteria 885
320 Ga0163163_10007267 3300014325 Bacteria 9766
321 Ga0163163_10025718 3300014325 Bacteria 5614
322 Ga0163163_10031341 3300014325 Bacteria 5130
323 Ga0163163_10038983 3300014325 Unclassified 4634
324 Ga0163163_10164173 3300014325 Bacteria 2267
325 Ga0163163_10168843 3300014325 Bacteria 2234
326 Ga0163163_10858181 3300014325 Bacteria 971
327 Ga0163163_11584290 3300014325 Bacteria 716
328 Ga0157380_10391070 3300014326 Unclassified 1316
329 Ga0157380_10473697 3300014326 Unclassified 1209
330 Ga0157380_11778141 3300014326 Bacteria 675
331 Ga0157377_10090147 3300014745 Bacteria 1809
332 Ga0157377_11425985 3300014745 Unclassified 547
333 Ga0157377_11437236 3300014745 Unclassified 545
334 Ga0157377_11702109 3300014745 Unclassified 509
335 Ga0157379_10026966 3300014968 Bacteria 5113
336 Ga0157379_10061318 3300014968 Bacteria 3363
337 Ga0157379_10094788 3300014968 Bacteria 2678
338 Ga0157379_10386772 3300014968 Bacteria 1284
339 Ga0157379_10468185 3300014968 Unclassified 1165
340 Ga0157376_10003732 3300014969 Bacteria 10522
341 Ga0157376_10037023 3300014969 Bacteria 3956
342 Ga0182005_1065542 3300015265 Unclassified 994
343 Ga0163161_10071789 3300017792 Bacteria 2534
344 Ga0163161_10205394 3300017792 Bacteria 1520
345 Ga0207713_1093830 3300025735 Unclassified 1049
346 Ga0207713_1218413 3300025735 Unclassified 576
347 Ga0207653_10005112 3300025885 Unclassified 4099
348 Ga0207682_10226915 3300025893 Unclassified 865
349 Ga0207710_10232672 3300025900 Bacteria 917
350 Ga0207710_10683687 3300025900 Bacteria 538
351 Ga0207680_10394005 3300025903 Unclassified 978
352 Ga0207680_10880486 3300025903 Unclassified 642
353 Ga0207647_10003725 3300025904 Bacteria 11400
354 Ga0207647_10432951 3300025904 Bacteria 738
355 Ga0207643_10176041 3300025908 Unclassified 1293
356 Ga0207643_10254023 3300025908 Bacteria 1083
357 Ga0207643_10800438 3300025908 Bacteria 611
358 Ga0207684_10001881 3300025910 Bacteria 21837
359 Ga0207654_10070089 3300025911 Bacteria 2080
360 Ga0207654_10169457 3300025911 Bacteria 1417
361 Ga0207654_10179270 3300025911 Unclassified 1381
362 Ga0207654_10900943 3300025911 Unclassified 641
363 Ga0207654_11164176 3300025911 Unclassified 562
364 Ga0207707_10000031 3300025912 Bacteria 159505
365 Ga0207707_10052786 3300025912 Bacteria 3538
366 Ga0207695_10592409 3300025913 Bacteria 990
367 Ga0207695_11013002 3300025913 Unclassified 710
368 Ga0207695_11101221 3300025913 Unclassified 674
369 Ga0207671_10835113 3300025914 Unclassified 730
370 Ga0207671_11146037 3300025914 Unclassified 610
371 Ga0207660_10004070 3300025917 Bacteria 9535
372 Ga0207660_10112483 3300025917 Bacteria 2051
373 Ga0207660_10852305 3300025917 Unclassified 744
374 Ga0207662_10038701 3300025918 Bacteria 2795
375 Ga0207662_10044123 3300025918 Bacteria 2631
376 Ga0207662_10376062 3300025918 Unclassified 959
377 Ga0207657_10082494 3300025919 Unclassified 2699
378 Ga0207657_10300204 3300025919 Unclassified 1272
379 Ga0207657_10634643 3300025919 Unclassified 832
380 Ga0207649_10828152 3300025920 Unclassified 723
381 Ga0207652_10000375 3300025921 Bacteria 46312
382 Ga0207652_10093414 3300025921 Bacteria 2647
383 Ga0207652_10569000 3300025921 Unclassified 1018
384 Ga0207646_10177494 3300025922 Bacteria 1924
385 Ga0207646_10197571 3300025922 Unclassified 1816
386 Ga0207681_10349388 3300025923 Bacteria 1183
387 Ga0207681_10810970 3300025923 Unclassified 782
388 Ga0207681_11759440 3300025923 Bacteria 517
389 Ga0207694_10132447 3300025924 Unclassified 1999
390 Ga0207694_11202709 3300025924 Bacteria 641
391 Ga0207650_10018250 3300025925 Bacteria 4922
392 Ga0207650_10435033 3300025925 Unclassified 1090
393 Ga0207650_10438403 3300025925 Unclassified 1086
394 Ga0207650_11489176 3300025925 Bacteria 575
395 Ga0207659_11170924 3300025926 Unclassified 661
396 Ga0207687_11677447 3300025927 Unclassified 545
397 Ga0207644_10353344 3300025931 Bacteria 1194
398 Ga0207690_10047556 3300025932 Unclassified 2847
399 Ga0207706_10032892 3300025933 Unclassified 4614
400 Ga0207706_10241635 3300025933 Bacteria 1579
401 Ga0207686_10114564 3300025934 Bacteria 1824
402 Ga0207709_10008381 3300025935 Bacteria 5719
403 Ga0207709_10571279 3300025935 Bacteria 892
404 Ga0207709_10955851 3300025935 Unclassified 699
405 Ga0207704_10419576 3300025938 Bacteria 1060
406 Ga0207665_10130488 3300025939 Bacteria 1783
407 Ga0207665_10198171 3300025939 Bacteria 1462
408 Ga0207665_10391540 3300025939 Bacteria 1056
409 Ga0207665_10822445 3300025939 Unclassified 735
410 Ga0207691_10001222 3300025940 Bacteria 25638
411 Ga0207691_10525441 3300025940 Bacteria 1004
412 Ga0207711_10367810 3300025941 Unclassified 1333
413 Ga0207711_10911233 3300025941 Bacteria 817
414 Ga0207711_11357646 3300025941 Bacteria 653
415 Ga0207679_10007697 3300025945 Bacteria 6843
416 Ga0207679_10180832 3300025945 Unclassified 1744
417 Ga0207667_10413340 3300025949 Bacteria 1373
418 Ga0207651_10247049 3300025960 Unclassified 1458
419 Ga0207712_10025809 3300025961 Bacteria 3908
420 Ga0207712_10029128 3300025961 Bacteria 3701
421 Ga0207712_10111860 3300025961 Bacteria 2050
422 Ga0207712_10960418 3300025961 Bacteria 757
423 Ga0207712_11160918 3300025961 Bacteria 688
424 Ga0207640_10051309 3300025981 Bacteria 2681
425 Ga0207640_10606744 3300025981 Unclassified 927
426 Ga0207640_11554121 3300025981 Unclassified 595
427 Ga0207658_10040181 3300025986 Bacteria 3380
428 Ga0207677_11839270 3300026023 Unclassified 562
429 Ga0207703_10105781 3300026035 Unclassified 2392
430 Ga0207703_10194183 3300026035 Unclassified 1800
431 Ga0207703_11393244 3300026035 Bacteria 674
432 Ga0207639_10180865 3300026041 Bacteria 1793
433 Ga0207639_10863174 3300026041 Unclassified 845
434 Ga0207708_10010665 3300026075 Bacteria 6825
435 Ga0207708_10030781 3300026075 Bacteria 4070
436 Ga0207708_10060263 3300026075 Bacteria 2897
437 Ga0207708_10072317 3300026075 Bacteria 2642
438 Ga0207708_10522374 3300026075 Bacteria 998
439 Ga0207708_10554068 3300026075 Bacteria 970
440 Ga0207702_10122843 3300026078 Bacteria 2326
441 Ga0207641_10058313 3300026088 Unclassified 3286
442 Ga0207641_10220537 3300026088 Bacteria 1758
443 Ga0207641_10458850 3300026088 Bacteria 1232
444 Ga0207641_10813384 3300026088 Unclassified 925
445 Ga0207641_10989051 3300026088 Unclassified 838
446 Ga0207641_11258810 3300026088 Unclassified 740
447 Ga0207641_11327965 3300026088 Unclassified 720
448 Ga0207641_12283304 3300026088 Bacteria 541
449 Ga0207648_10012826 3300026089 Bacteria 7828
450 Ga0207648_10083848 3300026089 Unclassified 2780
451 Ga0207648_12140505 3300026089 Unclassified 520
452 Ga0207676_10021600 3300026095 Bacteria 4723
453 Ga0207676_10055248 3300026095 Bacteria 3116
454 Ga0207676_10165742 3300026095 Unclassified 1919
455 Ga0207676_10283415 3300026095 Bacteria 1505
456 Ga0207676_10691922 3300026095 Unclassified 987
457 Ga0207674_10000790 3300026116 Bacteria 41276
458 Ga0207674_10022062 3300026116 Bacteria 6845
459 Ga0207674_10113692 3300026116 Bacteria 2680
460 Ga0207674_10128585 3300026116 Unclassified 2498
461 Ga0207674_10830445 3300026116 Unclassified 891
462 Ga0207675_100001065 3300026118 Bacteria 27234
463 Ga0207675_100073732 3300026118 Bacteria 3193
464 Ga0207675_100088490 3300026118 Bacteria 2909
465 Ga0207675_100324292 3300026118 Bacteria 1504
466 Ga0207683_10190534 3300026121 Bacteria 1862
467 Ga0207698_10101696 3300026142 Unclassified 2384
468 Ga0207698_10948153 3300026142 Bacteria 869
469 Ga0207698_11318814 3300026142 Unclassified 736
470 Ga0207698_12231654 3300026142 Unclassified 560
471 Ga0207428_10124794 3300027907 Unclassified 1972
472 Ga0268265_10061347 3300028380 Bacteria 2885
473 Ga0268265_11784776 3300028380 Unclassified 621
474 Ga0268264_10018284 3300028381 Bacteria 5733
475 Ga0268264_10055967 3300028381 Bacteria 3296
476 Ga0268264_10852222 3300028381 Bacteria 913
477 Ga0268264_10912222 3300028381 Bacteria 882
478 Ga0268264_11806787 3300028381 Unclassified 621
479 Ga0268264_11836145 3300028381 Unclassified 616
480 Ga0316183_1059456 3300030742 Unclassified 528
481 Ga0307408_100124680 3300031548 Bacteria 2001
482 Ga0307408_100918401 3300031548 Unclassified 802
483 Ga0307405_10654433 3300031731 Bacteria 864
484 Ga0307405_11985610 3300031731 Unclassified 520
485 Ga0307413_11041234 3300031824 Viruses 704
486 Ga0307410_10124756 3300031852 Unclassified 1883
487 Ga0307412_10194892 3300031911 Bacteria 1534
488 Ga0307409_100047089 3300031995 Bacteria 3270
489 Ga0307409_101573824 3300031995 Bacteria 685
490 Ga0307416_103701471 3300032002 Unclassified 512
491 Ga0307411_10038838 3300032005 Unclassified 3007
492 Ga0307415_100034997 3300032126 Unclassified 3276
493 Ga0373940_0116646 3300035088 Unclassified 825
494 Ga0373949_0124010 3300035090 Unclassified 728
495 Ga0373951_0252421 3300035091 Unclassified 530
496 Ga0373952_0067357 3300035092 Unclassified 889
497 Ga0373937_0360290 3300036401 Archaea 1378
498 Ga0395899_0571990 3300037312 Bacteria 723
499 Ga0395900_1373669 3300037418 Unclassified 620
500 Ga0395898_0669953 3300037466 Bacteria 980
501 Ga0395905_0438949 3300037471 Bacteria 1203
502 Ga0242420_005428 3300038996 Unclassified 1977
503 Ga0242420_033088 3300038996 Unclassified 966
504 Ga0439444_0162407 3300042437 Unclassified 546
505 Ga0451576_0544128 3300045051 Bacteria 1220
506 Ga0451576_0711772 3300045051 Bacteria 1055
507 Ga0451576_0871806 3300045051 Bacteria 945
508 Ga0451576_2166385 3300045051 Unclassified 571
509 Ga0496102_0076332 3300048905 Bacteria 3082
510 Ga0496102_0536481 3300048905 Bacteria 1093
511 Ga0496102_1688283 3300048905 Bacteria 551
512 Ga0496103_0220241 3300048906 Unclassified 1221
513 Ga0496104_0078629 3300048907 Bacteria 3143
514 Ga0496104_0126269 3300048907 Unclassified 2457
515 Ga0496104_0973722 3300048907 Unclassified 753
516 Ga0496104_1663007 3300048907 Unclassified 541
517 Ga0496106_0136589 3300048909 Bacteria 1926
518 Ga0496106_0763838 3300048909 Unclassified 768
519 Ga0496107_0093478 3300048910 Unclassified 2199
520 Ga0496107_0355955 3300048910 Bacteria 1089
521 Ga0496108_0150642 3300048911 Bacteria 2007
522 Ga0496108_0160098 3300048911 Bacteria 1945
523 Ga0496108_0298297 3300048911 Unclassified 1404
524 Ga0496109_0109084 3300048912 Bacteria 2573
525 Ga0496110_0299078 3300048913 Unclassified 1466
526 Ga0496110_0646012 3300048913 Bacteria 958
527 Ga0496112_0109066 3300048915 Unclassified 2739
528 Ga0496112_0363174 3300048915 Bacteria 1390
529 Ga0496112_0433862 3300048915 Unclassified 1252
530 Ga0496112_0498983 3300048915 Bacteria 1153
531 Ga0496112_0575562 3300048915 Bacteria 1059
532 Ga0496112_1076605 3300048915 Archaea 722
533 Ga0496112_1221606 3300048915 Unclassified 668
534 Ga0496113_0301169 3300048916 Unclassified 1284
535 Ga0496113_0638273 3300048916 Bacteria 852
536 Ga0496113_1608130 3300048916 Bacteria 500
537 Ga0496114_0349503 3300048917 Unclassified 1308
538 Ga0501290_093628 3300049513 Bacteria 526
539 Ga0501292_002422 3300049515 Unclassified 2410
540 Ga0501296_000693 3300049519 Unclassified 3335
541 Ga0501296_004422 3300049519 Bacteria 1536
542 Ga0501297_002180 3300049520 Unclassified 1878
543 Ga0501298_007275 3300049521 Unclassified 1834
544 Ga0501299_001490 3300049522 Unclassified 3028
545 Ga0501299_002470 3300049522 Unclassified 2561
546 Ga0501303_006883 3300049526 Bacteria 1001
547 Ga0501069_0283690 3300049585 Bacteria 969
548 Ga0501198_059842 3300049649 Unclassified 696
549 Ga0501198_086819 3300049649 Bacteria 614
550 Ga0501201_002538 3300049651 Unclassified 1674
551 Ga0501201_046961 3300049651 Unclassified 531
552 Ga0501202_030715 3300049652 Bacteria 1119
553 Ga0501202_082020 3300049652 Unclassified 759
554 Ga0501202_182356 3300049652 Unclassified 567
555 Ga0501208_075195 3300049655 Bacteria 686
556 Ga0501217_015150 3300049661 Bacteria 1752
557 Ga0501224_028468 3300049664 Unclassified 836
558 Ga0501227_015581 3300049665 Unclassified 1699
559 Ga0501227_017279 3300049665 Bacteria 1628
560 Ga0501233_035480 3300049668 Unclassified 1149
561 Ga0501235_001823 3300049669 Unclassified 4567
562 Ga0501235_012584 3300049669 Bacteria 1861
563 Ga0501235_101281 3300049669 Bacteria 704
564 Ga0501240_019169 3300049673 Bacteria 1014
565 Ga0501243_081977 3300049675 Bacteria 629
566 Ga0501249_010084 3300049679 Bacteria 1970
567 Ga0501253_010665 3300049683 Bacteria 1391
568 Ga0501257_073943 3300049686 Bacteria 873
569 Ga0501259_035640 3300049688 Bacteria 959
570 Ga0501225_0012705 3300049705 Unclassified 2363
571 Ga0501225_0133073 3300049705 Unclassified 746
572 Ga0501229_006923 3300049706 Unclassified 1407
573 Ga0501263_095444 3300049760 Unclassified 506
574 Ga0501265_069518 3300049762 Bacteria 592
575 Ga0501270_036638 3300049767 Bacteria 837
576 Ga0501272_009043 3300049769 Bacteria 1098
577 Ga0501280_088473 3300049776 Unclassified 580
578 Ga0501283_001776 3300049779 Unclassified 2796
579 Ga0501283_040299 3300049779 Bacteria 807
580 Ga0501212_007105 3300049851 Unclassified 1526
581 Ga0501212_083100 3300049851 Unclassified 582
582 nmdc:mga05p37_1279577_c1 3300050507 Bacteria 750
583 nmdc:mga05p37_291710_c1 3300050507 Unclassified 1941
584 nmdc:mga05p37_372282_c1 3300050507 Bacteria 1676
585 nmdc:mga05p37_85382_c1 3300050507 Bacteria 3889
586 nmdc:mga09592_112536_c1 3300050508 Bacteria 2335
587 nmdc:mga09592_39400_c1 3300050508 Unclassified 3969
588 nmdc:mga09592_803375_c1 3300050508 Bacteria 795
589 nmdc:mga0qj67_183075_c1 3300050509 Unclassified 1702
590 nmdc:mga0qj67_753414_c1 3300050509 Bacteria 773
591 nmdc:mga0qj67_899338_c1 3300050509 Bacteria 698
592 nmdc:mga06r32_688073_c1 3300050510 Bacteria 989
593 nmdc:mga06r32_847222_c1 3300050510 Bacteria 873
594 nmdc:mga08y16_1720_c1 3300050511 Bacteria 22215
595 nmdc:mga0n895_1096487_c1 3300050512 Unclassified 774
596 nmdc:mga0n895_205873_c1 3300050512 Unclassified 1998
597 nmdc:mga0rr50_942704_c1 3300050513 Unclassified 736
598 nmdc:mga08x19_17942_c1 3300050514 Bacteria 4333
599 nmdc:mga0a205_153325_c1 3300050515 Bacteria 2203
600 nmdc:mga0a205_268062_c1 3300050515 Unclassified 1585
601 nmdc:mga0a205_83063_c1 3300050515 Bacteria 3094
602 nmdc:mga0a205_850804_c1 3300050515 Unclassified 759
603 nmdc:mga0a205_911809_c1 3300050515 Unclassified 726
604 nmdc:mga0a205_92926_c1 3300050515 Bacteria 2915
605 Ga0068852_101673631
606 SwRhRL3b_contig_1266107
607 CNBas_1002431
608 CNAas_1000665
609 JGI25406J46586_10048117
610 Ga0065714_10064454
611 Ga0065704_10076020
612 Ga0065704_10114080
613 Ga0065712_10000129
614 Ga0065715_10015972
615 Ga0065715_10023290
616 Ga0065715_10108203
617 Ga0065715_10125346
618 Ga0065715_10153838
619 Ga0065715_10194224
620 Ga0065715_10196506
621 Ga0065715_10360215
622 Ga0065715_10750726
623 Ga0065707_10002257
624 Ga0070676_10521013
625 Ga0070676_11259206
626 Ga0070683_100831744
627 Ga0070690_100272576
628 Ga0070690_101696047
629 Ga0070670_100027974
630 Ga0070670_100097718
631 Ga0070670_101528586
632 Ga0070677_10521353
633 Ga0068869_100283652
634 Ga0070666_10455785
635 Ga0070666_10795811
636 Ga0070680_100005606
637 Ga0070680_100056565
638 Ga0070682_100018107
639 Ga0070682_100039090
640 Ga0070682_101260181
641 Ga0068868_100689722
642 Ga0070660_100031027
643 Ga0070660_100600319
644 Ga0070660_101935515
645 Ga0070689_100350136
646 Ga0070691_10207597
647 Ga0070687_100907921
648 Ga0070687_101100441
649 Ga0070687_101182902
650 Ga0070661_100231987
651 Ga0070661_100251454
652 Ga0070692_10017150
653 Ga0070692_10028073
654 Ga0070669_100776431
655 Ga0070669_102003673
656 Ga0070673_100174000
657 Ga0070673_100305249
658 Ga0070673_101185815
659 Ga0070673_101359626
660 Ga0070688_100875721
661 Ga0070659_100002273
662 Ga0070667_100159688
663 Ga0070703_10006463
664 Ga0070705_100006565
665 Ga0070705_100235989
666 Ga0070705_101043053
667 Ga0070705_101379140
668 Ga0070700_100006434
669 Ga0070700_100031495
670 Ga0070700_100044794
671 Ga0070700_100047449
672 Ga0070700_100282623
673 Ga0070694_100011628
674 Ga0070694_100016906
675 Ga0070694_100072060
676 Ga0070694_100121504
677 Ga0070694_100293408
678 Ga0070694_100627915
679 Ga0070694_100969626
680 Ga0070708_100831210
681 Ga0070708_102003663
682 Ga0070678_100069303
683 Ga0070678_100322204
684 Ga0070678_100509247
685 Ga0070662_100070622
686 Ga0070662_100161910
687 Ga0070662_100211002
688 Ga0070681_10000362
689 Ga0070681_10015191
690 Ga0070681_12039996
691 Ga0068867_100158240
692 Ga0068867_100228540
693 Ga0068867_101171318
694 Ga0070707_100028094
695 Ga0070707_101755855
696 Ga0070707_102083631
697 Ga0070698_100034683
698 Ga0070699_100002843
699 Ga0070699_100009653
700 Ga0070699_101536367
701 Ga0070679_100000540
702 Ga0070679_100030221
703 Ga0070679_101005384
704 Ga0070684_100919328
705 Ga0070684_101982354
706 Ga0070697_100035763
707 Ga0070697_100489326
708 Ga0070697_101890599
709 Ga0068853_100055988
710 Ga0068853_100486244
711 Ga0068853_101842483
712 Ga0068853_102061365
713 Ga0070672_100066259
714 Ga0070695_100074589
715 Ga0070695_100087375
716 Ga0070695_100098614
717 Ga0070695_100103388
718 Ga0070695_100468587
719 Ga0070695_101063804
720 Ga0070696_100204892
721 Ga0070696_100341009
722 Ga0070693_100016399
723 Ga0070693_100095804
724 Ga0070693_100204481
725 Ga0070693_100383805
726 Ga0070693_100537457
727 Ga0070704_100008763
728 Ga0070704_100097811
729 Ga0070704_100100030
730 Ga0070704_100127978
731 Ga0070704_102257650
732 Ga0068855_101023089
733 Ga0068855_101828890
734 Ga0070664_100003825
735 Ga0070664_100227643
736 Ga0070664_101076926
737 Ga0070664_101668172
738 Ga0068857_100003794
739 Ga0068857_100261412
740 Ga0068857_100525352
741 Ga0068857_100555522
742 Ga0068857_100957421
743 Ga0068857_101156012
744 Ga0068857_101678722
745 Ga0068854_100553364
746 Ga0068854_100948657
747 Ga0068856_100073874
748 Ga0070702_100021459
749 Ga0070702_100025583
750 Ga0070702_100033665
751 Ga0070702_100185959
752 Ga0070702_100405385
753 Ga0068852_100110605
754 Ga0068852_101031052
755 Ga0068859_100012155
756 Ga0068859_100014303
757 Ga0068859_100055655
758 Ga0068859_100072946
759 Ga0068859_100202370
760 Ga0068859_100233550
761 Ga0068859_100430991
762 Ga0068859_102850186
763 Ga0068864_100009677
764 Ga0068864_100067598
765 Ga0068864_100093107
766 Ga0068864_100408581
767 Ga0068864_100615851
768 Ga0068864_100744972
769 Ga0068864_100782836
770 Ga0068864_101717433
771 Ga0068864_102382251
772 Ga0068866_10008736
773 Ga0068861_100066551
774 Ga0068870_10155919
775 Ga0068870_10231248
776 Ga0068870_10280640
777 Ga0068870_10582645
778 Ga0068863_100073163
779 Ga0068863_100088501
780 Ga0068863_100100105
781 Ga0068863_100422825
782 Ga0068863_100656418
783 Ga0068863_100823013
784 Ga0068858_100044468
785 Ga0068858_100048180
786 Ga0068858_100084247
787 Ga0068858_101424899
788 Ga0068858_101583307
789 Ga0068858_101666573
790 Ga0068860_100050408
791 Ga0068860_100077347
792 Ga0068860_100105967
793 Ga0068860_100233990
794 Ga0068860_100777538
795 Ga0068860_101657366
796 Ga0068862_100008193
797 Ga0068862_100301694
798 Ga0068862_100424923
799 Ga0068862_101034452
800 Ga0081539_10004393
801 Ga0081539_10254855
802 Ga0070716_100161078
803 Ga0097621_100062172
804 Ga0097621_100085043
805 Ga0097621_101943274
806 Ga0068871_100001909
807 Ga0068871_100060225
808 Ga0068871_100950125
809 Ga0075428_100081118
810 Ga0075428_102621995
811 Ga0075430_100046477
812 Ga0075431_100537991
813 Ga0075433_10064779
814 Ga0075433_10098057
815 Ga0075433_10117076
816 Ga0075433_10119569
817 Ga0075433_10125579
818 Ga0075433_10192584
819 Ga0075433_10277450
820 Ga0075434_100064420
821 Ga0075434_100395125
822 Ga0075434_100976359
823 Ga0075429_100115559
824 Ga0075429_100301353
825 Ga0075429_100551535
826 Ga0068865_100001742
827 Ga0075436_100035941
828 Ga0097620_100012155
829 Ga0097620_100014302
830 Ga0097620_100055655
831 Ga0097620_100072949
832 Ga0097620_100202369
833 Ga0097620_100233564
834 Ga0097620_100431046
835 Ga0097620_102850832
836 Ga0075435_100218401
837 Ga0075435_100496718
838 Ga0105251_10080883
839 Ga0105251_10113395
840 Ga0105244_10167484
841 Ga0105240_10078482
842 Ga0105240_11276250
843 Ga0105240_11446777
844 Ga0105240_11531696
845 Ga0111539_10001823
846 Ga0111539_10327527
847 Ga0111539_11707972
848 Ga0105245_10094291
849 Ga0105245_10581849
850 Ga0105245_10938547
851 Ga0105245_12454737
852 Ga0105247_10119754
853 Ga0105247_10384033
854 Ga0105247_11218856
855 Ga0105247_11454051
856 Ga0105247_11547829
857 Ga0114129_10037171
858 Ga0114129_10037717
859 Ga0114129_10042987
860 Ga0114129_10120413
861 Ga0114129_10325953
862 Ga0105243_10012306
863 Ga0105243_10092140
864 Ga0105243_10988896
865 Ga0105243_11183086
866 Ga0105243_11326802
867 Ga0105243_11940505
868 Ga0105243_12976009
869 Ga0105241_10125935
870 Ga0105241_10350669
871 Ga0105241_10471533
872 Ga0105241_10650598
873 Ga0105241_10726908
874 Ga0105241_10762827
875 Ga0105241_10874752
876 Ga0105241_11571104
877 Ga0105241_11859052
878 Ga0105241_12149048
879 Ga0105242_10184118
880 Ga0105242_10291432
881 Ga0105242_12241817
882 Ga0105242_12908514
883 Ga0105248_10028552
884 Ga0105248_10089068
885 Ga0105248_10166970
886 Ga0105248_10168269
887 Ga0105248_10775551
888 Ga0105248_11173424
889 Ga0105248_11766586
890 Ga0105248_12447803
891 Ga0105237_10150953
892 Ga0105237_10165842
893 Ga0105238_10003265
894 Ga0105238_10622099
895 Ga0105249_10034607
896 Ga0105249_10133657
897 Ga0105249_12240602
898 Ga0105239_10297182
899 Ga0105239_10349565
900 Ga0105239_10536498
901 Ga0105239_11018605
902 Ga0105246_10043358
903 Ga0105246_10124288
904 Ga0105246_10624225
905 Ga0105246_10778208
906 Ga0105246_11524949
907 Ga0157373_10089893
908 Ga0157373_10102894
909 Ga0157373_11186479
910 Ga0157373_11196676
911 Ga0157371_10535516
912 Ga0157371_10969039
913 Ga0157374_10021074
914 Ga0157378_10060916
915 Ga0157378_10929994
916 Ga0157378_11367125
917 Ga0163162_10002140
918 Ga0163162_11256787
919 Ga0163162_11330519
920 Ga0157372_10026279
921 Ga0157372_10128556
922 Ga0157372_12008750
923 Ga0157375_11213148
924 Ga0163163_10007267
925 Ga0163163_10025718
926 Ga0163163_10031341
927 Ga0163163_10038983
928 Ga0163163_10164173
929 Ga0163163_10168843
930 Ga0163163_10858181
931 Ga0163163_11584290
932 Ga0157380_10391070
933 Ga0157380_10473697
934 Ga0157380_11778141
935 Ga0157377_10090147
936 Ga0157377_11425985
937 Ga0157377_11437236
938 Ga0157377_11702109
939 Ga0157379_10026966
940 Ga0157379_10061318
941 Ga0157379_10094788
942 Ga0157379_10386772
943 Ga0157379_10468185
944 Ga0157376_10003732
945 Ga0157376_10037023
946 Ga0182005_1065542
947 Ga0163161_10071789
948 Ga0163161_10205394
949 Ga0207713_1093830
950 Ga0207713_1218413
951 Ga0207653_10005112
952 Ga0207682_10226915
953 Ga0207710_10232672
954 Ga0207710_10683687
955 Ga0207680_10394005
956 Ga0207680_10880486
957 Ga0207647_10003725
958 Ga0207647_10432951
959 Ga0207643_10176041
960 Ga0207643_10254023
961 Ga0207643_10800438
962 Ga0207684_10001881
963 Ga0207654_10070089
964 Ga0207654_10169457
965 Ga0207654_10179270
966 Ga0207654_10900943
967 Ga0207654_11164176
968 Ga0207707_10000031
969 Ga0207707_10052786
970 Ga0207695_10592409
971 Ga0207695_11013002
972 Ga0207695_11101221
973 Ga0207671_10835113
974 Ga0207671_11146037
975 Ga0207660_10004070
976 Ga0207660_10112483
977 Ga0207660_10852305
978 Ga0207662_10038701
979 Ga0207662_10044123
980 Ga0207662_10376062
981 Ga0207657_10082494
982 Ga0207657_10300204
983 Ga0207657_10634643
984 Ga0207649_10828152
985 Ga0207652_10000375
986 Ga0207652_10093414
987 Ga0207652_10569000
988 Ga0207646_10177494
989 Ga0207646_10197571
990 Ga0207681_10349388
991 Ga0207681_10810970
992 Ga0207681_11759440
993 Ga0207694_10132447
994 Ga0207694_11202709
995 Ga0207650_10018250
996 Ga0207650_10435033
997 Ga0207650_10438403
998 Ga0207650_11489176
999 Ga0207659_11170924
1000 Ga0207687_11677447
1001 Ga0207644_10353344
1002 Ga0207690_10047556
1003 Ga0207706_10032892
1004 Ga0207706_10241635
1005 Ga0207686_10114564
1006 Ga0207709_10008381
1007 Ga0207709_10571279
1008 Ga0207709_10955851
1009 Ga0207704_10419576
1010 Ga0207665_10130488
1011 Ga0207665_10198171
1012 Ga0207665_10391540
1013 Ga0207665_10822445
1014 Ga0207691_10001222
1015 Ga0207691_10525441
1016 Ga0207711_10367810
1017 Ga0207711_10911233
1018 Ga0207711_11357646
1019 Ga0207679_10007697
1020 Ga0207679_10180832
1021 Ga0207667_10413340
1022 Ga0207651_10247049
1023 Ga0207712_10025809
1024 Ga0207712_10029128
1025 Ga0207712_10111860
1026 Ga0207712_10960418
1027 Ga0207712_11160918
1028 Ga0207640_10051309
1029 Ga0207640_10606744
1030 Ga0207640_11554121
1031 Ga0207658_10040181
1032 Ga0207677_11839270
1033 Ga0207703_10105781
1034 Ga0207703_10194183
1035 Ga0207703_11393244
1036 Ga0207639_10180865
1037 Ga0207639_10863174
1038 Ga0207708_10010665
1039 Ga0207708_10030781
1040 Ga0207708_10060263
1041 Ga0207708_10072317
1042 Ga0207708_10522374
1043 Ga0207708_10554068
1044 Ga0207702_10122843
1045 Ga0207641_10058313
1046 Ga0207641_10220537
1047 Ga0207641_10458850
1048 Ga0207641_10813384
1049 Ga0207641_10989051
1050 Ga0207641_11258810
1051 Ga0207641_11327965
1052 Ga0207641_12283304
1053 Ga0207648_10012826
1054 Ga0207648_10083848
1055 Ga0207648_12140505
1056 Ga0207676_10021600
1057 Ga0207676_10055248
1058 Ga0207676_10165742
1059 Ga0207676_10283415
1060 Ga0207676_10691922
1061 Ga0207674_10000790
1062 Ga0207674_10022062
1063 Ga0207674_10113692
1064 Ga0207674_10128585
1065 Ga0207674_10830445
1066 Ga0207675_100001065
1067 Ga0207675_100073732
1068 Ga0207675_100088490
1069 Ga0207675_100324292
1070 Ga0207683_10190534
1071 Ga0207698_10101696
1072 Ga0207698_10948153
1073 Ga0207698_11318814
1074 Ga0207698_12231654
1075 Ga0207428_10124794
1076 Ga0268265_10061347
1077 Ga0268265_11784776
1078 Ga0268264_10018284
1079 Ga0268264_10055967
1080 Ga0268264_10852222
1081 Ga0268264_10912222
1082 Ga0268264_11806787
1083 Ga0268264_11836145
1084 Ga0316183_1059456
1085 Ga0307408_100124680
1086 Ga0307408_100918401
1087 Ga0307405_10654433
1088 Ga0307405_11985610
1089 Ga0307413_11041234
1090 Ga0307410_10124756
1091 Ga0307412_10194892
1092 Ga0307409_100047089
1093 Ga0307409_101573824
1094 Ga0307416_103701471
1095 Ga0307411_10038838
1096 Ga0307415_100034997
1097 Ga0373940_0116646
1098 Ga0373949_0124010
1099 Ga0373951_0252421
1100 Ga0373952_0067357
1101 Ga0373937_0360290
1102 Ga0395899_0571990
1103 Ga0395900_1373669
1104 Ga0395898_0669953
1105 Ga0395905_0438949
1106 Ga0242420_005428
1107 Ga0242420_033088
1108 Ga0439444_0162407
1109 Ga0451576_0544128
1110 Ga0451576_0711772
1111 Ga0451576_0871806
1112 Ga0451576_2166385
1113 Ga0496102_0076332
1114 Ga0496102_0536481
1115 Ga0496102_1688283
1116 Ga0496103_0220241
1117 Ga0496104_0078629
1118 Ga0496104_0126269
1119 Ga0496104_0973722
1120 Ga0496104_1663007
1121 Ga0496106_0136589
1122 Ga0496106_0763838
1123 Ga0496107_0093478
1124 Ga0496107_0355955
1125 Ga0496108_0150642
1126 Ga0496108_0160098
1127 Ga0496108_0298297
1128 Ga0496109_0109084
1129 Ga0496110_0299078
1130 Ga0496110_0646012
1131 Ga0496112_0109066
1132 Ga0496112_0363174
1133 Ga0496112_0433862
1134 Ga0496112_0498983
1135 Ga0496112_0575562
1136 Ga0496112_1076605
1137 Ga0496112_1221606
1138 Ga0496113_0301169
1139 Ga0496113_0638273
1140 Ga0496113_1608130
1141 Ga0496114_0349503
1142 Ga0501290_093628
1143 Ga0501292_002422
1144 Ga0501296_000693
1145 Ga0501296_004422
1146 Ga0501297_002180
1147 Ga0501298_007275
1148 Ga0501299_001490
1149 Ga0501299_002470
1150 Ga0501303_006883
1151 Ga0501069_0283690
1152 Ga0501198_059842
1153 Ga0501198_086819
1154 Ga0501201_002538
1155 Ga0501201_046961
1156 Ga0501202_030715
1157 Ga0501202_082020
1158 Ga0501202_182356
1159 Ga0501208_075195
1160 Ga0501217_015150
1161 Ga0501224_028468
1162 Ga0501227_015581
1163 Ga0501227_017279
1164 Ga0501233_035480
1165 Ga0501235_001823
1166 Ga0501235_012584
1167 Ga0501235_101281
1168 Ga0501240_019169
1169 Ga0501243_081977
1170 Ga0501249_010084
1171 Ga0501253_010665
1172 Ga0501257_073943
1173 Ga0501259_035640
1174 Ga0501225_0012705
1175 Ga0501225_0133073
1176 Ga0501229_006923
1177 Ga0501263_095444
1178 Ga0501265_069518
1179 Ga0501270_036638
1180 Ga0501272_009043
1181 Ga0501280_088473
1182 Ga0501283_001776
1183 Ga0501283_040299
1184 Ga0501212_007105
1185 Ga0501212_083100
1186 nmdc:mga05p37_1279577_c1
1187 nmdc:mga05p37_291710_c1
1188 nmdc:mga05p37_372282_c1
1189 nmdc:mga05p37_85382_c1
1190 nmdc:mga09592_112536_c1
1191 nmdc:mga09592_39400_c1
1192 nmdc:mga09592_803375_c1
1193 nmdc:mga0qj67_183075_c1
1194 nmdc:mga0qj67_753414_c1
1195 nmdc:mga0qj67_899338_c1
1196 nmdc:mga06r32_688073_c1
1197 nmdc:mga06r32_847222_c1
1198 nmdc:mga08y16_1720_c1
1199 nmdc:mga0n895_1096487_c1
1200 nmdc:mga0n895_205873_c1
1201 nmdc:mga0rr50_942704_c1
1202 nmdc:mga08x19_17942_c1
1203 nmdc:mga0a205_153325_c1
1204 nmdc:mga0a205_268062_c1
1205 nmdc:mga0a205_83063_c1
1206 nmdc:mga0a205_850804_c1
1207 nmdc:mga0a205_911809_c1
1208 nmdc:mga0a205_92926_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09527

ATPase_gene1

Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter

21

73

0.93

Map